Diaphorina citri psyllid: psy6731

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MSDAGNWCLIESDPGVFTELIRGFGVQGVQVEELWSLEPENLKILQPVHGLIFLFKLREDTEPAGSIVQDSRLETIFFAKQVVNNACATQAILSILLNNSDPEVKLGSVLTEFKDFCQSFDPTMKGYALSNSQPIRTVHNSFARYSSEEIRFNLLAVVCDKKMKYEKELAAATQALKDPSLDAATKTAKQNEVVQLKILIEEEAAKLESYRIENIRRKHNYLPLIMNLLKLLAKQGQLVNLYQKAVELNSSKKEKVKP
ccccccccccccccHHHHHHHHHccccccEEEEcccccccHHcccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccccHHHHHHHccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccc
****GNWCLIESDPGVFTELIRGFGVQGVQVEELWSLEPENLKILQPVHGLIFLFKLREDTEPAGSIVQDSRLETIFFAKQVVNNACATQAILSILLNNSDPEVKLGSVLTEFKDFCQSFDPTMKGYALSNSQPIRTVHNSFARYSSEEIRFNLLAVVCDKKMKYEKELAA************ATKTAKQNEVVQLKILIEEEAAKLESYRIENIRRKHNYLPLIMNLLKLLAKQGQLVNLYQKAV************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDAGNWCLIESDPGVFTELIRGFGVQGVQVEELWSLEPENLKILQPVHGLIFLFKLREDTEPAGSIVQDSRLETIFFAKQVVNNACATQAILSILLNNSDPEVKLGSVLTEFKDFCQSFDPTMKGYALSNSQPIRTVHNSFARYSSEEIRFNLLAVVCDKKMKYEKELAAATQALKDPSLDAATKTAKQNExxxxxxxxxxxxxxxxxxxxxNIRRKHNYLPLIMNLLKLLAKQGQLVNLYQKAVELNSSKKEKVKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 2 Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin.confidentQ9UUB6
Ubiquitin carboxyl-terminal hydrolase isozyme L5 Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.confidentQ9XSJ0
Ubiquitin carboxyl-terminal hydrolase isozyme L5 Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.confidentQ9Y5K5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0010951 [BP]negative regulation of endopeptidase activityprobableGO:0051336, GO:0051346, GO:0019222, GO:0052547, GO:0052548, GO:0050790, GO:0050789, GO:0010466, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0043086
GO:0004221 [MF]ubiquitin thiolesterase activityprobableGO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0070628 [MF]proteasome bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0031011 [CC]Ino80 complexprobableGO:0033202, GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0070603, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0097346, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0008242 [MF]omega peptidase activityprobableGO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0048853 [BP]forebrain morphogenesisprobableGO:0032502, GO:0009887, GO:0044707, GO:0007420, GO:0007399, GO:0048854, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0021670 [BP]lateral ventricle developmentprobableGO:0021537, GO:0032502, GO:0044707, GO:0021591, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030901 [BP]midbrain developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0061136 [BP]regulation of proteasomal protein catabolic processprobableGO:0009894, GO:0032268, GO:0080090, GO:0031329, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0008150, GO:0042176, GO:0030162, GO:0065007, GO:0019222, GO:0050789
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0004866 [MF]endopeptidase inhibitor activityprobableGO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135
GO:0006310 [BP]DNA recombinationprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0000502 [CC]proteasome complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0034399 [CC]nuclear peripheryprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHR, chain A
Confidence level:very confident
Coverage over the Query: 6-241
View the alignment between query and template
View the model in PyMOL