Diaphorina citri psyllid: psy6726

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MVYPSVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAGVTVLISIYALHRDPKYYPSPGRFDPSRWMRFRFRGDKTSAPLLELPLIPTSFVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAVE
cHHHHHHHHHHHHccccccccccHHHcccccHHHHHHHHHcccccccccccccccccEEEccEEEccccEEEEEEEHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHcccccHHHHHHHHccccccccccccEEEcccCEEccCECcccc
MVYPSVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAGVTVLISIYALHRDPKYYPSPGRFDPSRWMRFRFRGDKTSAPLLELPLIPTSFVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYPSVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAGVTVLISIYALHRDPKYYPSPGRFDPSRWMRFRFRGDKTSAPLLELPLIPTSFVLEEIDRVLGRNTTHCPSYEDLCQLEYLECVIKETLRLFPAAPLIGRHIDEDFILDGLTIPAVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070989 [BP]oxidative demethylationprobableGO:0070988, GO:0044710, GO:0008150, GO:0008152, GO:0055114
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0048252 [BP]lauric acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044237, GO:0008152, GO:0043436, GO:0044255, GO:0051791, GO:0044281
GO:0043651 [BP]linoleic acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0043436, GO:0008150, GO:0019752, GO:0008152, GO:0001676, GO:0044255, GO:0033559, GO:0044281
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0009820 [BP]alkaloid metabolic processprobableGO:0008150, GO:0071704, GO:0006807, GO:1901564, GO:0008152
GO:0019369 [BP]arachidonic acid metabolic processprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0016709 [MF]oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygenprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0042343 [BP]indole glucosinolate metabolic processprobableGO:0019757, GO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0071704, GO:0009987, GO:0019760, GO:0019748, GO:0006725, GO:0016143, GO:0008150, GO:0008152, GO:0043436, GO:0042430, GO:0046483, GO:1901564, GO:0006082, GO:1901135, GO:0044237, GO:1901657, GO:0006790
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010430 [BP]fatty acid omega-oxidationprobableGO:0034440, GO:0006631, GO:0006629, GO:0006082, GO:0044238, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0019395, GO:0044255, GO:0030258, GO:0055114, GO:0044281
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0008391 [MF]arachidonic acid monooxygenase activityprobableGO:0003824, GO:0004497, GO:0016705, GO:0003674, GO:0016491
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:1901615 [BP]organic hydroxy compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0018685 [MF]alkane 1-monooxygenase activityprobableGO:0004497, GO:0016705, GO:0016713, GO:0003824, GO:0003674, GO:0016491
GO:1901576 [BP]organic substance biosynthetic processprobableGO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:1901575 [BP]organic substance catabolic processprobableGO:0008150, GO:0071704, GO:0009056, GO:0008152
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044249 [BP]cellular biosynthetic processprobableGO:0009058, GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0017144 [BP]drug metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0044248 [BP]cellular catabolic processprobableGO:0008150, GO:0009987, GO:0009056, GO:0008152, GO:0044237

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CZH, chain A
Confidence level:very confident
Coverage over the Query: 1-132
View the alignment between query and template
View the model in PyMOL
Template: 3K9V, chain A
Confidence level:very confident
Coverage over the Query: 118-184
View the alignment between query and template
View the model in PyMOL