Query         psy6739
Match_columns 56
No_of_seqs    112 out of 1059
Neff          8.4 
Searched_HMMs 46136
Date          Fri Aug 16 17:12:47 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6739.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6739hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0100|consensus               99.7 4.7E-17   1E-21  102.7   5.7   56    1-56    490-545 (663)
  2 KOG0102|consensus               99.5 6.7E-14 1.4E-18   90.1   3.9   54    2-56    479-532 (640)
  3 PTZ00186 heat shock 70 kDa pre  99.4 3.7E-13   8E-18   88.1   5.8   54    2-56    479-532 (657)
  4 KOG0101|consensus               99.4 2.5E-13 5.5E-18   88.3   4.8   56    1-56    464-519 (620)
  5 PRK01433 hscA chaperone protei  99.3   3E-12 6.5E-17   83.1   6.0   54    2-56    434-487 (595)
  6 PRK05183 hscA chaperone protei  99.2 1.9E-11   4E-16   79.6   5.3   54    2-56    456-509 (616)
  7 TIGR01991 HscA Fe-S protein as  99.2 2.4E-11 5.2E-16   78.9   5.5   54    2-56    440-493 (599)
  8 PRK13410 molecular chaperone D  99.2 3.7E-11   8E-16   78.9   5.3   54    2-56    454-507 (668)
  9 COG0443 DnaK Molecular chapero  99.1 8.1E-11 1.8E-15   76.4   5.3   54    2-56    435-488 (579)
 10 PRK13411 molecular chaperone D  99.1 2.4E-10 5.2E-15   74.9   5.5   54    2-56    454-507 (653)
 11 PLN03184 chloroplast Hsp70; Pr  99.0 4.7E-10   1E-14   73.8   5.4   54    2-56    491-544 (673)
 12 PTZ00400 DnaK-type molecular c  99.0 8.9E-10 1.9E-14   72.4   6.0   54    2-56    493-546 (663)
 13 CHL00094 dnaK heat shock prote  99.0   7E-10 1.5E-14   72.3   4.9   54    2-56    454-507 (621)
 14 PRK00290 dnaK molecular chaper  99.0 1.2E-09 2.5E-14   71.2   5.7   54    2-56    452-505 (627)
 15 PTZ00009 heat shock 70 kDa pro  99.0 1.3E-09 2.9E-14   71.4   5.8   55    2-56    463-517 (653)
 16 TIGR02350 prok_dnaK chaperone   99.0 2.6E-09 5.7E-14   69.1   6.2   54    2-56    450-503 (595)
 17 PF00012 HSP70:  Hsp70 protein;  98.4 7.6E-07 1.7E-11   57.3   5.6   53    2-55    456-508 (602)
 18 KOG3591|consensus               93.0    0.27 5.8E-06   28.2   4.0   39    8-46    123-163 (173)
 19 cd06480 ACD_HspB8_like Alpha-c  91.6    0.28 6.1E-06   25.4   2.7   24    8-31     66-89  (91)
 20 cd06477 ACD_HspB3_Like Alpha c  89.6    0.54 1.2E-05   23.8   2.7   25    9-33     59-83  (83)
 21 PF13103 TonB_2:  TonB C termin  88.3     1.7 3.7E-05   21.3   4.0   19   10-28     23-41  (85)
 22 PF07865 DUF1652:  Protein of u  87.3     1.7 3.8E-05   21.5   3.6   25   15-39     15-39  (69)
 23 cd06476 ACD_HspB2_like Alpha c  87.1    0.93   2E-05   22.9   2.6   23    9-31     59-81  (83)
 24 COG1334 FlaG Uncharacterized f  85.4     1.6 3.5E-05   23.8   3.1   25   15-39     67-92  (120)
 25 PF13670 PepSY_2:  Peptidase pr  83.9     3.8 8.3E-05   20.3   4.8   36   17-53     46-81  (83)
 26 cd06497 ACD_alphaA-crystallin_  82.1     1.4   3E-05   22.3   1.9   16   16-31     69-84  (86)
 27 cd06479 ACD_HspB7_like Alpha c  81.3     1.6 3.4E-05   22.0   1.9   18   15-32     63-80  (81)
 28 cd06478 ACD_HspB4-5-6 Alpha-cr  81.2     1.5 3.2E-05   22.0   1.8   16   16-31     66-81  (83)
 29 PF03646 FlaG:  FlaG protein;    81.0     2.7 5.8E-05   21.9   2.8   26   14-39     54-80  (107)
 30 PRK10050 curli assembly protei  79.5     8.8 0.00019   21.5   5.5   31   15-46    100-130 (138)
 31 cd06498 ACD_alphaB-crystallin_  79.1     1.7 3.8E-05   21.8   1.7   23    9-31     59-81  (84)
 32 cd04030 C2C_KIAA1228 C2 domain  78.1     5.9 0.00013   20.6   3.6   21    9-31      1-22  (127)
 33 PF11211 DUF2997:  Protein of u  77.9     3.5 7.5E-05   18.9   2.3   17   17-33      1-17  (48)
 34 PF10614 CsgF:  Type VIII secre  76.6      11 0.00023   21.2   4.5   30   15-45    109-138 (142)
 35 PF03544 TonB_C:  Gram-negative  75.7     7.1 0.00015   18.5   3.3   15   14-28     17-31  (79)
 36 PF03072 DUF237:  MG032/MG096/M  75.4     4.4 9.6E-05   22.7   2.7   21    2-24     79-99  (137)
 37 cd06481 ACD_HspB9_like Alpha c  73.5     3.3 7.1E-05   20.9   1.8   15   17-31     71-85  (87)
 38 PRK08868 flagellar protein Fla  72.7       8 0.00017   21.8   3.3   25   15-39     89-114 (144)
 39 PF05593 RHS_repeat:  RHS Repea  71.8     6.2 0.00013   16.7   2.3   13   17-29     18-30  (38)
 40 PRK08452 flagellar protein Fla  71.0     9.9 0.00022   20.8   3.4   25   15-39     71-96  (124)
 41 PRK07738 flagellar protein Fla  69.6      11 0.00023   20.5   3.3   25   15-39     64-89  (117)
 42 cd06526 metazoan_ACD Alpha-cry  66.3     5.9 0.00013   19.5   1.8   15   17-31     67-81  (83)
 43 PF00011 HSP20:  Hsp20/alpha cr  65.0      16 0.00036   18.3   3.6   20   17-37     72-91  (102)
 44 TIGR01352 tonB_Cterm TonB fami  62.8      15 0.00033   17.1   3.9   15   14-28     11-25  (74)
 45 cd08381 C2B_PI3K_class_II C2 d  62.7      17 0.00038   19.1   3.3   17   14-31      3-19  (122)
 46 cd06475 ACD_HspB1_like Alpha c  60.9     7.7 0.00017   19.5   1.7   16   16-31     69-84  (86)
 47 PF05691 Raffinose_syn:  Raffin  58.4     9.8 0.00021   26.7   2.2   16   15-30    731-746 (747)
 48 COG0810 TonB Periplasmic prote  55.6      15 0.00033   21.8   2.6   15   13-27    180-194 (244)
 49 PF09264 Sial-lect-inser:  Vibr  55.4      22 0.00048   21.0   3.1   21   11-31     55-75  (198)
 50 COG2017 GalM Galactose mutarot  55.4      27 0.00059   21.5   3.7   25   12-37    131-155 (308)
 51 COG0315 MoaC Molybdenum cofact  55.1      39 0.00084   19.4   4.4   26   13-38     82-107 (157)
 52 PF08758 Cadherin_pro:  Cadheri  55.0      28 0.00062   17.8   3.3   29   18-46     47-75  (90)
 53 cd08388 C2A_Synaptotagmin-4-11  54.3      32  0.0007   18.2   3.7   18   14-31      4-22  (128)
 54 cd00276 C2B_Synaptotagmin C2 d  53.1      32 0.00069   17.8   3.4   20   14-33      2-22  (134)
 55 PF11975 Glyco_hydro_4C:  Famil  53.0      14 0.00031   21.6   2.1   25    5-30    164-188 (232)
 56 cd04026 C2_PKC_alpha_gamma C2   52.9      33 0.00071   17.9   3.7   18   14-32      3-20  (131)
 57 cd08392 C2A_SLP-3 C2 domain fi  51.9      36 0.00079   18.1   3.7   19   14-32      3-22  (128)
 58 PF01263 Aldose_epim:  Aldose 1  49.6      45 0.00097   19.8   3.9   25   13-37    123-147 (300)
 59 PF13581 HATPase_c_2:  Histidin  48.9      37 0.00081   17.4   4.0   25   13-38     54-78  (125)
 60 PRK10819 transport protein Ton  48.8      24 0.00052   21.3   2.6   15   14-28    182-196 (246)
 61 PF11720 Inhibitor_I78:  Peptid  48.7      20 0.00044   16.9   1.9   12   16-27     43-54  (60)
 62 PRK10743 heat shock protein Ib  48.1      24 0.00052   19.4   2.4   11   23-33    113-123 (137)
 63 cd08384 C2B_Rabphilin_Doc2 C2   47.7      41 0.00088   17.6   3.2   19   14-32      1-20  (133)
 64 cd08408 C2B_Synaptotagmin-14_1  47.6      45 0.00098   18.0   3.4   19   13-31      2-21  (138)
 65 cd08521 C2A_SLP C2 domain firs  47.4      40 0.00086   17.2   3.6   19   14-32      2-21  (123)
 66 PF02768 DNA_pol3_beta_3:  DNA   47.3      41  0.0009   17.4   3.3   24   17-41     37-60  (121)
 67 PF13595 DUF4138:  Domain of un  46.7      56  0.0012   19.8   4.0   30   18-47    209-238 (246)
 68 PF02929 Bgal_small_N:  Beta ga  46.5      36 0.00078   20.7   3.2   25   13-37     98-122 (276)
 69 cd08385 C2A_Synaptotagmin-1-5-  46.2      43 0.00092   17.3   3.5   19   14-32      4-23  (124)
 70 cd04029 C2A_SLP-4_5 C2 domain   46.2      45 0.00098   17.5   3.4   19   14-32      3-22  (125)
 71 cd08387 C2A_Synaptotagmin-8 C2  46.0      43 0.00093   17.3   3.6   19   14-32      4-23  (124)
 72 PF04314 DUF461:  Protein of un  45.2      29 0.00063   18.1   2.4   20    9-29     90-109 (110)
 73 COG0071 IbpA Molecular chapero  45.1      23  0.0005   19.3   2.1   13   23-35    122-134 (146)
 74 cd08393 C2A_SLP-1_2 C2 domain   45.1      47   0.001   17.4   3.8   19   14-32      3-22  (125)
 75 PF10955 DUF2757:  Protein of u  45.1      32  0.0007   17.3   2.4   16   18-33     40-55  (76)
 76 PF04225 OapA:  Opacity-associa  44.6      27 0.00059   17.6   2.1   16   15-30     47-62  (85)
 77 PF13127 DUF3955:  Protein of u  44.4      15 0.00033   17.7   1.1    9   20-28     27-35  (63)
 78 cd01419 MoaC_A MoaC family, ar  43.4      61  0.0013   18.3   4.3   25   12-37     67-91  (141)
 79 COG2892 Uncharacterized protei  43.4      37  0.0008   17.4   2.4   22   14-35     34-56  (82)
 80 cd01420 MoaC_PE MoaC family, p  43.3      61  0.0013   18.2   4.4   28   11-38     66-94  (140)
 81 PF15534 Toxin_56:  Putative to  43.2      40 0.00086   17.0   2.6   17   14-31     59-75  (79)
 82 COG4585 Signal transduction hi  43.2      69  0.0015   19.8   4.1   28   12-40    297-324 (365)
 83 PRK11597 heat shock chaperone   43.1      48   0.001   18.4   3.1   25   23-47    111-137 (142)
 84 cd08680 C2_Kibra C2 domain fou  42.6      54  0.0012   17.4   3.4   18   14-31      2-20  (124)
 85 PF09972 DUF2207:  Predicted me  41.5      41 0.00088   21.4   3.0   18   13-30      5-22  (511)
 86 TIGR01643 YD_repeat_2x YD repe  40.2      33 0.00072   14.3   3.9   14   16-29     17-30  (42)
 87 cd06482 ACD_HspB10 Alpha cryst  39.9      32  0.0007   17.4   2.0   17   15-31     69-85  (87)
 88 PF02294 7kD_DNA_binding:  7kD   39.9      21 0.00047   16.8   1.2   12   16-27     28-40  (62)
 89 cd08390 C2A_Synaptotagmin-15-1  39.6      56  0.0012   16.7   3.8   19   14-32      2-21  (123)
 90 TIGR02794 tolA_full TolA prote  38.1      81  0.0018   20.1   3.9   22    7-29    280-301 (346)
 91 PF09244 DUF1964:  Domain of un  38.1      51  0.0011   16.1   2.4   32   18-49      5-36  (68)
 92 cd05197 GH4_glycoside_hydrolas  38.0      44 0.00095   21.8   2.7   25    5-30    341-365 (425)
 93 PF13750 Big_3_3:  Bacterial Ig  37.6      72  0.0016   17.9   3.3   30   22-51    122-152 (158)
 94 PF15417 DUF4624:  Domain of un  37.5      37 0.00081   18.6   2.0   17   14-30     50-67  (132)
 95 cd08685 C2_RGS-like C2 domain   37.2      65  0.0014   16.8   3.5   18   14-32      2-19  (119)
 96 PF15043 CNRIP1:  CB1 cannabino  37.2      82  0.0018   18.2   3.5   29    3-31     89-118 (161)
 97 PF06903 VirK:  VirK protein;    37.2      66  0.0014   17.0   2.9   18   17-34     77-94  (100)
 98 PF02144 Rad1:  Repair protein   37.1      34 0.00074   20.8   2.1   16   15-30    257-272 (275)
 99 COG3061 OapA Cell envelope opa  37.0   1E+02  0.0022   18.9   5.0   27    8-37    200-226 (242)
100 cd08405 C2B_Synaptotagmin-7 C2  36.9      67  0.0015   16.9   3.6   19   14-32      3-22  (136)
101 PF08772 NOB1_Zn_bind:  Nin one  36.7      15 0.00033   18.3   0.4   18   14-31     35-52  (73)
102 cd04035 C2A_Rabphilin_Doc2 C2   36.4      65  0.0014   16.6   3.5   19   14-32      3-22  (123)
103 PF15283 DUF4595:  Domain of un  35.7      89  0.0019   17.9   4.4   15   14-28     71-85  (197)
104 PF10296 DUF2404:  Putative int  34.8      66  0.0014   16.1   3.9   25    8-32     64-88  (91)
105 cd04031 C2A_RIM1alpha C2 domai  34.1      71  0.0015   16.3   3.5   19   14-32      4-23  (125)
106 cd06472 ACD_ScHsp26_like Alpha  33.8      58  0.0013   16.2   2.4   17   17-33     25-41  (92)
107 cd00528 MoaC MoaC family. Memb  33.2      93   0.002   17.4   4.3   27   12-38     67-94  (136)
108 PLN02982 galactinol-raffinose   33.1   1E+02  0.0022   22.4   4.0   19   15-33    833-851 (865)
109 cd08677 C2A_Synaptotagmin-13 C  33.0      85  0.0018   16.9   3.8   20   14-33      2-22  (118)
110 cd05297 GH4_alpha_glucosidase_  32.7      57  0.0012   21.1   2.6   25    5-30    338-362 (423)
111 PF04398 DUF538:  Protein of un  32.6      73  0.0016   16.9   2.7   24    4-31     10-36  (110)
112 cd05296 GH4_P_beta_glucosidase  32.5      61  0.0013   21.1   2.7   25    5-30    330-354 (419)
113 PLN02711 Probable galactinol--  32.5 1.1E+02  0.0023   22.0   4.0   29   15-44    747-775 (777)
114 cd06464 ACD_sHsps-like Alpha-c  32.5      30 0.00065   16.4   1.1   14   17-31     73-86  (88)
115 cd08402 C2B_Synaptotagmin-1 C2  32.2      83  0.0018   16.5   3.5   19   14-32      3-22  (136)
116 PF12014 DUF3506:  Domain of un  31.8      52  0.0011   18.4   2.0   27    1-31     69-98  (134)
117 PF01967 MoaC:  MoaC family;  I  31.2      71  0.0015   17.8   2.5   23   13-35     68-91  (136)
118 PF09912 DUF2141:  Uncharacteri  31.1      65  0.0014   17.0   2.3   20    9-28     51-70  (112)
119 cd08389 C2A_Synaptotagmin-14_1  30.6      88  0.0019   16.3   3.5   19   14-32      4-23  (124)
120 PRK11055 galM galactose-1-epim  30.5   1E+02  0.0023   19.4   3.5   24   11-34    134-157 (342)
121 PRK15076 alpha-galactosidase;   29.7      70  0.0015   20.9   2.7   26    5-31    335-360 (431)
122 PF15091 DUF4554:  Domain of un  29.5      52  0.0011   21.7   2.0   20   13-32     19-38  (458)
123 cd08410 C2B_Synaptotagmin-17 C  29.5      96  0.0021   16.4   3.7   19   14-32      2-21  (135)
124 KOG3194|consensus               29.1      62  0.0014   20.2   2.2   20   15-34    236-255 (279)
125 PF12930 DUF3836:  Family of un  28.9      65  0.0014   17.7   2.2   19   13-31     60-78  (132)
126 PF04205 FMN_bind:  FMN-binding  28.7      75  0.0016   15.2   2.2   20   14-33      5-25  (81)
127 PF14601 TFX_C:  DNA_binding pr  28.7      79  0.0017   16.1   2.3   17   14-30     68-84  (84)
128 cd04009 C2B_Munc13-like C2 dom  28.5      99  0.0021   16.3   3.8   18   14-31      4-22  (133)
129 cd06471 ACD_LpsHSP_like Group   27.9      43 0.00093   16.6   1.3    9   23-31     83-91  (93)
130 cd08403 C2B_Synaptotagmin-3-5-  27.6   1E+02  0.0022   16.1   3.5   20   14-33      2-22  (134)
131 PF03633 Glyco_hydro_65C:  Glyc  27.5      71  0.0015   14.3   2.1   25    6-31      1-25  (54)
132 PF11604 CusF_Ec:  Copper bindi  27.5      84  0.0018   15.1   3.0   15   15-29     49-63  (70)
133 TIGR00581 moaC molybdenum cofa  27.0 1.3E+02  0.0028   17.1   4.1   21   12-33     78-98  (147)
134 COG0450 AhpC Peroxiredoxin [Po  27.0 1.5E+02  0.0031   17.7   4.2   26   14-39    123-149 (194)
135 PF11359 gpUL132:  Glycoprotein  26.8      87  0.0019   19.0   2.5   29   19-47    157-185 (235)
136 COG1225 Bcp Peroxiredoxin [Pos  26.8      61  0.0013   18.4   1.8   16   14-29    119-134 (157)
137 PF11739 DctA-YdbH:  Dicarboxyl  26.6 1.4E+02   0.003   17.3   3.4   22   14-35    147-168 (207)
138 TIGR01953 NusA transcription t  26.4 1.8E+02  0.0039   18.6   4.2   27   23-49    214-240 (341)
139 PF08212 Lipocalin_2:  Lipocali  26.2 1.2E+02  0.0025   16.3   4.3   34   10-43     22-56  (143)
140 PRK15172 putative aldose-1-epi  26.1 1.6E+02  0.0034   18.0   3.7   20   13-32    126-145 (300)
141 PF07661 MORN_2:  MORN repeat v  25.9      47   0.001   11.6   2.7   14   18-31      5-18  (22)
142 cd01759 PLAT_PL PLAT/LH2 domai  25.4 1.2E+02  0.0026   16.2   4.5   32   13-45      3-36  (113)
143 TIGR02636 galM_Leloir galactos  25.0 1.8E+02  0.0039   18.1   3.9   23   11-33    129-151 (335)
144 PF02191 OLF:  Olfactomedin-lik  24.9 1.7E+02  0.0037   17.7   4.3   26   14-39    123-148 (250)
145 PHA02762 hypothetical protein;  24.9      77  0.0017   15.1   1.7   15   14-28     27-41  (62)
146 PRK00095 mutL DNA mismatch rep  24.6 1.4E+02  0.0031   20.4   3.5   29   10-40     37-65  (617)
147 COG2847 Copper(I)-binding prot  24.4 1.5E+02  0.0032   16.9   3.8   28    7-35    115-142 (151)
148 TIGR01924 rsbW_low_gc serine-p  24.4 1.4E+02   0.003   16.5   4.5   25   14-39     66-90  (159)
149 PLN00194 aldose 1-epimerase; P  24.3 1.3E+02  0.0028   18.8   3.1   21   12-32    137-157 (337)
150 cd09024 Aldose_epim_lacX Aldos  23.9 1.7E+02  0.0036   17.7   3.5   20   13-32    107-127 (288)
151 PF02772 S-AdoMet_synt_M:  S-ad  23.8   1E+02  0.0022   16.8   2.3   18   14-31     54-72  (120)
152 PF11353 DUF3153:  Protein of u  23.5 1.6E+02  0.0036   17.1   3.3   25    9-33     11-35  (209)
153 PLN02355 probable galactinol--  23.4 1.9E+02  0.0042   20.8   4.0   19   15-33    725-744 (758)
154 PRK12328 nusA transcription el  23.3 2.2E+02  0.0049   18.6   4.2   27   23-49    222-248 (374)
155 PRK09202 nusA transcription el  23.2 2.4E+02  0.0052   18.9   4.2   29   23-51    216-244 (470)
156 PF01863 DUF45:  Protein of unk  23.1 1.3E+02  0.0028   16.9   2.8   17   17-33      3-19  (205)
157 TIGR03000 plancto_dom_1 Planct  23.0 1.2E+02  0.0026   15.3   2.6   21    6-26     34-55  (75)
158 PF11954 DUF3471:  Domain of un  22.9      96  0.0021   15.5   2.0   14   15-28     66-79  (100)
159 PRK09510 tolA cell envelope in  22.8 1.3E+02  0.0028   19.7   2.9   22    6-28    320-341 (387)
160 PRK12343 putative molybdenum c  22.8 1.6E+02  0.0035   16.8   4.3   25   12-37     75-99  (151)
161 PRK14499 molybdenum cofactor b  22.8 2.1E+02  0.0046   18.1   4.3   26   12-37     80-106 (308)
162 cd08409 C2B_Synaptotagmin-15 C  22.7 1.4E+02   0.003   15.9   3.8   18   14-31      3-21  (137)
163 TIGR03027 pepcterm_export puta  22.5      72  0.0016   17.7   1.6   18   13-30     17-34  (165)
164 PRK13598 hisB imidazoleglycero  22.4 1.5E+02  0.0033   17.5   3.0   20   11-30     12-31  (193)
165 PF13211 DUF4019:  Protein of u  22.3 1.1E+02  0.0025   15.9   2.3   19    3-22     61-79  (105)
166 PF09260 DUF1966:  Domain of un  22.2      98  0.0021   15.8   2.0   15   18-32     58-72  (91)
167 PF04200 Lipoprotein_17:  Lipop  21.4   1E+02  0.0022   14.6   1.9   27   14-40     44-73  (84)
168 PF03174 CHB_HEX_C:  Chitobiase  21.4      75  0.0016   15.2   1.4   17   19-35     49-65  (75)
169 PRK14500 putative bifunctional  21.3 2.3E+02   0.005   18.0   4.4   27   12-38     81-110 (346)
170 cd09019 galactose_mutarotase_l  21.3 1.8E+02  0.0039   17.9   3.3   21   12-32    125-145 (326)
171 PF14564 Membrane_bind:  Membra  21.2 1.3E+02  0.0027   16.1   2.3   16   16-31     70-86  (110)
172 cd08406 C2B_Synaptotagmin-12 C  21.2 1.5E+02  0.0034   15.9   3.4   18   14-31      3-21  (136)
173 KOG0104|consensus               21.0 1.1E+02  0.0024   22.2   2.5   18   14-31    512-529 (902)
174 cd01081 Aldose_epim aldose 1-e  20.8 1.9E+02  0.0041   16.8   3.8   13   13-25    113-125 (284)
175 PF04014 Antitoxin-MazE:  Antid  20.5      99  0.0021   13.4   2.3   16   16-31     26-41  (47)
176 cd04028 C2B_RIM1alpha C2 domai  20.5 1.7E+02  0.0037   16.1   3.5   17   14-31     19-35  (146)
177 cd06470 ACD_IbpA-B_like Alpha-  20.4      70  0.0015   15.9   1.2    9   23-31     80-88  (90)
178 cd07914 IGPD Imidazoleglycerol  20.4 1.5E+02  0.0032   17.5   2.6   20   11-30      8-27  (190)
179 KOG4824|consensus               20.4 2.2E+02  0.0047   17.3   4.9   27   17-43     71-99  (224)
180 COG4814 Uncharacterized protei  20.4 2.4E+02  0.0052   17.8   3.8   28   16-43     78-105 (288)
181 PF10297 Hap4_Hap_bind:  Minima  20.3      60  0.0013   11.7   0.7    6    5-10      7-12  (17)
182 PF07773 DUF1619:  Protein of u  20.2 2.2E+02  0.0047   17.3   3.4   19   13-31    229-247 (294)
183 cd08407 C2B_Synaptotagmin-13 C  20.0 1.7E+02  0.0037   15.9   3.3   18   14-31      3-21  (138)

No 1  
>KOG0100|consensus
Probab=99.69  E-value=4.7e-17  Score=102.67  Aligned_cols=56  Identities=73%  Similarity=1.147  Sum_probs=53.4

Q ss_pred             CccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           1 ELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         1 ~l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      .|.||||+|+|.|+|+|+|++|.||+|+|+|.+..+|++..++|..+.+.|+.++|
T Consensus       490 dltGipPAPRGvpqIEVtFevDangiL~VsAeDKgtg~~~kitItNd~~rLt~EdI  545 (663)
T KOG0100|consen  490 DLTGIPPAPRGVPQIEVTFEVDANGILQVSAEDKGTGKKEKITITNDKGRLTPEDI  545 (663)
T ss_pred             cccCCCCCCCCCccEEEEEEEccCceEEEEeeccCCCCcceEEEecCCCCCCHHHH
Confidence            47899999999999999999999999999999999999999999999999999875


No 2  
>KOG0102|consensus
Probab=99.45  E-value=6.7e-14  Score=90.06  Aligned_cols=54  Identities=67%  Similarity=1.002  Sum_probs=50.4

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.||||.|+|.|.|+|+|.+|.||+++|+|.+..+|++..+++... |.||++||
T Consensus       479 l~gipp~pRgvpqieVtfDIdanGI~~vsA~dk~t~K~qsi~i~~s-ggLs~~ei  532 (640)
T KOG0102|consen  479 LQGIPPAPRGVPQIEVTFDIDANGIGTVSAKDKGTGKSQSITIASS-GGLSKDEI  532 (640)
T ss_pred             ecccCCCCCCCCceeEEEeecCCceeeeehhhcccCCccceEEeec-CCCCHHHH
Confidence            6799999999999999999999999999999999999999999876 56998874


No 3  
>PTZ00186 heat shock 70 kDa precursor protein; Provisional
Probab=99.42  E-value=3.7e-13  Score=88.10  Aligned_cols=54  Identities=72%  Similarity=1.047  Sum_probs=49.3

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.+|||.|+|.++|+|+|.||.||+|+|+|++..+|+...++|... ++|++++|
T Consensus       479 l~~ip~~~~G~~~I~Vtf~iD~nGiL~V~a~d~~tg~~~~~~i~~~-~~ls~~~i  532 (657)
T PTZ00186        479 LVGIPPAPRGVPQIEVTFDIDANGICHVTAKDKATGKTQNITITAN-GGLSKEQI  532 (657)
T ss_pred             EcCCCCCCCCCCcEEEEEEEcCCCEEEEEEEEccCCcEEEEEeccC-ccCCHHHH
Confidence            6789999999999999999999999999999999999999999864 56998764


No 4  
>KOG0101|consensus
Probab=99.42  E-value=2.5e-13  Score=88.31  Aligned_cols=56  Identities=89%  Similarity=1.285  Sum_probs=53.1

Q ss_pred             CccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           1 ELTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         1 ~l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      +|.||||.|+|.+.|+|+|.+|.||+|.|+|.+..+|+...++|..+.+.||+++|
T Consensus       464 eL~gippaprgvp~IevtfdiD~ngiL~Vta~d~stgK~~~i~i~n~~grls~~~I  519 (620)
T KOG0101|consen  464 ELTGIPPAPRGVPQIEVTFDIDANGILNVTAVDKSTGKENKITITNDKGRLSKEEI  519 (620)
T ss_pred             eecCCCccccCCcceeEEEecCCCcEEEEeeccccCCccceEEEecccceeehhhh
Confidence            47899999999999999999999999999999999999999999998999999875


No 5  
>PRK01433 hscA chaperone protein HscA; Provisional
Probab=99.34  E-value=3e-12  Score=83.13  Aligned_cols=54  Identities=37%  Similarity=0.608  Sum_probs=48.8

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|+||.||+|+|+|.+..+|+...+.|... .+||++|+
T Consensus       434 l~~i~~~~~g~~~i~vtf~id~~Gil~V~a~~~~t~~~~~~~i~~~-~~ls~~ei  487 (595)
T PRK01433        434 LKGLPPMKAGSIRAEVTFAIDADGILSVSAYEKISNTSHAIEVKPN-HGIDKTEI  487 (595)
T ss_pred             EcCCCCCCCCCccEEEEEEECCCCcEEEEEEEcCCCcEEEEEecCC-CCCCHHHH
Confidence            6789999999989999999999999999999999999999999765 45998764


No 6  
>PRK05183 hscA chaperone protein HscA; Provisional
Probab=99.23  E-value=1.9e-11  Score=79.60  Aligned_cols=54  Identities=44%  Similarity=0.735  Sum_probs=48.1

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|.||.||+|+|+|++..+|+...+.+... ..|++++|
T Consensus       456 i~~i~~~~~g~~~i~v~f~~d~~Gil~V~a~~~~~~~~~~~~i~~~-~~ls~~~i  509 (616)
T PRK05183        456 LRGIPPMAAGAARIRVTFQVDADGLLSVTAMEKSTGVEASIQVKPS-YGLTDDEI  509 (616)
T ss_pred             eCCCCCCCCCCccEEEEEEECCCCeEEEEEEEcCCCcEEEeccccc-ccCCHHHH
Confidence            6789999999989999999999999999999999999999988755 45887764


No 7  
>TIGR01991 HscA Fe-S protein assembly chaperone HscA. The Heat Shock Cognate proteins HscA and HscB act together as chaperones. HscA resembles DnaK but belongs in a separate clade. The apparent function is to aid assembly of iron-sulfur cluster proteins. Homologs from Buchnera and Wolbachia are clearly in the same clade but are highly derived and score lower than some examples of DnaK.
Probab=99.22  E-value=2.4e-11  Score=78.86  Aligned_cols=54  Identities=44%  Similarity=0.692  Sum_probs=48.1

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|+||.||+|+|+|.+..+|+...+.+... ..|++++|
T Consensus       440 l~~i~~~~~g~~~i~v~f~id~~gil~V~a~~~~t~~~~~~~i~~~-~~l~~~~i  493 (599)
T TIGR01991       440 LRGIPPMVAGAARIRVTFQVDADGLLTVSAQEQSTGVEQSIQVKPS-YGLSDEEI  493 (599)
T ss_pred             EcCCCCCCCCCCcEEEEEEECCCCeEEEEEEECCCCcEEEEecccc-cCCCHHHH
Confidence            6789999999999999999999999999999999999998888765 45887764


No 8  
>PRK13410 molecular chaperone DnaK; Provisional
Probab=99.19  E-value=3.7e-11  Score=78.92  Aligned_cols=54  Identities=56%  Similarity=1.001  Sum_probs=48.3

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|.||.||+|+|++.+..+|+...+.+... +.|+++||
T Consensus       454 l~~i~~~~~g~~~I~v~f~id~nGiL~V~a~d~~tg~~~~~~i~~~-~~ls~~ei  507 (668)
T PRK13410        454 LSGIPPAPRGVPQVQVAFDIDANGILQVSATDRTTGREQSVTIQGA-STLSEQEV  507 (668)
T ss_pred             EeCCCCCCCCCCeEEEEEEECCCcEEEEEEEEcCCCceeeeeeccc-ccCCHHHH
Confidence            6789999999999999999999999999999999999988888754 66988764


No 9  
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones]
Probab=99.15  E-value=8.1e-11  Score=76.40  Aligned_cols=54  Identities=72%  Similarity=1.052  Sum_probs=50.2

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      +.+|||.|+|.+.|+|+|.+|.||+++|++.+..+|+...+.|....+ |++++|
T Consensus       435 l~~i~~~~~g~~~i~v~f~iD~~gi~~v~a~~~~~~k~~~i~i~~~~~-ls~~~i  488 (579)
T COG0443         435 LDGIPPAPRGVPQIEVTFDIDANGILNVTAKDLGTGKEQSITIKASSG-LSDEEI  488 (579)
T ss_pred             CCCCCCCCCCCCceEEEeccCCCcceEeeeecccCCceEEEEEecCCC-CCHHHH
Confidence            678999999999999999999999999999999999999999998866 988764


No 10 
>PRK13411 molecular chaperone DnaK; Provisional
Probab=99.09  E-value=2.4e-10  Score=74.89  Aligned_cols=54  Identities=63%  Similarity=1.027  Sum_probs=47.7

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|.||.||+|+|+|.+..+|+...+.+... ..||++++
T Consensus       454 l~~i~~~~~g~~~i~v~f~id~~Gil~v~a~d~~t~~~~~~~i~~~-~~ls~~ei  507 (653)
T PRK13411        454 LTGIPPAPRGVPQIEVSFEIDVNGILKVSAQDQGTGREQSIRITNT-GGLSSNEI  507 (653)
T ss_pred             EcCCCCCCCCCccEEEEEEECCCCeEEEEEeeccCCceEeeEEecc-ccchHHHH
Confidence            5689999999989999999999999999999999999988888754 55888764


No 11 
>PLN03184 chloroplast Hsp70; Provisional
Probab=99.04  E-value=4.7e-10  Score=73.80  Aligned_cols=54  Identities=65%  Similarity=1.023  Sum_probs=47.7

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|.||.||+|+|++.+..+++...+.+... ..||++++
T Consensus       491 i~~i~~~~~g~~~i~v~f~id~~GiL~V~a~~~~t~~~~~~~i~~~-~~ls~eei  544 (673)
T PLN03184        491 LDGIPPAPRGVPQIEVKFDIDANGILSVSATDKGTGKKQDITITGA-STLPKDEV  544 (673)
T ss_pred             EeCCCCCCCCCceEEEEEEeCCCCeEEEEEEecCCCeEEEEEeccc-ccccHHHH
Confidence            5689999999989999999999999999999999999999988754 55887764


No 12 
>PTZ00400 DnaK-type molecular chaperone; Provisional
Probab=99.02  E-value=8.9e-10  Score=72.39  Aligned_cols=54  Identities=67%  Similarity=1.101  Sum_probs=47.6

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++||.|+|.++|+|+|.+|.||+|+|++.+..+|+...+.+... ..|+++++
T Consensus       493 i~~i~~~~~g~~~i~v~f~id~~Gil~v~a~~~~~~~~~~~~i~~~-~~ls~~ei  546 (663)
T PTZ00400        493 LVGIPPAPRGVPQIEVTFDVDANGIMNISAVDKSTGKKQEITIQSS-GGLSDEEI  546 (663)
T ss_pred             EcCCCCCCCCCceEEEEEEECCCCCEEEEEEeccCCcEEEEEeecc-ccccHHHH
Confidence            5689999999989999999999999999999999999988888764 45887764


No 13 
>CHL00094 dnaK heat shock protein 70
Probab=99.00  E-value=7e-10  Score=72.28  Aligned_cols=54  Identities=69%  Similarity=1.031  Sum_probs=47.3

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++|+.|+|.++|+|+|.||.||+|+|++.+..+|+...+.+... ..|+++++
T Consensus       454 i~~~~~~~~g~~~i~v~f~id~~Gil~v~~~~~~t~~~~~~~i~~~-~~ls~~~i  507 (621)
T CHL00094        454 LDGIPPAPRGVPQIEVTFDIDANGILSVTAKDKGTGKEQSITIQGA-STLPKDEV  507 (621)
T ss_pred             EeCCCCCCCCCCcEEEEEEECCCCeEEEEEeeccCCceeeeeeccc-hhccHHHH
Confidence            5689999999989999999999999999999999999988888753 55887763


No 14 
>PRK00290 dnaK molecular chaperone DnaK; Provisional
Probab=98.99  E-value=1.2e-09  Score=71.24  Aligned_cols=54  Identities=70%  Similarity=1.036  Sum_probs=47.5

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++|+.|+|.++|+|+|.+|.||+|+|++.+..+|+...+.+... ..|+++++
T Consensus       452 i~~~~~~~~g~~~i~v~f~~d~~gil~v~a~~~~~~~~~~~~i~~~-~~ls~e~i  505 (627)
T PRK00290        452 LTGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGKEQSITITAS-SGLSDEEI  505 (627)
T ss_pred             ECCCCCCCCCCceEEEEEEECCCceEEEEEEEccCCceeEEEeccc-cccCHHHH
Confidence            5689999999989999999999999999999999999999988754 55887753


No 15 
>PTZ00009 heat shock 70 kDa protein; Provisional
Probab=98.99  E-value=1.3e-09  Score=71.43  Aligned_cols=55  Identities=84%  Similarity=1.200  Sum_probs=47.7

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++|+.|+|.++|+|+|.+|.||+|+|++.+..+++...+.+....+.|+++++
T Consensus       463 i~~i~~~~~g~~~i~v~f~id~~Gil~v~~~~~~t~~~~~~~i~~~~~~ls~~~i  517 (653)
T PTZ00009        463 LDGIPPAPRGVPQIEVTFDIDANGILNVSAEDKSTGKSNKITITNDKGRLSKADI  517 (653)
T ss_pred             EcCCCCCCCCCceEEEEEEECCCCeEEEEEecccCCceeeEEEeeccccccHHHH
Confidence            5679999999888999999999999999999999999988888755566887653


No 16 
>TIGR02350 prok_dnaK chaperone protein DnaK. Members of this family are the chaperone DnaK, of the DnaK-DnaJ-GrpE chaperone system. All members of the seed alignment were taken from completely sequenced bacterial or archaeal genomes and (except for Mycoplasma sequence) found clustered with other genes of this systems. This model excludes DnaK homologs that are not DnaK itself, such as the heat shock cognate protein HscA (TIGR01991). However, it is not designed to distinguish among DnaK paralogs in eukaryotes. Note that a number of dnaK genes have shadow ORFs in the same reverse (relative to dnaK) reading frame, a few of which have been assigned glutamate dehydrogenase activity. The significance of this observation is unclear; lengths of such shadow ORFs are highly variable as if the presumptive protein product is not conserved.
Probab=98.95  E-value=2.6e-09  Score=69.14  Aligned_cols=54  Identities=72%  Similarity=1.054  Sum_probs=47.4

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCcccC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKEDT   56 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~ei   56 (56)
                      |.++|+.|+|.++|+|+|.+|.||+|+|++.+..+|+...+.+... ..||++++
T Consensus       450 i~~~~~~~~g~~~i~v~f~~d~~G~l~v~~~~~~~~~~~~~~i~~~-~~ls~~~~  503 (595)
T TIGR02350       450 LTGIPPAPRGVPQIEVTFDIDANGILHVSAKDKGTGKEQSITITAS-SGLSEEEI  503 (595)
T ss_pred             ECCCCCCCCCCceEEEEEEEcCCCeEEEEEEEccCCceEEEEeccc-cccCHHHH
Confidence            5678999999889999999999999999999999999988888754 55887763


No 17 
>PF00012 HSP70:  Hsp70 protein;  InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins. Hsp70 assisted folding involves repeated cycles of substrate binding and release. Hsp70 activity is ATP dependent. Hsp70 proteins are made up of two regions: the amino terminus is the ATPase domain and the carboxyl terminus is the substrate binding region []. Hsp70 proteins have an average molecular weight of 70 kDa [, , ]. In most species,there are many proteins that belong to the hsp70 family. Some of these are only expressed under stress conditions (strictly inducible), while some are present in cells under normal growth conditions and are not heat-inducible (constitutive or cognate) [, ]. Hsp70 proteins can be found in different cellular compartments(nuclear, cytosolic, mitochondrial, endoplasmic reticulum, for example).; PDB: 2P32_D 3D2F_A 2QXL_A 3D2E_C 3C7N_A 3FE1_C 4ANI_C 2V7Y_A 2KHO_A 3DPQ_B ....
Probab=98.42  E-value=7.6e-07  Score=57.28  Aligned_cols=53  Identities=53%  Similarity=0.938  Sum_probs=44.6

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCccc
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSKED   55 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~~e   55 (56)
                      |.++++.|+|.++|+|+|.+|.||+|+|++.+...+....+.+.... .+++++
T Consensus       456 i~~i~~~~~g~~~i~v~f~ld~~Gil~V~~~~~~~~~~~~~~v~~~~-~~~~~~  508 (602)
T PF00012_consen  456 ISGIPPAPKGKPKIKVTFELDENGILSVEAAEVETGKEEEVTVKKKE-TLSKEE  508 (602)
T ss_dssp             EES-SSSSTTSSEEEEEEEEETTSEEEEEEEETTTTEEEEEEEESSS-SSCHHH
T ss_pred             ccccccccccccceeeEEeeeeeeehhhhhccccccccccccccccc-cccccc
Confidence            56788899999999999999999999999999999998888887653 366554


No 18 
>KOG3591|consensus
Probab=93.05  E-value=0.27  Score=28.24  Aligned_cols=39  Identities=26%  Similarity=0.428  Sum_probs=30.6

Q ss_pred             CCCCcCeEEEEEEeCCCcceEEEEEeCcCCc--eEEEEEEc
Q psy6739           8 APRGVPQIEVTFDIDANGILNVTAIEKSTGK--ENKITITN   46 (56)
Q Consensus         8 ~p~g~~~i~V~f~~d~nGil~V~a~~~~~~~--~~~~~i~~   46 (56)
                      .|+|...=.|+-.++.+|+|+|+|.-.....  .+.+.|..
T Consensus       123 LP~~vdp~~V~S~LS~dGvLtI~ap~~~~~~~~er~ipI~~  163 (173)
T KOG3591|consen  123 LPEDVDPTSVTSTLSSDGVLTIEAPKPPPKQDNERSIPIEQ  163 (173)
T ss_pred             CCCCCChhheEEeeCCCceEEEEccCCCCcCccceEEeEee
Confidence            5777766889999999999999998776554  56666654


No 19 
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21.6 KDa small heat shock protein (sHsp) HspB8, also denoted as Hsp22 in humans, and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. A chaperone complex formed of HspB8 and Bag3 stimulates degradation of protein complexes by macroautophagy. HspB8 also forms complexes with Hsp27 (HspB1), MKBP (HspB2), HspB3, alphaB-crystallin (HspB5), Hsp20 (HspB6), and cvHsp (HspB7). These latter interactions may depend on phosphorylation of the respective partner sHsp. HspB8 may participate in the regulation of cell proliferation, cardiac hypertrophy, apoptosis, and carcinogenesis. Point mutations in HspB8 have been correlated with the development of several congenital neurological diseases, including Charcot Marie tooth disease and distal motor neuropathy type II.
Probab=91.62  E-value=0.28  Score=25.40  Aligned_cols=24  Identities=25%  Similarity=0.419  Sum_probs=20.1

Q ss_pred             CCCCcCeEEEEEEeCCCcceEEEE
Q psy6739           8 APRGVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         8 ~p~g~~~i~V~f~~d~nGil~V~a   31 (56)
                      .|.+.....|+-.+..||+|+|.|
T Consensus        66 LP~~Vd~~~v~s~l~~dGvL~Iea   89 (91)
T cd06480          66 LPPEVDPVTVFASLSPEGLLIIEA   89 (91)
T ss_pred             CCCCCCchhEEEEeCCCCeEEEEc
Confidence            466666688999999999999987


No 20 
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB3 is expressed in adult skeletal muscle, smooth muscle, and heart, and in several other fetal tissues.  In muscle cells HspB3 forms an oligomeric 150 kDa complex with myotonic dystrophy protein kinase-binding protein (MKBP/ HspB2), this complex may comprise one of two independent muscle-cell specific chaperone systems. The expression of HspB3 is induced during muscle differentiation controlled by the myogenic factor MyoD. HspB3 may also interact with Hsp22 (HspB8).
Probab=89.64  E-value=0.54  Score=23.84  Aligned_cols=25  Identities=28%  Similarity=0.461  Sum_probs=16.8

Q ss_pred             CCCcCeEEEEEEeCCCcceEEEEEe
Q psy6739           9 PRGVPQIEVTFDIDANGILNVTAIE   33 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~V~a~~   33 (56)
                      |.+...=.|+-.+..||+|+|+|.+
T Consensus        59 P~~Vd~~~v~A~~~~dGvL~I~~~~   83 (83)
T cd06477          59 PDGVEHKDLSAMLCHDGILVVETKD   83 (83)
T ss_pred             CCCcchheEEEEEcCCCEEEEEecC
Confidence            4443334566667789999998853


No 21 
>PF13103 TonB_2:  TonB C terminal; PDB: 1LR0_A.
Probab=88.26  E-value=1.7  Score=21.30  Aligned_cols=19  Identities=26%  Similarity=0.398  Sum_probs=12.8

Q ss_pred             CCcCeEEEEEEeCCCcceE
Q psy6739          10 RGVPQIEVTFDIDANGILN   28 (56)
Q Consensus        10 ~g~~~i~V~f~~d~nGil~   28 (56)
                      .+...+.|+|.+|.||.+.
T Consensus        23 ~~~~~~~V~i~i~~dG~v~   41 (85)
T PF13103_consen   23 SGGLSVTVRITIDPDGRVI   41 (85)
T ss_dssp             -TT--EEEEEEE-TTSBEE
T ss_pred             CCCcEEEEEEEECCCCCEE
Confidence            3345699999999999984


No 22 
>PF07865 DUF1652:  Protein of unknown function (DUF1652);  InterPro: IPR012448  The proteins in this entry have not been characterised.
Probab=87.34  E-value=1.7  Score=21.47  Aligned_cols=25  Identities=16%  Similarity=0.424  Sum_probs=23.1

Q ss_pred             EEEEEEeCCCcceEEEEEeCcCCce
Q psy6739          15 IEVTFDIDANGILNVTAIEKSTGKE   39 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~~~~~~~   39 (56)
                      ....++++.+|.|+|...+..+|..
T Consensus        15 l~C~ct~~~~~smtvrl~d~~sg~~   39 (69)
T PF07865_consen   15 LRCECTIAPDGSMTVRLFDPASGRV   39 (69)
T ss_pred             ceeEEEECCCCcEEEEEecCCCCcE
Confidence            6788999999999999999999986


No 23 
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits.  HspB2 is preferentially and constitutively expressed in skeletal muscle and heart. HspB2 shows homooligomeric activity and forms aggregates in muscle cytosol. Although its expression is not induced by heat shock, it redistributes to the insoluble fraction in response to heat shock. In the mouse heart, HspB2 plays a role in maintaining energetic balance, by protecting cardiac energetics during ischemia/reperfusion, and allowing  for increased work during acute inotropic challenge. hHspB2 [previously also known as myotonic dystrophy protein kinase (DMPK) binding protein (MKBP)]  is selectively up-regulated in skeletal muscles from myotonic dystrophy patients.
Probab=87.09  E-value=0.93  Score=22.87  Aligned_cols=23  Identities=30%  Similarity=0.478  Sum_probs=17.2

Q ss_pred             CCCcCeEEEEEEeCCCcceEEEE
Q psy6739           9 PRGVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~V~a   31 (56)
                      |.+...-.|+-.+..||+|+|++
T Consensus        59 P~~vd~~~v~A~~~~dGvL~I~~   81 (83)
T cd06476          59 PMDVDPLLVRASLSHDGILCIQA   81 (83)
T ss_pred             CCCCChhhEEEEecCCCEEEEEe
Confidence            44444466888888999999976


No 24 
>COG1334 FlaG Uncharacterized flagellar protein FlaG [Cell motility and secretion]
Probab=85.43  E-value=1.6  Score=23.83  Aligned_cols=25  Identities=36%  Similarity=0.553  Sum_probs=21.7

Q ss_pred             EEEEEEeCCC-cceEEEEEeCcCCce
Q psy6739          15 IEVTFDIDAN-GILNVTAIEKSTGKE   39 (56)
Q Consensus        15 i~V~f~~d~n-Gil~V~a~~~~~~~~   39 (56)
                      -.+.|+||.. |.+.|++.+..||..
T Consensus        67 t~l~F~~dd~lg~~vVkI~d~~TgeV   92 (120)
T COG1334          67 THLNFSYDDELGELVVKIIDKDTGEV   92 (120)
T ss_pred             CceEEEEecccCcEEEEEEECCCCcc
Confidence            3589999966 999999999999985


No 25 
>PF13670 PepSY_2:  Peptidase propeptide and YPEB domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. 
Probab=83.88  E-value=3.8  Score=20.28  Aligned_cols=36  Identities=22%  Similarity=0.415  Sum_probs=26.4

Q ss_pred             EEEEeCCCcceEEEEEeCcCCceEEEEEEcCCCCCCc
Q psy6739          17 VTFDIDANGILNVTAIEKSTGKENKITITNDRGRLSK   53 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~~ls~   53 (56)
                      ..++.+.+|..+|++.+ ..|+..++.+....|...+
T Consensus        46 ~~ve~~~~g~yev~~~~-~dG~~~ev~vD~~tG~V~~   81 (83)
T PF13670_consen   46 REVEFDDDGCYEVEARD-KDGKKVEVYVDPATGEVVK   81 (83)
T ss_pred             EEEEEcCCCEEEEEEEE-CCCCEEEEEEcCCCCeEee
Confidence            45677778889998665 7788899988876555443


No 26 
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 does not belong to this group. Mutations inHspB4 have been associated with Autosomal Dominant Congenital Cataract (ADCC). The chaperone-like functions of HspB4 are considered important for maintaining lens transparency and preventing cataract.
Probab=82.13  E-value=1.4  Score=22.27  Aligned_cols=16  Identities=25%  Similarity=0.603  Sum_probs=12.9

Q ss_pred             EEEEEeCCCcceEEEE
Q psy6739          16 EVTFDIDANGILNVTA   31 (56)
Q Consensus        16 ~V~f~~d~nGil~V~a   31 (56)
                      .|+-.++.||+|+|++
T Consensus        69 ~i~A~~~~dGvL~I~~   84 (86)
T cd06497          69 AITCSLSADGMLTFSG   84 (86)
T ss_pred             HeEEEeCCCCEEEEEe
Confidence            3677788899999876


No 27 
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. HspB7 is a 25-kDa protein, preferentially expressed in heart and skeletal muscle. It binds the cytoskeleton protein alpha-filamin (also known as actin-binding protein 280). The expression of HspB7 is increased during rat muscle aging.  Its expression is also modulated in obesity implicating this protein in this and related metabolic disorders. As the human gene encoding HspB7 is mapped to chromosome 1p36.23-p34.3 it is a positional candidate for several dystrophies and myopathies.
Probab=81.32  E-value=1.6  Score=22.00  Aligned_cols=18  Identities=22%  Similarity=0.390  Sum_probs=13.5

Q ss_pred             EEEEEEeCCCcceEEEEE
Q psy6739          15 IEVTFDIDANGILNVTAI   32 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~   32 (56)
                      =.|+-.+..||+|+|++.
T Consensus        63 e~v~A~l~~~GvL~I~~~   80 (81)
T cd06479          63 TSVSSSLGEDGTLTIKAR   80 (81)
T ss_pred             HHeEEEecCCCEEEEEec
Confidence            345666689999999874


No 28 
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 on the other hand is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer.  HspB5's functions include effects on the apoptotic pathway and on metastasis.  Phosphorylation of HspB5 reduces its ol
Probab=81.19  E-value=1.5  Score=21.98  Aligned_cols=16  Identities=25%  Similarity=0.636  Sum_probs=12.8

Q ss_pred             EEEEEeCCCcceEEEE
Q psy6739          16 EVTFDIDANGILNVTA   31 (56)
Q Consensus        16 ~V~f~~d~nGil~V~a   31 (56)
                      .|+-.+..||+|+|++
T Consensus        66 ~i~A~~~~dGvL~I~~   81 (83)
T cd06478          66 AITSSLSADGVLTISG   81 (83)
T ss_pred             HeEEEECCCCEEEEEe
Confidence            4677788899999876


No 29 
>PF03646 FlaG:  FlaG protein;  InterPro: IPR005186 Although these proteins are known to be important for flagellar their exact function is unknown.; PDB: 2HC5_A.
Probab=80.95  E-value=2.7  Score=21.87  Aligned_cols=26  Identities=31%  Similarity=0.565  Sum_probs=20.6

Q ss_pred             eEEEEEEeCCC-cceEEEEEeCcCCce
Q psy6739          14 QIEVTFDIDAN-GILNVTAIEKSTGKE   39 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~~~~~~~~   39 (56)
                      ...+.|.+|.+ |.+.|.+.|..||.-
T Consensus        54 ~~~l~F~vde~~~~~vVkViD~~T~eV   80 (107)
T PF03646_consen   54 NTSLRFSVDEESGRVVVKVIDKETGEV   80 (107)
T ss_dssp             S--EEEEEEEETTEEEEEEEETTT-SE
T ss_pred             CCceEEEEecCCCcEEEEEEECCCCcE
Confidence            36699999977 889999999999986


No 30 
>PRK10050 curli assembly protein CsgF; Provisional
Probab=79.47  E-value=8.8  Score=21.51  Aligned_cols=31  Identities=19%  Similarity=0.444  Sum_probs=24.7

Q ss_pred             EEEEEEeCCCcceEEEEEeCcCCceEEEEEEc
Q psy6739          15 IEVTFDIDANGILNVTAIEKSTGKENKITITN   46 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~~   46 (56)
                      ..|.| ++.+|-|.|..+|..+|....+.+..
T Consensus       100 ~~i~i-~~~~~~l~i~ItD~~TGe~T~I~V~g  130 (138)
T PRK10050        100 YIVDI-ANRDGQLQLNVTDRKTGQTSTIQVSG  130 (138)
T ss_pred             EEEEE-EecCCcEEEEEEeCCCccEEEEEeCC
Confidence            34444 45689999999999999999888753


No 31 
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1.  HspB4 does not belong to this group. HspB5 shows increased synthesis in response to stress. HspB5 is also expressed constitutively in other tissues including brain, heart, and type I and type IIa skeletal muscle fibers, and in several cancers including gliomas, renal cell carcinomas, basal-like and metaplastic breast carcinomas, and head and neck cancer.  Its functions include effects on the apoptotic pathway and on metastasis.  Phosphorylation of HspB5 reduces its oligomerization and anti-apoptotic activ
Probab=79.14  E-value=1.7  Score=21.85  Aligned_cols=23  Identities=26%  Similarity=0.566  Sum_probs=15.4

Q ss_pred             CCCcCeEEEEEEeCCCcceEEEE
Q psy6739           9 PRGVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~V~a   31 (56)
                      |.+...=.|+-+|..||+|+|++
T Consensus        59 P~~vd~~~i~A~~~~dGvL~I~l   81 (84)
T cd06498          59 PADVDPLTITSSLSPDGVLTVCG   81 (84)
T ss_pred             CCCCChHHcEEEeCCCCEEEEEE
Confidence            33333344667788899999876


No 32 
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins. KIAA proteins are uncharacterized human proteins. They were compiled by the Kazusa mammalian cDNA project which identified more than 2000 human genes. They are identified by 4 digit codes that precede the KIAA designation.  Many KIAA genes are still functionally uncharacterized including KIAA1228. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1
Probab=78.07  E-value=5.9  Score=20.60  Aligned_cols=21  Identities=33%  Similarity=0.475  Sum_probs=16.6

Q ss_pred             CCCcCeEEEEEEeCCC-cceEEEE
Q psy6739           9 PRGVPQIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus         9 p~g~~~i~V~f~~d~n-Gil~V~a   31 (56)
                      |.|  +|++.+.|+.+ +.|+|.+
T Consensus         1 ~~G--~l~~~l~y~~~~~~L~V~v   22 (127)
T cd04030           1 PLG--RIQLTIRYSSQRQKLIVTV   22 (127)
T ss_pred             CCe--EEEEEEEEeCCCCEEEEEE
Confidence            456  58999999987 7788875


No 33 
>PF11211 DUF2997:  Protein of unknown function (DUF2997);  InterPro: IPR021375  This family of proteins has no known function. 
Probab=77.88  E-value=3.5  Score=18.92  Aligned_cols=17  Identities=18%  Similarity=0.300  Sum_probs=14.2

Q ss_pred             EEEEeCCCcceEEEEEe
Q psy6739          17 VTFDIDANGILNVTAIE   33 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~   33 (56)
                      +.|.++.||.+++++.-
T Consensus         1 I~~~I~~dG~V~~~v~G   17 (48)
T PF11211_consen    1 IEFTIYPDGRVEEEVEG   17 (48)
T ss_pred             CEEEECCCcEEEEEEEe
Confidence            46889999999988765


No 34 
>PF10614 CsgF:  Type VIII secretion system (T8SS), CsgF protein;  InterPro: IPR018893  Fimbriae are cell-surface protein polymers, of e.g. Escherichia coli and Salmonella spp, that mediate interactions important for host and environmental persistence, development of biofilms, motility, colonisation and invasion of cells, and conjugation. Four general assembly pathways for different fimbriae have been proposed, one of which is extracellular nucleation-precipitation (ENP), that differs from the others in that fibre-growth occurs extracellularly. Thin aggregative fimbriae (Tafi) are the only fimbriae dependent on the ENP pathway. Tafi were first identified in Salmonella spp. and the controlling operon termed agf; however subsequent isolation of the homologous operon in E. coli led to its being called csg. Tafi are known as curli because, in the absence of extracellular polysaccharides, their morphology appears curled; however, when expressed with such polysaccharides their morphology appears as a tangled amorphous matrix []. CsgF is one of three putative curli assembly factors appearing to act as a nucleator protein. Unlike eukaryotic amyloid formation, curli biogenesis is a productive pathway requiring a specific assembly machinery []. 
Probab=76.62  E-value=11  Score=21.21  Aligned_cols=30  Identities=23%  Similarity=0.410  Sum_probs=23.6

Q ss_pred             EEEEEEeCCCcceEEEEEeCcCCceEEEEEE
Q psy6739          15 IEVTFDIDANGILNVTAIEKSTGKENKITIT   45 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~~~~~~~~~~~i~   45 (56)
                      ..|.+. +.+|-|.|..+|..+|....+.+.
T Consensus       109 f~I~i~-~~~g~l~v~I~D~~TGe~T~I~Vp  138 (142)
T PF10614_consen  109 FTIEIV-NSDGGLVVNITDKNTGEVTTIEVP  138 (142)
T ss_pred             EEEEEE-eCCCeEEEEEEeCCCccEEEEEec
Confidence            334433 568889999999999999888875


No 35 
>PF03544 TonB_C:  Gram-negative bacterial TonB protein C-terminal;  InterPro: IPR006260 The sequences in this set all contain a conserved C-terminal domain which is characteristic of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria []. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetitive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to span the periplasm.  Iron is essential for growth in both bacteria and mammals. Controlling the amount of free iron in solution is often used as a tactic by hosts to limit invasion of pathogenic microbes; binding iron tightly within protein molecules can accomplish this. Some bacteria express surface receptors to capture eukaryotic iron-binding compounds, while others have evolved siderophores to scavenge iron from iron-binding host proteins [].  The absence of free iron molecules in the surrounding environment triggers transcription of gene clusters that encode both siderophore-synthesis ezymes, and receptors that recognise iron-bound siderophores []. An example of the latter is Escherichia coli fepA, which resides in the outer envelope and captures iron-bound enterobactin [].  To complete transport of bound iron across the inner membrane, a second receptor complex is needed. The major component of this is tonB, a 27kDa protein that facilitates energy transfer from the proton motive force to outer receptors. B-12 and colicin receptors also make use of the tonB system to drive active transport at the outer membrane.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016020 membrane, 0030288 outer membrane-bounded periplasmic space; PDB: 1U07_B 1IHR_A 2GRX_C 2GSK_B 1QXX_A 1XX3_A 2K9K_A.
Probab=75.67  E-value=7.1  Score=18.54  Aligned_cols=15  Identities=33%  Similarity=0.658  Sum_probs=13.1

Q ss_pred             eEEEEEEeCCCcceE
Q psy6739          14 QIEVTFDIDANGILN   28 (56)
Q Consensus        14 ~i~V~f~~d~nGil~   28 (56)
                      .+.|.|.+|.||.++
T Consensus        17 ~v~v~~~I~~~G~v~   31 (79)
T PF03544_consen   17 TVVVEFTIDPDGRVS   31 (79)
T ss_dssp             EEEEEEEEETTTEEE
T ss_pred             EEEEEEEEeCCCCEE
Confidence            588999999999876


No 36 
>PF03072 DUF237:  MG032/MG096/MG288 family 1;  InterPro: IPR004306 This domain is found entirely in Mycoplasma pneumoniae proteins of unknown function. Another related domain (IPR004319 from INTERPRO) is found entirely in mycoplasmal proteins of the MG032/MG096/MG288 family and both domains often occur together.
Probab=75.41  E-value=4.4  Score=22.65  Aligned_cols=21  Identities=29%  Similarity=0.517  Sum_probs=16.9

Q ss_pred             ccCCCCCCCCcCeEEEEEEeCCC
Q psy6739           2 LTSIPPAPRGVPQIEVTFDIDAN   24 (56)
Q Consensus         2 l~~ip~~p~g~~~i~V~f~~d~n   24 (56)
                      +.+||+.-+|  +++|+|.+|.+
T Consensus        79 ~ggIPg~WkG--km~vk~~~DG~   99 (137)
T PF03072_consen   79 RGGIPGSWKG--KMNVKFIFDGD   99 (137)
T ss_pred             hCCCCCcccc--eEEEEEEEccc
Confidence            4689999999  58999988753


No 37 
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Human (h) HspB9 is expressed exclusively in the normal testis and in various tumor samples and is a cancer/testis antigen. hHspB9  interacts with TCTEL1 (T-complex testis expressed protein -1), a subunit of dynein. hHspB9 and TCTEL1 are co-expressed in similar cells within the testis and in tumor cells. Included in this group is Xenopus Hsp30, a developmentally-regulated heat-inducible molecular chaperone.
Probab=73.53  E-value=3.3  Score=20.93  Aligned_cols=15  Identities=33%  Similarity=0.556  Sum_probs=11.4

Q ss_pred             EEEEeCCCcceEEEE
Q psy6739          17 VTFDIDANGILNVTA   31 (56)
Q Consensus        17 V~f~~d~nGil~V~a   31 (56)
                      |+-.+..||+|+|++
T Consensus        71 i~A~~~~dGvL~I~~   85 (87)
T cd06481          71 VTCSLSPSGHLHIRA   85 (87)
T ss_pred             eEEEeCCCceEEEEc
Confidence            556667899998875


No 38 
>PRK08868 flagellar protein FlaG; Provisional
Probab=72.70  E-value=8  Score=21.79  Aligned_cols=25  Identities=36%  Similarity=0.408  Sum_probs=22.2

Q ss_pred             EEEEEEeCCC-cceEEEEEeCcCCce
Q psy6739          15 IEVTFDIDAN-GILNVTAIEKSTGKE   39 (56)
Q Consensus        15 i~V~f~~d~n-Gil~V~a~~~~~~~~   39 (56)
                      ..+.|.+|.+ |.+-|.+.|..||.-
T Consensus        89 ~~L~F~vdeetgr~VVkViD~~T~EV  114 (144)
T PRK08868         89 KGLSFRVDEESGRDVVTIYEASTGDI  114 (144)
T ss_pred             CceEEEEecCCCCEEEEEEECCCCce
Confidence            5689999987 999999999999985


No 39 
>PF05593 RHS_repeat:  RHS Repeat;  InterPro: IPR006530 These sequences contain two tandem copies of a 21-residue extracellular repeat that is found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin [, , ].
Probab=71.84  E-value=6.2  Score=16.73  Aligned_cols=13  Identities=31%  Similarity=0.480  Sum_probs=10.6

Q ss_pred             EEEEeCCCcceEE
Q psy6739          17 VTFDIDANGILNV   29 (56)
Q Consensus        17 V~f~~d~nGil~V   29 (56)
                      .+|.||..|.|.-
T Consensus        18 ~~y~YD~~g~l~~   30 (38)
T PF05593_consen   18 TRYTYDAAGRLTS   30 (38)
T ss_pred             EEEEECCCCCEEE
Confidence            5899999999754


No 40 
>PRK08452 flagellar protein FlaG; Provisional
Probab=71.02  E-value=9.9  Score=20.82  Aligned_cols=25  Identities=24%  Similarity=0.299  Sum_probs=21.7

Q ss_pred             EEEEEEeCCC-cceEEEEEeCcCCce
Q psy6739          15 IEVTFDIDAN-GILNVTAIEKSTGKE   39 (56)
Q Consensus        15 i~V~f~~d~n-Gil~V~a~~~~~~~~   39 (56)
                      ..+.|.||.+ |.+.|.+.|..||.-
T Consensus        71 ~~L~F~~de~~~~~vVkVvD~~T~eV   96 (124)
T PRK08452         71 TNIRFGYNDKIKGLVVSVKEANGGKV   96 (124)
T ss_pred             CceEEEEcCCCCcEEEEEEECCCCce
Confidence            4689999877 889999999999885


No 41 
>PRK07738 flagellar protein FlaG; Provisional
Probab=69.60  E-value=11  Score=20.52  Aligned_cols=25  Identities=12%  Similarity=0.322  Sum_probs=21.9

Q ss_pred             EEEEEEeCCC-cceEEEEEeCcCCce
Q psy6739          15 IEVTFDIDAN-GILNVTAIEKSTGKE   39 (56)
Q Consensus        15 i~V~f~~d~n-Gil~V~a~~~~~~~~   39 (56)
                      -.+.|++|.+ |.+-|.+.|..||.-
T Consensus        64 ~~L~F~vdeet~~~vVkVvD~~T~EV   89 (117)
T PRK07738         64 TSLKFELHEKLNEYYVQVVDERTNEV   89 (117)
T ss_pred             CceEEEEecCCCcEEEEEEECCCCee
Confidence            4689999976 999999999999875


No 42 
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain  (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps.
Probab=66.34  E-value=5.9  Score=19.53  Aligned_cols=15  Identities=33%  Similarity=0.663  Sum_probs=10.1

Q ss_pred             EEEEeCCCcceEEEE
Q psy6739          17 VTFDIDANGILNVTA   31 (56)
Q Consensus        17 V~f~~d~nGil~V~a   31 (56)
                      ++-.+..||+|+|++
T Consensus        67 i~A~~~~~GvL~I~~   81 (83)
T cd06526          67 VTSSLSSDGVLTIEA   81 (83)
T ss_pred             eEEEeCCCcEEEEEe
Confidence            444555679998875


No 43 
>PF00011 HSP20:  Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry.;  InterPro: IPR002068 Prokaryotic and eukaryotic organisms respond to heat shock or other environmental stress by inducing the synthesis of proteins collectively known as heat-shock proteins (hsp) []. Amongst them is a family of proteins with an average molecular weight of 20 Kd, known as the hsp20 proteins []. These seem to act as chaperones that can protect other proteins against heat-induced denaturation and aggregation. Hsp20 proteins seem to form large heterooligomeric aggregates. Structurally, this family is characterised by the presence of a conserved C-terminal domain of about 100 residues.; PDB: 2BOL_B 3N3E_B 2H50_P 2H53_F 2BYU_L 1GME_D 3VQM_J 3VQK_E 3VQL_A 3AAC_A ....
Probab=65.03  E-value=16  Score=18.29  Aligned_cols=20  Identities=25%  Similarity=0.411  Sum_probs=13.6

Q ss_pred             EEEEeCCCcceEEEEEeCcCC
Q psy6739          17 VTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ++-.+ .||+|+|++--....
T Consensus        72 i~a~~-~~GvL~I~~pk~~~~   91 (102)
T PF00011_consen   72 IKASY-ENGVLTITIPKKEEE   91 (102)
T ss_dssp             -EEEE-TTSEEEEEEEBSSSC
T ss_pred             EEEEe-cCCEEEEEEEccccc
Confidence            34445 899999998665544


No 44 
>TIGR01352 tonB_Cterm TonB family C-terminal domain. This model represents the C-terminal of TonB and is homologs. TonB is an energy-transducer for TonB-dependent receptors of Gram-negative bacteria. Most members are designated as TonB or TonB-related proteins, but a few represent the paralogous TolA protein. Several bacteria have up to four TonB paralogs. In nearly every case, a proline-rich repetive region is found N-terminal to this domain; these low-complexity regions are highly divergent and cannot readily be aligned. The region is suggested to help span the periplasm.
Probab=62.83  E-value=15  Score=17.10  Aligned_cols=15  Identities=33%  Similarity=0.674  Sum_probs=13.0

Q ss_pred             eEEEEEEeCCCcceE
Q psy6739          14 QIEVTFDIDANGILN   28 (56)
Q Consensus        14 ~i~V~f~~d~nGil~   28 (56)
                      .+.|.|.+|.+|.+.
T Consensus        11 ~v~v~~~i~~~G~v~   25 (74)
T TIGR01352        11 TVVVRFTVDADGRVT   25 (74)
T ss_pred             EEEEEEEECCCCCEE
Confidence            588999999999875


No 45 
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks). There are 3 classes of PI3Ks based on structure, regulation, and specificity.  All classes contain a N-terminal C2 domain, a PIK domain, and a kinase catalytic domain. Unlike class I and class III, class II PI3Ks have additionally a PX domain and a C-terminal C2 domain containing a nuclear localization signal both of which bind phospholipids though in a slightly different fashion.  PI3Ks (AKA phosphatidylinositol (PtdIns) 3-kinases) regulate cell processes such as cell growth, differentiation, proliferation, and motility. PI3Ks work on phosphorylation of phosphatidylinositol, phosphatidylinositide (4)P (PtdIns (4)P),2 or PtdIns(4,5)P2. Specifically they phosphorylate the D3 hydroxyl group of phosphoinositol lipids on the inositol ring. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permut
Probab=62.68  E-value=17  Score=19.08  Aligned_cols=17  Identities=29%  Similarity=0.495  Sum_probs=14.2

Q ss_pred             eEEEEEEeCCCcceEEEE
Q psy6739          14 QIEVTFDIDANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a   31 (56)
                      +|.+++.|+ .|.|+|.+
T Consensus         3 ~l~~~l~y~-~~~L~V~V   19 (122)
T cd08381           3 QVKLSISYK-NGTLFVMV   19 (122)
T ss_pred             eEEEEEEEe-CCEEEEEE
Confidence            588899999 89999874


No 46 
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Hsp27 shows enhanced synthesis in response to stress. It is a molecular chaperone which interacts with a large number of different proteins. It is found in many types of human cells including breast, uterus, cervix, platelets and cancer cells. Hsp27 has diverse cellular functions including, chaperoning, regulation of actin polymerization, keratinocyte differentiation, regulation of inflammatory pathways in keratinocytes, and protection from oxidative stress through modulating glutathione levels. It is also a subunit of AUF1-containing protein complexes. It has been linked to several transduction pathways regulating cellular functions including differentiat
Probab=60.88  E-value=7.7  Score=19.51  Aligned_cols=16  Identities=44%  Similarity=0.630  Sum_probs=11.6

Q ss_pred             EEEEEeCCCcceEEEE
Q psy6739          16 EVTFDIDANGILNVTA   31 (56)
Q Consensus        16 ~V~f~~d~nGil~V~a   31 (56)
                      .|+=.+..||+|+|++
T Consensus        69 ~v~A~~~~dGvL~I~l   84 (86)
T cd06475          69 AVTSSLSPDGILTVEA   84 (86)
T ss_pred             HcEEEECCCCeEEEEe
Confidence            4555567799998876


No 47 
>PF05691 Raffinose_syn:  Raffinose synthase or seed imbibition protein Sip1;  InterPro: IPR008811 This family consists of several raffinose synthase proteins, also known as seed imbibition (Sip1) proteins. Raffinose (O-alpha- D-galactopyranosyl- (1-->6)- O-alpha- D-glucopyranosyl-(1-->2)- O-beta- D-fructofuranoside) is a widespread oligosaccharide in plant seeds and other tissues. Raffinose synthase (2.4.1.82 from EC) is the key enzyme that channels sucrose into the raffinose oligosaccharide pathway [].
Probab=58.37  E-value=9.8  Score=26.71  Aligned_cols=16  Identities=44%  Similarity=0.773  Sum_probs=14.2

Q ss_pred             EEEEEEeCCCcceEEE
Q psy6739          15 IEVTFDIDANGILNVT   30 (56)
Q Consensus        15 i~V~f~~d~nGil~V~   30 (56)
                      -+|.|+||.+|+|+|.
T Consensus       731 ~ev~F~yd~~gllt~~  746 (747)
T PF05691_consen  731 AEVEFSYDEDGLLTVD  746 (747)
T ss_pred             EEeeEEEcCCceEEEe
Confidence            5799999999999885


No 48 
>COG0810 TonB Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane]
Probab=55.62  E-value=15  Score=21.77  Aligned_cols=15  Identities=33%  Similarity=0.667  Sum_probs=12.6

Q ss_pred             CeEEEEEEeCCCcce
Q psy6739          13 PQIEVTFDIDANGIL   27 (56)
Q Consensus        13 ~~i~V~f~~d~nGil   27 (56)
                      -++.|.|.+|.+|.+
T Consensus       180 G~V~V~f~i~~~G~v  194 (244)
T COG0810         180 GTVKVKFTIDPDGNV  194 (244)
T ss_pred             ceEEEEEEECCCCCE
Confidence            368999999999963


No 49 
>PF09264 Sial-lect-inser:  Vibrio cholerae sialidase, lectin insertion;  InterPro: IPR015344 This domain is predominantly found in Vibrio cholerae sialidase, and adopt a beta sandwich structure consisting of 12-14 strands arranged in two beta-sheets. It binds to lectins with high affinity helping to target the protein to sialic acid-rich environments, thereby enhancing the catalytic efficiency of the enzyme []. ; PDB: 1W0P_A 1W0O_A 1KIT_A 2W68_B.
Probab=55.43  E-value=22  Score=21.05  Aligned_cols=21  Identities=14%  Similarity=0.235  Sum_probs=15.8

Q ss_pred             CcCeEEEEEEeCCCcceEEEE
Q psy6739          11 GVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus        11 g~~~i~V~f~~d~nGil~V~a   31 (56)
                      |..++.+.|++|.+|-|.+..
T Consensus        55 G~~r~l~~lsvn~sG~LvA~L   75 (198)
T PF09264_consen   55 GSKRYLPILSVNESGSLVAEL   75 (198)
T ss_dssp             SSEEEEEEEEE-TTS-EEEEE
T ss_pred             CceEEEEEEEEcCCCCEEEEE
Confidence            556799999999999987764


No 50 
>COG2017 GalM Galactose mutarotase and related enzymes [Carbohydrate transport and metabolism]
Probab=55.39  E-value=27  Score=21.52  Aligned_cols=25  Identities=28%  Similarity=0.432  Sum_probs=19.2

Q ss_pred             cCeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739          12 VPQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ...++|+|.++.++ |+|+.+....+
T Consensus       131 ~l~~~vtY~L~~~~-L~v~~~~~n~~  155 (308)
T COG2017         131 NLEATVTYTLNEDG-LTVTYEVTNDG  155 (308)
T ss_pred             eEEEEEEEEEcCCC-EEEEEEEEeCC
Confidence            45799999999999 88776655444


No 51 
>COG0315 MoaC Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]
Probab=55.14  E-value=39  Score=19.39  Aligned_cols=26  Identities=35%  Similarity=0.658  Sum_probs=19.3

Q ss_pred             CeEEEEEEeCCCcceEEEEEeCcCCc
Q psy6739          13 PQIEVTFDIDANGILNVTAIEKSTGK   38 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~~~~~~~   38 (56)
                      ..++|.|.++.+.-++|+++...+|+
T Consensus        82 t~Vdv~~~~~~~~~v~i~~~vkt~gk  107 (157)
T COG0315          82 TKVDVDFEVDEDDGVEITATVKTTGK  107 (157)
T ss_pred             cceEEEEEECCCCcEEEEEEEEECCC
Confidence            46999999999856777776665554


No 52 
>PF08758 Cadherin_pro:  Cadherin prodomain like;  InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This protein corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions []. ; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1OP4_A.
Probab=54.97  E-value=28  Score=17.81  Aligned_cols=29  Identities=10%  Similarity=0.219  Sum_probs=17.5

Q ss_pred             EEEeCCCcceEEEEEeCcCCceEEEEEEc
Q psy6739          18 TFDIDANGILNVTAIEKSTGKENKITITN   46 (56)
Q Consensus        18 ~f~~d~nGil~V~a~~~~~~~~~~~~i~~   46 (56)
                      .|.++.||.+.+.-.-.-.+....+.|..
T Consensus        47 dF~V~~DGsVy~~r~v~l~~~~~~F~V~a   75 (90)
T PF08758_consen   47 DFRVLEDGSVYAKRPVQLSSEQRSFTVHA   75 (90)
T ss_dssp             EEEEETTTEEEEES--S-SSS-EEEEEEE
T ss_pred             CEEEcCCCeEEEeeeEecCCCceEEEEEE
Confidence            68999999998765444445545555543


No 53 
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmins 4 and 11, class 4 synaptotagmins, are located in the brain.  Their functions are unknown. They are distinguished from the other synaptotagmins by having and Asp to Ser substitution in their C2A domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence 
Probab=54.31  E-value=32  Score=18.20  Aligned_cols=18  Identities=11%  Similarity=0.148  Sum_probs=14.3

Q ss_pred             eEEEEEEeCCC-cceEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a   31 (56)
                      +|.+++.|+.+ +.|+|.+
T Consensus         4 ~l~~~l~y~~~~~~L~V~V   22 (128)
T cd08388           4 TLFFSLRYNSEKKALLVNI   22 (128)
T ss_pred             EEEEEEEEECCCCEEEEEE
Confidence            58899999965 7788774


No 54 
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. There are several classes of Synaptotagmins. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distin
Probab=53.12  E-value=32  Score=17.81  Aligned_cols=20  Identities=10%  Similarity=0.195  Sum_probs=15.4

Q ss_pred             eEEEEEEeCC-CcceEEEEEe
Q psy6739          14 QIEVTFDIDA-NGILNVTAIE   33 (56)
Q Consensus        14 ~i~V~f~~d~-nGil~V~a~~   33 (56)
                      +|.+.+.|+. +|.|+|.+..
T Consensus         2 ~i~~~l~y~~~~~~L~V~v~~   22 (134)
T cd00276           2 ELLLSLSYLPTAERLTVVVLK   22 (134)
T ss_pred             eEEEEEEeeCCCCEEEEEEEE
Confidence            5889999996 4889977543


No 55 
>PF11975 Glyco_hydro_4C:  Family 4 glycosyl hydrolase C-terminal domain;  InterPro: IPR022616 This domain is found primarily in bacterial family 4 glycosyl hydrolases. It is found in the C terminus. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds; PDB: 1UP4_A 1UP6_C 1UP7_E 1VJT_A 1U8X_X 1S6Y_A 3FEF_D 1OBB_A.
Probab=53.04  E-value=14  Score=21.61  Aligned_cols=25  Identities=36%  Similarity=0.589  Sum_probs=18.2

Q ss_pred             CCCCCCCcCeEEEEEEeCCCcceEEE
Q psy6739           5 IPPAPRGVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus         5 ip~~p~g~~~i~V~f~~d~nGil~V~   30 (56)
                      |+..|.+.. |+|...+|.+|+-=+.
T Consensus       164 I~nLp~dav-VEvp~~v~~~Gi~P~~  188 (232)
T PF11975_consen  164 IPNLPDDAV-VEVPCYVDGDGIHPVA  188 (232)
T ss_dssp             STTS-TTSE-EEEEEEEETTEEEEB-
T ss_pred             cCCCCCCcE-EEEEEEEcCCeeEecc
Confidence            566777765 9999999999986443


No 56 
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma. A single C2 domain is found in PKC alpha and gamma. The PKC family of serine/threonine kinases regulates apoptosis, proliferation, migration, motility, chemo-resistance, and differentiation.  There are 3 groups: group 1(alpha, betaI, beta II, gamma) which require phospholipids and calcium, group 2 (delta, epsilon, theta, eta) which do not require calcium for activation, and group 3 (xi, iota/lambda) which are atypical and can be activated in the absence of diacylglycerol and calcium. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transd
Probab=52.86  E-value=33  Score=17.91  Aligned_cols=18  Identities=17%  Similarity=0.248  Sum_probs=14.3

Q ss_pred             eEEEEEEeCCCcceEEEEE
Q psy6739          14 QIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a~   32 (56)
                      +|.++|+|+. |.|+|...
T Consensus         3 ~~~~~~~~~~-~~l~v~i~   20 (131)
T cd04026           3 RIYLKISVKD-NKLTVEVR   20 (131)
T ss_pred             EEEEEEEECC-CEEEEEEE
Confidence            5888999988 88887754


No 57 
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. Little is known about the expression or localization of Slp3.  The C2A domain of Slp3 is Ca2+ dependent.  It has been demonstrated that Slp3 promotes dense-core vesicle exocytosis.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids
Probab=51.86  E-value=36  Score=18.11  Aligned_cols=19  Identities=21%  Similarity=0.335  Sum_probs=15.2

Q ss_pred             eEEEEEEeCC-CcceEEEEE
Q psy6739          14 QIEVTFDIDA-NGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~-nGil~V~a~   32 (56)
                      +|++++.|+. .+.|+|.+.
T Consensus         3 ~i~~sl~Y~~~~~~L~V~V~   22 (128)
T cd08392           3 EIEFALHYNFRTSCLEITIK   22 (128)
T ss_pred             EEEEEEEEeCCCCEEEEEEE
Confidence            5899999996 588888753


No 58 
>PF01263 Aldose_epim:  Aldose 1-epimerase;  InterPro: IPR008183 Aldose 1-epimerase (5.1.3.3 from EC) (mutarotase) is the enzyme responsible for the anomeric interconversion of D-glucose and other aldoses between their alpha- and beta-forms. The sequence of mutarotase from two bacteria, Acinetobacter calcoaceticus and Streptococcus thermophilus is available []. It has also been shown that, on the basis of extensive sequence similarities, a mutarotase domain seems to be present in the C-terminal half of the fungal GAL10 protein which encodes, in the N-terminal part, UDP-glucose 4-epimerase.; GO: 0016853 isomerase activity, 0005975 carbohydrate metabolic process; PDB: 1YGA_A 3DCD_A 2CIQ_A 2CIS_A 2CIR_A 2HTB_C 2HTA_B 3Q1N_A 1NSZ_B 1NSR_B ....
Probab=49.58  E-value=45  Score=19.77  Aligned_cols=25  Identities=28%  Similarity=0.511  Sum_probs=17.5

Q ss_pred             CeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739          13 PQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ..++++|+++.++.|+++.+....+
T Consensus       123 ~~l~~~y~L~~~~~L~i~~~v~n~~  147 (300)
T PF01263_consen  123 FRLRITYTLDENGKLTITYEVTNDG  147 (300)
T ss_dssp             EEEEEEEEEETTEEEEEEEEEEESS
T ss_pred             eeeEEEEEECCCCeEEEEEEEEecC
Confidence            4689999999999655555444444


No 59 
>PF13581 HATPase_c_2:  Histidine kinase-like ATPase domain
Probab=48.86  E-value=37  Score=17.38  Aligned_cols=25  Identities=16%  Similarity=0.469  Sum_probs=19.9

Q ss_pred             CeEEEEEEeCCCcceEEEEEeCcCCc
Q psy6739          13 PQIEVTFDIDANGILNVTAIEKSTGK   38 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~~~~~~~   38 (56)
                      ..|.|++..+.++ |++++.|.+.+-
T Consensus        54 ~~v~v~~~~~~~~-l~i~v~D~G~~~   78 (125)
T PF13581_consen   54 GPVDVRLEVDPDR-LRISVRDNGPGF   78 (125)
T ss_pred             cEEEEEEEEcCCE-EEEEEEECCCCC
Confidence            3589999999888 788888877763


No 60 
>PRK10819 transport protein TonB; Provisional
Probab=48.77  E-value=24  Score=21.35  Aligned_cols=15  Identities=40%  Similarity=0.897  Sum_probs=12.6

Q ss_pred             eEEEEEEeCCCcceE
Q psy6739          14 QIEVTFDIDANGILN   28 (56)
Q Consensus        14 ~i~V~f~~d~nGil~   28 (56)
                      .+.|.|.+|.||.++
T Consensus       182 ~V~V~f~I~~~G~V~  196 (246)
T PRK10819        182 QVKVKFDVDEDGRVD  196 (246)
T ss_pred             EEEEEEEECCCCCEE
Confidence            588999999999863


No 61 
>PF11720 Inhibitor_I78:  Peptidase inhibitor I78 family;  InterPro: IPR021719  This family includes Aspergillus elastase inhibitor and belongs to MEROPS peptidase inhibitor family I78. 
Probab=48.73  E-value=20  Score=16.85  Aligned_cols=12  Identities=17%  Similarity=0.769  Sum_probs=7.6

Q ss_pred             EEEEEeCCCcce
Q psy6739          16 EVTFDIDANGIL   27 (56)
Q Consensus        16 ~V~f~~d~nGil   27 (56)
                      ++.|.+|.+|.+
T Consensus        43 RLnv~~D~~g~I   54 (60)
T PF11720_consen   43 RLNVEVDDDGVI   54 (60)
T ss_pred             cEEEEECCCCcE
Confidence            456666666665


No 62 
>PRK10743 heat shock protein IbpA; Provisional
Probab=48.12  E-value=24  Score=19.43  Aligned_cols=11  Identities=27%  Similarity=0.471  Sum_probs=8.7

Q ss_pred             CCcceEEEEEe
Q psy6739          23 ANGILNVTAIE   33 (56)
Q Consensus        23 ~nGil~V~a~~   33 (56)
                      .||+|+|+.--
T Consensus       113 ~dGVL~I~lPK  123 (137)
T PRK10743        113 VNGLLYIDLER  123 (137)
T ss_pred             eCCEEEEEEeC
Confidence            58999998753


No 63 
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domai
Probab=47.68  E-value=41  Score=17.61  Aligned_cols=19  Identities=26%  Similarity=0.181  Sum_probs=14.5

Q ss_pred             eEEEEEEeCC-CcceEEEEE
Q psy6739          14 QIEVTFDIDA-NGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~-nGil~V~a~   32 (56)
                      +|.+++.|+. .|.|+|.+.
T Consensus         1 ~i~~~l~y~~~~~~L~V~Vi   20 (133)
T cd08384           1 KILVSLMYNTQRRGLIVGII   20 (133)
T ss_pred             CEEEEEEEcCCCCEEEEEEE
Confidence            3788999986 588887754


No 64 
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=47.59  E-value=45  Score=17.98  Aligned_cols=19  Identities=26%  Similarity=0.555  Sum_probs=15.7

Q ss_pred             CeEEEEEEeCC-CcceEEEE
Q psy6739          13 PQIEVTFDIDA-NGILNVTA   31 (56)
Q Consensus        13 ~~i~V~f~~d~-nGil~V~a   31 (56)
                      ++|.+.+.|+. .|.|.|.+
T Consensus         2 ~ei~~sL~Y~~~~~~L~V~V   21 (138)
T cd08408           2 PELLLGLEYNALTGRLSVEV   21 (138)
T ss_pred             CeEEEEeEEcCCCCeEEEEE
Confidence            46999999995 68899884


No 65 
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike the case in Slp3 and Slp4/granuphilin in which their C2A domains are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain. In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp3 and Slp4/granuphilin promote dense-core vesicle exocytosis. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into 
Probab=47.35  E-value=40  Score=17.23  Aligned_cols=19  Identities=26%  Similarity=0.406  Sum_probs=15.0

Q ss_pred             eEEEEEEeCC-CcceEEEEE
Q psy6739          14 QIEVTFDIDA-NGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~-nGil~V~a~   32 (56)
                      +|.+.+.|+. .|.|+|.+.
T Consensus         2 ~i~~~l~y~~~~~~L~V~v~   21 (123)
T cd08521           2 EIEFSLSYNYKTGSLEVHIK   21 (123)
T ss_pred             eEEEEEEEeCCCCEEEEEEE
Confidence            5889999985 588988754


No 66 
>PF02768 DNA_pol3_beta_3:  DNA polymerase III beta subunit, C-terminal domain;  InterPro: IPR022635 This entry describes the C-terminal domain of the beta chain of DNA polymerase III. This is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The beta chain is required for initiation of replication from an RNA primer, nucleotide triphosphate (dNTP) residues being added to the 5'-end of the growing DNA chain.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0008408 3'-5' exonuclease activity, 0006260 DNA replication, 0009360 DNA polymerase III complex; PDB: 3P16_A 3RB9_B 2AVT_B 2XUR_B 3Q4K_A 3BEP_A 3D1G_A 1UNN_B 3Q4J_D 2POL_A ....
Probab=47.33  E-value=41  Score=17.44  Aligned_cols=24  Identities=13%  Similarity=0.349  Sum_probs=16.8

Q ss_pred             EEEEeCCCcceEEEEEeCcCCceEE
Q psy6739          17 VTFDIDANGILNVTAIEKSTGKENK   41 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~~~~~~~~~   41 (56)
                      |.|.++ ++.|++++...+.|...+
T Consensus        37 v~l~~~-~~~l~l~~~~~~~g~~~e   60 (121)
T PF02768_consen   37 VKLSFS-DNQLTLSSQSSEIGEAEE   60 (121)
T ss_dssp             EEEEEE-TTEEEEEEEETTTEEEEE
T ss_pred             EEEEEE-CCEEEEEEcCCCCceEEE
Confidence            344444 888999999887776543


No 67 
>PF13595 DUF4138:  Domain of unknown function (DUF4138)
Probab=46.67  E-value=56  Score=19.81  Aligned_cols=30  Identities=27%  Similarity=0.525  Sum_probs=26.2

Q ss_pred             EEEeCCCcceEEEEEeCcCCceEEEEEEcC
Q psy6739          18 TFDIDANGILNVTAIEKSTGKENKITITND   47 (56)
Q Consensus        18 ~f~~d~nGil~V~a~~~~~~~~~~~~i~~~   47 (56)
                      .|++-.+-.|.|+..+...|+...+.++..
T Consensus       209 KFT~pd~K~L~Iel~EknGgR~~~l~I~~~  238 (246)
T PF13595_consen  209 KFTIPDDKVLEIELYEKNGGRHITLKIENE  238 (246)
T ss_pred             eeecCCCCEEEEEEEEcCCCceEEEEEChH
Confidence            577788899999999999999999998753


No 68 
>PF02929 Bgal_small_N:  Beta galactosidase small chain;  InterPro: IPR004199 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Beta-galactosidase enzymes (3.2.1.23 from EC) belong to several glycoside hydrolase families: GH1 from CAZY, GH2 from CAZY, GH35 from CAZY and GH42 from CAZY. Beta-galactosidase is the product of the lac operon Z gene of Escherichia coli. This enzyme catalyses the hydrolysis of the disaccharide lactose to galactose and glucose, and can also convert lactose to allolactose, the inducer of the lac operon. This domain is found in single chain beta-galactosidases, which are comprised of five domains. The active site is located in a deep pocket built around the central alpha-beta barrel, with the other domains conferring specificity for a disaccharide substrate. This entry represents domain 5 of glycoside hydrolase family 2, which contains an N-terminal loop that swings towards the active site upon the deep binding of a ligand to produce a closed conformation []. This domain is also found in the amino-terminal portion of the small chain of dimeric beta-galactosidases.; GO: 0004565 beta-galactosidase activity, 0005975 carbohydrate metabolic process, 0009341 beta-galactosidase complex; PDB: 1JZ3_D 1JYY_H 1GHO_P 3VD9_B 3I3E_B 3T0B_A 3T09_C 1F4A_D 3VDC_C 3VDB_D ....
Probab=46.46  E-value=36  Score=20.65  Aligned_cols=25  Identities=24%  Similarity=0.466  Sum_probs=19.4

Q ss_pred             CeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739          13 PQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ....+++.++.||.|.|+..-...+
T Consensus        98 ~~~~~~y~i~~dG~i~v~~~~~~~~  122 (276)
T PF02929_consen   98 FEVTITYTIYADGTIKVDMTFEPSG  122 (276)
T ss_dssp             EEEEEEEEEETTSEEEEEEEEEEET
T ss_pred             EEEEEEEEEcCCCEEEEEEEEEeCC
Confidence            3578899999999999887654444


No 69 
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane.  They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus.  Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and
Probab=46.18  E-value=43  Score=17.26  Aligned_cols=19  Identities=26%  Similarity=0.447  Sum_probs=15.0

Q ss_pred             eEEEEEEeCC-CcceEEEEE
Q psy6739          14 QIEVTFDIDA-NGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~-nGil~V~a~   32 (56)
                      +|.+++.|+. +|.|+|.+.
T Consensus         4 ~l~~~l~y~~~~~~L~V~v~   23 (124)
T cd08385           4 KLQFSLDYDFQSNQLTVGII   23 (124)
T ss_pred             EEEEEEEEeCCCCEEEEEEE
Confidence            5899999984 588987754


No 70 
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length. SHD of Slp (except for the Slp4-SHD) function as a specific Rab27A/B-binding domain.  In addition to Slp, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins. It has been demonstrated that Slp4/granuphilin promotes dense-core vesicle exocytosis. The C2A domain of Slp4 is Ca2+ dependent. Slp5 mRNA has been shown to be restricted to human placenta and liver suggesting a role in Rab27A-dependent membrane trafficking in specific tissues. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2
Probab=46.18  E-value=45  Score=17.54  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=14.7

Q ss_pred             eEEEEEEeC-CCcceEEEEE
Q psy6739          14 QIEVTFDID-ANGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d-~nGil~V~a~   32 (56)
                      +|.+++.|+ ..|.|+|.+.
T Consensus         3 ~i~~sl~y~~~~~~L~V~Vi   22 (125)
T cd04029           3 EILFSLSYDYKTQSLNVHVK   22 (125)
T ss_pred             EEEEEEEEECCCCeEEEEEE
Confidence            589999998 4478888753


No 71 
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involv
Probab=46.01  E-value=43  Score=17.27  Aligned_cols=19  Identities=37%  Similarity=0.732  Sum_probs=15.2

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+++.|+.. |.|.|.+.
T Consensus         4 ~l~~sl~y~~~~~~L~V~v~   23 (124)
T cd08387           4 ELHFSLEYDKDMGILNVKLI   23 (124)
T ss_pred             EEEEEEEECCCCCEEEEEEE
Confidence            68999999965 88888754


No 72 
>PF04314 DUF461:  Protein of unknown function (DUF461);  InterPro: IPR007410 This entry represents a domain found in of proteins of unknown function, including DR1885 from Deinococcus radiodurans and CC3502 from Caulobacter crescentus (Caulobacter vibrioides), which share a potential metal binding motif H(M)X10MX21HXM. DR1885 was found to bind copper(I) through a histidine and three Mets in a cupredoxin-like fold []. The surface location of the copper-binding site as well as the type of coordination are well poised for metal transfer chemistry, suggesting that DR1885 might transfer copper, taking the role of Cox17 in bacteria (Cox17 being an accessory protein required for correct assembly of eukaryotic cyochrome c oxidase). ; PDB: 2K6W_A 2K6Z_A 2K6Y_A 2K70_A 1X9L_A 2JQA_A.
Probab=45.19  E-value=29  Score=18.12  Aligned_cols=20  Identities=20%  Similarity=0.419  Sum_probs=11.4

Q ss_pred             CCCcCeEEEEEEeCCCcceEE
Q psy6739           9 PRGVPQIEVTFDIDANGILNV   29 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~V   29 (56)
                      ..|+ .+.++|..+..|.++|
T Consensus        90 ~~G~-~v~ltL~f~~gg~v~v  109 (110)
T PF04314_consen   90 KPGD-TVPLTLTFEDGGKVTV  109 (110)
T ss_dssp             -TTE-EEEEEEEETTTEEEEE
T ss_pred             CCCC-EEEEEEEECCCCEEEe
Confidence            3343 4666666666666655


No 73 
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones]
Probab=45.10  E-value=23  Score=19.33  Aligned_cols=13  Identities=38%  Similarity=0.524  Sum_probs=9.6

Q ss_pred             CCcceEEEEEeCc
Q psy6739          23 ANGILNVTAIEKS   35 (56)
Q Consensus        23 ~nGil~V~a~~~~   35 (56)
                      .||+|+|+..-..
T Consensus       122 ~nGvL~I~lpk~~  134 (146)
T COG0071         122 KNGLLTVTLPKAE  134 (146)
T ss_pred             eCcEEEEEEeccc
Confidence            5899999875433


No 74 
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2. All Slp members basically share an N-terminal Slp homology domain (SHD) and C-terminal tandem C2 domains (named the C2A domain and the C2B domain) with the SHD and C2 domains being separated by a linker sequence of various length.  Slp1/JFC1 and Slp2/exophilin 4 promote granule docking to the plasma membrane.  Additionally, their C2A domains are both Ca2+ independent, unlike Slp3 and Slp4/granuphilin which are Ca2+ dependent.  It is thought that SHD (except for the Slp4-SHD) functions as a specific Rab27A/B-binding domain.  In addition to Slps, rabphilin, Noc2, and  Munc13-4 also function as Rab27-binding proteins.  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety 
Probab=45.09  E-value=47  Score=17.41  Aligned_cols=19  Identities=26%  Similarity=0.461  Sum_probs=15.1

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+.+.|+.. +.|+|.+.
T Consensus         3 ~i~~sl~y~~~~~~L~V~vi   22 (125)
T cd08393           3 SVQFALDYDPKLRELHVHVI   22 (125)
T ss_pred             EEEEEEEEECCCCEEEEEEE
Confidence            58899999977 77888753


No 75 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=45.09  E-value=32  Score=17.34  Aligned_cols=16  Identities=31%  Similarity=0.420  Sum_probs=13.0

Q ss_pred             EEEeCCCcceEEEEEe
Q psy6739          18 TFDIDANGILNVTAIE   33 (56)
Q Consensus        18 ~f~~d~nGil~V~a~~   33 (56)
                      ..+||.||-++|.+..
T Consensus        40 mI~~~~~G~i~V~~iC   55 (76)
T PF10955_consen   40 MISYDENGDIHVKVIC   55 (76)
T ss_pred             heEEcCCCCEEEEEec
Confidence            3679999999998765


No 76 
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=44.62  E-value=27  Score=17.58  Aligned_cols=16  Identities=25%  Similarity=0.528  Sum_probs=10.3

Q ss_pred             EEEEEEeCCCcceEEE
Q psy6739          15 IEVTFDIDANGILNVT   30 (56)
Q Consensus        15 i~V~f~~d~nGil~V~   30 (56)
                      =.+.|.+|.+|.|.--
T Consensus        47 q~l~f~~d~~g~L~~L   62 (85)
T PF04225_consen   47 QTLEFQLDEDGQLTAL   62 (85)
T ss_dssp             -EEEEEE-TTS-EEEE
T ss_pred             CEEEEEECCCCCEEEE
Confidence            3589999999997543


No 77 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=44.41  E-value=15  Score=17.70  Aligned_cols=9  Identities=33%  Similarity=0.818  Sum_probs=7.5

Q ss_pred             EeCCCcceE
Q psy6739          20 DIDANGILN   28 (56)
Q Consensus        20 ~~d~nGil~   28 (56)
                      .+|.||.|+
T Consensus        27 yVd~~G~L~   35 (63)
T PF13127_consen   27 YVDEDGVLH   35 (63)
T ss_pred             eECCCCeEe
Confidence            489999986


No 78 
>cd01419 MoaC_A MoaC family, archaeal. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine derivative to the precursor Z by inserting the carbon-8 of the purine between the 2' and 3' ribose carbon atoms, which is the first of three phases of Moco biosynthesis.
Probab=43.41  E-value=61  Score=18.26  Aligned_cols=25  Identities=24%  Similarity=0.585  Sum_probs=16.6

Q ss_pred             cCeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739          12 VPQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ...++|.|.++.++ +.+.++....+
T Consensus        67 l~~v~v~~~~~~~~-i~i~~~v~t~~   91 (141)
T cd01419          67 ITGVDVDFEVEEDG-IEVRCTVKTTY   91 (141)
T ss_pred             ceEEEEEEEEcCCE-EEEEEEEEEcC
Confidence            34689999999885 55655544433


No 79 
>COG2892 Uncharacterized protein conserved in archaea [Function unknown]
Probab=43.37  E-value=37  Score=17.42  Aligned_cols=22  Identities=32%  Similarity=0.462  Sum_probs=15.9

Q ss_pred             eEEEEEEeCCCcc-eEEEEEeCc
Q psy6739          14 QIEVTFDIDANGI-LNVTAIEKS   35 (56)
Q Consensus        14 ~i~V~f~~d~nGi-l~V~a~~~~   35 (56)
                      +-.+.|..|.|-+ |+|.|.|..
T Consensus        34 rSrv~l~~~~~rI~l~I~A~D~s   56 (82)
T COG2892          34 RSRVKLERDGNRIVLEIRAEDSS   56 (82)
T ss_pred             cceeEEEecCCEEEEEEEecchH
Confidence            4678888886655 778887754


No 80 
>cd01420 MoaC_PE MoaC family, prokaryotic and eukaryotic. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine derivative to the precursor Z by inserting the carbon-8 of the purine between the 2' and 3' ribose carbon atoms, which is the first of three phases of Moco biosynthesis.
Probab=43.29  E-value=61  Score=18.21  Aligned_cols=28  Identities=21%  Similarity=0.519  Sum_probs=19.6

Q ss_pred             CcCeEEEEEEeCCC-cceEEEEEeCcCCc
Q psy6739          11 GVPQIEVTFDIDAN-GILNVTAIEKSTGK   38 (56)
Q Consensus        11 g~~~i~V~f~~d~n-Gil~V~a~~~~~~~   38 (56)
                      ....++|.|.++.+ +.++++++....++
T Consensus        66 ~l~~v~v~~~~~~~~~~i~i~~~v~~~~k   94 (140)
T cd01420          66 PLTGVDVDFELDEETSGVRIEATVRTTGR   94 (140)
T ss_pred             cccEEEEEEEEcCCCCEEEEEEEEEEccC
Confidence            34569999999987 45777776655444


No 81 
>PF15534 Toxin_56:  Putative toxin 56
Probab=43.24  E-value=40  Score=17.04  Aligned_cols=17  Identities=18%  Similarity=0.456  Sum_probs=12.8

Q ss_pred             eEEEEEEeCCCcceEEEE
Q psy6739          14 QIEVTFDIDANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a   31 (56)
                      .++|||.. .||.+.++.
T Consensus        59 ~vtVt~~~-~dG~~~IS~   75 (79)
T PF15534_consen   59 TVTVTYFF-KDGKVRISD   75 (79)
T ss_pred             EEEEEEEe-eCCEEEeee
Confidence            48888887 888887754


No 82 
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms]
Probab=43.23  E-value=69  Score=19.82  Aligned_cols=28  Identities=18%  Similarity=0.404  Sum_probs=22.6

Q ss_pred             cCeEEEEEEeCCCcceEEEEEeCcCCceE
Q psy6739          12 VPQIEVTFDIDANGILNVTAIEKSTGKEN   40 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~~~~~~~~~   40 (56)
                      -..+.|++.++.++ |.+++.|.+.|-..
T Consensus       297 A~~v~V~l~~~~~~-l~l~V~DnG~Gf~~  324 (365)
T COG4585         297 ATEVRVTLERTDDE-LRLEVIDNGVGFDP  324 (365)
T ss_pred             CceEEEEEEEcCCE-EEEEEEECCcCCCc
Confidence            34699999999988 88888888777653


No 83 
>PRK11597 heat shock chaperone IbpB; Provisional
Probab=43.15  E-value=48  Score=18.44  Aligned_cols=25  Identities=24%  Similarity=0.469  Sum_probs=16.3

Q ss_pred             CCcceEEEEEeC--cCCceEEEEEEcC
Q psy6739          23 ANGILNVTAIEK--STGKENKITITND   47 (56)
Q Consensus        23 ~nGil~V~a~~~--~~~~~~~~~i~~~   47 (56)
                      .||+|+|+.--.  ...+.+.+.|...
T Consensus       111 ~nGVL~I~lPK~~~~~~~~rkI~I~~~  137 (142)
T PRK11597        111 VNGLLHIDLIRNEPEAIAPQRIAISER  137 (142)
T ss_pred             cCCEEEEEEeccCccccCCcEEEECCc
Confidence            689999998532  3344566777543


No 84 
>cd08680 C2_Kibra C2 domain found in Human protein Kibra. Kibra is thought to be a regulator of the Salvador (Sav)/Warts (Wts)/Hippo (Hpo) (SWH) signaling network, which limits tissue growth by inhibiting cell proliferation and promoting apoptosis. The core of the pathway consists of a MST and LATS family kinase cascade that ultimately phosphorylates and inactivates the YAP/Yorkie (Yki) transcription coactivator. The FERM domain proteins Merlin (Mer) and Expanded (Ex) are part of the upstream regulation controlling pathway mechanism.  Kibra colocalizes and associates with Mer and Ex and is thought to transduce an extracellular signal via the SWH network. The apical scaffold machinery that contains Hpo, Wts, and Ex recruits Yki to the apical membrane facilitating its inhibitory phosphorlyation by Wts.  Since Kibra associates with Ex and is apically located it is hypothesized that KIBRA is part of the scaffold, helps in the Hpo/Wts complex, and helps recruit Yki for inactivation that prom
Probab=42.57  E-value=54  Score=17.45  Aligned_cols=18  Identities=17%  Similarity=0.405  Sum_probs=15.0

Q ss_pred             eEEEEEEeCCC-cceEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a   31 (56)
                      +|.+++.||.. |.|+|.+
T Consensus         2 ~i~~sL~Y~~~~~~L~V~V   20 (124)
T cd08680           2 QVQIGLRYDSGDSSLVISV   20 (124)
T ss_pred             eEEEEEEECCCCCEEEEEE
Confidence            58999999975 7799885


No 85 
>PF09972 DUF2207:  Predicted membrane protein (DUF2207);  InterPro: IPR018702 This domain has no known function.
Probab=41.55  E-value=41  Score=21.40  Aligned_cols=18  Identities=28%  Similarity=0.477  Sum_probs=15.7

Q ss_pred             CeEEEEEEeCCCcceEEE
Q psy6739          13 PQIEVTFDIDANGILNVT   30 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~   30 (56)
                      .+++|+..++.||.++|+
T Consensus         5 ~~~~v~~~v~~dG~~~V~   22 (511)
T PF09972_consen    5 DSYDVDATVQEDGSLDVT   22 (511)
T ss_pred             eeeEEEEEECCCCcEEEE
Confidence            358899999999999887


No 86 
>TIGR01643 YD_repeat_2x YD repeat (two copies). This model describes two tandem copies of a 21-residue extracellular repeat found in Gram-negative, Gram-positive, and animal proteins. The repeat is named for a YD dipeptide, the most strongly conserved motif of the repeat. These repeats appear in general to be involved in binding carbohydrate; the chicken teneurin-1 YD-repeat region has been shown to bind heparin.
Probab=40.21  E-value=33  Score=14.29  Aligned_cols=14  Identities=29%  Similarity=0.358  Sum_probs=11.3

Q ss_pred             EEEEEeCCCcceEE
Q psy6739          16 EVTFDIDANGILNV   29 (56)
Q Consensus        16 ~V~f~~d~nGil~V   29 (56)
                      ..+|.||..|.|.-
T Consensus        17 ~~~~~YD~~Grl~~   30 (42)
T TIGR01643        17 TTRYTYDAAGRLVE   30 (42)
T ss_pred             EEEEEECCCCCEEE
Confidence            48899999999843


No 87 
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Human (h) HspB10 occurs exclusively in the axoneme of sperm cells and may have a cytoskeletal role.
Probab=39.90  E-value=32  Score=17.44  Aligned_cols=17  Identities=12%  Similarity=0.401  Sum_probs=12.2

Q ss_pred             EEEEEEeCCCcceEEEE
Q psy6739          15 IEVTFDIDANGILNVTA   31 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a   31 (56)
                      =.|+-+|..+|+|++.+
T Consensus        69 d~i~A~~~~~~~l~i~~   85 (87)
T cd06482          69 KDVTYSYGLGSVVKIET   85 (87)
T ss_pred             HHcEEEEcCCCEEEEee
Confidence            34666777788888875


No 88 
>PF02294 7kD_DNA_binding:  7kD DNA-binding domain;  InterPro: IPR003212 This family contains members of the hyperthermophilic archaebacterium 7kDa DNA-binding/endoribonuclease P2 family. There are five 7kDa DNA-binding proteins, 7a-7e, found as monomers in the cell. Protein 7e shows the tightest DNA-binding ability.; GO: 0003677 DNA binding, 0004521 endoribonuclease activity; PDB: 1SSO_A 2CVR_A 1B4O_A 2XIW_B 1WTV_A 1WTQ_A 1BF4_A 1WVL_B 1WTR_A 1WTP_B ....
Probab=39.86  E-value=21  Score=16.84  Aligned_cols=12  Identities=42%  Similarity=0.573  Sum_probs=8.6

Q ss_pred             EEEEEeCC-Ccce
Q psy6739          16 EVTFDIDA-NGIL   27 (56)
Q Consensus        16 ~V~f~~d~-nGil   27 (56)
                      -|.|.||. ||.-
T Consensus        28 mvsftyddgngkt   40 (62)
T PF02294_consen   28 MVSFTYDDGNGKT   40 (62)
T ss_dssp             EEEEEEECSSSSE
T ss_pred             eEEEEEecCCCcc
Confidence            37899987 6653


No 89 
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulat
Probab=39.57  E-value=56  Score=16.70  Aligned_cols=19  Identities=21%  Similarity=0.279  Sum_probs=14.8

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+.+.|+.. +.|+|.+.
T Consensus         2 ~l~~~l~y~~~~~~L~V~v~   21 (123)
T cd08390           2 RLWFSVQYDLEEEQLTVSLI   21 (123)
T ss_pred             EEEEEEEECCCCCEEEEEEE
Confidence            58899999965 67887754


No 90 
>TIGR02794 tolA_full TolA protein. TolA couples the inner membrane complex of itself with TolQ and TolR to the outer membrane complex of TolB and OprL (also called Pal). Most of the length of the protein consists of low-complexity sequence that may differ in both length and composition from one species to another, complicating efforts to discriminate TolA (the most divergent gene in the tol-pal system) from paralogs such as TonB. Selection of members of the seed alignment and criteria for setting scoring cutoffs are based largely conserved operon struction. //The Tol-Pal complex is required for maintaining outer membrane integrity. Also involved in transport (uptake) of colicins and filamentous DNA, and implicated in pathogenesis. Transport is energized by the proton motive force. TolA is an inner membrane protein that interacts with periplasmic TolB and with outer membrane porins ompC, phoE and lamB.
Probab=38.11  E-value=81  Score=20.10  Aligned_cols=22  Identities=23%  Similarity=0.412  Sum_probs=15.8

Q ss_pred             CCCCCcCeEEEEEEeCCCcceEE
Q psy6739           7 PAPRGVPQIEVTFDIDANGILNV   29 (56)
Q Consensus         7 ~~p~g~~~i~V~f~~d~nGil~V   29 (56)
                      +.-+|. .+.|.|.++.||.|.-
T Consensus       280 ~~~~g~-~v~V~I~L~pdG~V~~  301 (346)
T TIGR02794       280 PSFRGK-TCRLRIRLAPDGTLLS  301 (346)
T ss_pred             cccCCC-EEEEEEEECCCCCEEe
Confidence            333454 5899999999998643


No 91 
>PF09244 DUF1964:  Domain of unknown function (DUF1964);  InterPro: IPR015325 This domain is C-terminal to the catalytic sucrose phosphorylase beta/alpha barrel domain. It adopts a beta-sandwich fold, with Greek-key topology and is functionally uncharacterised []. ; PDB: 1R7A_B 2GDU_A 2GDV_A.
Probab=38.08  E-value=51  Score=16.12  Aligned_cols=32  Identities=22%  Similarity=0.331  Sum_probs=19.3

Q ss_pred             EEEeCCCcceEEEEEeCcCCceEEEEEEcCCC
Q psy6739          18 TFDIDANGILNVTAIEKSTGKENKITITNDRG   49 (56)
Q Consensus        18 ~f~~d~nGil~V~a~~~~~~~~~~~~i~~~~~   49 (56)
                      .|+|..||-..++-+=.....+..++++...|
T Consensus         5 ~FSy~~dgdtSitf~W~g~~t~atLtFePg~G   36 (68)
T PF09244_consen    5 EFSYEADGDTSITFTWTGATTSATLTFEPGRG   36 (68)
T ss_dssp             EEEEEEETTTEEEEEEE-SS-EEEEEE-GGGC
T ss_pred             eeeEecCCCcEEEEEEeccccEEEEEEccCcc
Confidence            57777777766666666666677777776433


No 92 
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families in
Probab=37.97  E-value=44  Score=21.77  Aligned_cols=25  Identities=28%  Similarity=0.325  Sum_probs=19.2

Q ss_pred             CCCCCCCcCeEEEEEEeCCCcceEEE
Q psy6739           5 IPPAPRGVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus         5 ip~~p~g~~~i~V~f~~d~nGil~V~   30 (56)
                      |+..|.+.. |+|...+|.+|+--+.
T Consensus       341 I~nLp~d~v-VEvp~~v~~~Gi~P~~  365 (425)
T cd05197         341 IANIDDDVV-VEVPCLVDKNGPHPIK  365 (425)
T ss_pred             CCCCCCCCE-EEEeEEEcCCCceecc
Confidence            566777765 9999999999975443


No 93 
>PF13750 Big_3_3:  Bacterial Ig-like domain (group 3)
Probab=37.58  E-value=72  Score=17.90  Aligned_cols=30  Identities=23%  Similarity=0.293  Sum_probs=18.6

Q ss_pred             CCCcceEEEEEeCcCCce-EEEEEEcCCCCC
Q psy6739          22 DANGILNVTAIEKSTGKE-NKITITNDRGRL   51 (56)
Q Consensus        22 d~nGil~V~a~~~~~~~~-~~~~i~~~~~~l   51 (56)
                      +..-.|+|.|.|.+-+.. +.+.|...+.+|
T Consensus       122 ~~~YtLtV~a~D~aGN~~~~si~F~y~P~~~  152 (158)
T PF13750_consen  122 DDSYTLTVSATDKAGNQSTKSISFSYMPPNL  152 (158)
T ss_pred             CCeEEEEEEEEecCCCEEEEEEEEEEeCCee
Confidence            444569999999765554 556665544433


No 94 
>PF15417 DUF4624:  Domain of unknown function (DUF4624)
Probab=37.53  E-value=37  Score=18.62  Aligned_cols=17  Identities=35%  Similarity=0.749  Sum_probs=12.2

Q ss_pred             eEEEEEEeCCC-cceEEE
Q psy6739          14 QIEVTFDIDAN-GILNVT   30 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~   30 (56)
                      .-+|+|++|.+ |+++|.
T Consensus        50 ~aEv~f~mDGe~~iVEiK   67 (132)
T PF15417_consen   50 DAEVYFQMDGESGIVEIK   67 (132)
T ss_pred             eeEEEEEEcCccceEEec
Confidence            35789999966 666664


No 95 
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family. This CD contains members of the regulator of G-protein signaling (RGS) family. RGS is a GTPase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. There are multiple alternatively spliced transcript variants in this family with some members having additional domains (ex. PDZ and RGS) downstream of the C2 domain. The C2 domain was first identified in PKC. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind pho
Probab=37.24  E-value=65  Score=16.82  Aligned_cols=18  Identities=17%  Similarity=0.346  Sum_probs=13.0

Q ss_pred             eEEEEEEeCCCcceEEEEE
Q psy6739          14 QIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a~   32 (56)
                      +|.++|.+ .+|.|+|.+.
T Consensus         2 ~l~l~~~~-~~~~L~V~Vi   19 (119)
T cd08685           2 QLKLSIEG-QNRKLTLHVL   19 (119)
T ss_pred             EEEEEEEE-cCCEEEEEEE
Confidence            46777777 5788888753


No 96 
>PF15043 CNRIP1:  CB1 cannabinoid receptor-interacting protein 1
Probab=37.18  E-value=82  Score=18.17  Aligned_cols=29  Identities=21%  Similarity=0.538  Sum_probs=21.5

Q ss_pred             cCCCCCCCCc-CeEEEEEEeCCCcceEEEE
Q psy6739           3 TSIPPAPRGV-PQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         3 ~~ip~~p~g~-~~i~V~f~~d~nGil~V~a   31 (56)
                      .|+++..+|+ ..|.|.+..+.-|.+.+-.
T Consensus        89 ~G~~~TKsG~Rq~i~i~~~f~~~g~~~~~~  118 (161)
T PF15043_consen   89 EGVPPTKSGERQPIQISMQFNPGGTLETVW  118 (161)
T ss_pred             CCCCcccCCccccEEEEEEecCcceEEEEE
Confidence            5788877776 2388999998888776553


No 97 
>PF06903 VirK:  VirK protein;  InterPro: IPR010694 This family consists of several bacterial VirK proteins of around 145 residues in length. The function of this family is unknown [].
Probab=37.17  E-value=66  Score=17.04  Aligned_cols=18  Identities=17%  Similarity=0.324  Sum_probs=14.2

Q ss_pred             EEEEeCCCcceEEEEEeC
Q psy6739          17 VTFDIDANGILNVTAIEK   34 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~~   34 (56)
                      ++|+++.||.++++..-.
T Consensus        77 ~rY~i~~dg~~~f~~~~~   94 (100)
T PF06903_consen   77 IRYQIRPDGSASFTTTIL   94 (100)
T ss_pred             EEEEEcCCCcEEEEEEEe
Confidence            788899999988877543


No 98 
>PF02144 Rad1:  Repair protein Rad1/Rec1/Rad17;  InterPro: IPR003021 REC1 of Ustilago maydis plays a key role in regulating the genetic system of the fungus. REC1 mutants are very sensitive to UV light. Mutation leads to a complex phenotype with alterations in DNA repair, recombination, mutagenesis, meiosis and cell division []. The predicted product of the REC1 gene is a polypeptide of 522 amino acid residues with molecular mass 57kDa. The protein shows 3'--5' exonuclease activity, but only in cells over-expressing REC1 []. While it is distinguishable from the major bacterial nucleases, the protein has certain enzymatic features in common with epsilon, the proof-reading exonuclease subunit of Escherichia coli DNA polymerase III holoenzyme []. The rad1 gene of Schizosaccharomyces pombe comprises three exons and encodes a 37kDa protein that exhibits partial similarity to the REC1 gene of U. maydis []. The two genes share putative functional similarities in their respective organisms.; GO: 0003684 damaged DNA binding, 0008853 exodeoxyribonuclease III activity, 0006281 DNA repair, 0005634 nucleus; PDB: 3G65_B 3GGR_C 3A1J_C.
Probab=37.09  E-value=34  Score=20.77  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=12.8

Q ss_pred             EEEEEEeCCCcceEEE
Q psy6739          15 IEVTFDIDANGILNVT   30 (56)
Q Consensus        15 i~V~f~~d~nGil~V~   30 (56)
                      .+|.+.+|.+|+|.+.
T Consensus       257 sKv~ir~d~~GlLs~Q  272 (275)
T PF02144_consen  257 SKVSIRIDENGLLSLQ  272 (275)
T ss_dssp             SEEEEEEESSS-EEEE
T ss_pred             cEEEEEeCCCcEEEEE
Confidence            5789999999999875


No 99 
>COG3061 OapA Cell envelope opacity-associated protein A [Cell envelope biogenesis, outer membrane]
Probab=36.99  E-value=1e+02  Score=18.91  Aligned_cols=27  Identities=19%  Similarity=0.341  Sum_probs=20.2

Q ss_pred             CCCCcCeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739           8 APRGVPQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus         8 ~p~g~~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ..+|.   .|+|++|.+|.++.-..+...+
T Consensus       200 lkaGq---~Vki~~naqG~Vt~L~le~~n~  226 (242)
T COG3061         200 LKAGQ---KVKISLNAQGRVTELRLETGNN  226 (242)
T ss_pred             ccCCC---EEEEEEcCccceEEEEeccCCc
Confidence            34554   4899999999998877766555


No 100
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 7, a member of class 2 synaptotagmins, is located in presynaptic plasma membranes in neurons, dense-core vesicles in endocrine cells, and lysosomes in fibroblasts.  It has been shown to play a role in regulation of Ca2+-dependent lysosomal exocytosis in fibroblasts and may also function as a vesicular Ca2+-sensor.  It is distinguished from the other synaptotagmins by having over 12 splice forms. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic ves
Probab=36.93  E-value=67  Score=16.89  Aligned_cols=19  Identities=11%  Similarity=0.256  Sum_probs=14.8

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      ++.+++.|+.. |.|+|.+.
T Consensus         3 ~l~~sl~y~~~~~~L~v~vi   22 (136)
T cd08405           3 ELLLSLCYNPTANRITVNII   22 (136)
T ss_pred             EEEEEEEEcCCCCeEEEEEE
Confidence            58899999865 78887754


No 101
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=36.68  E-value=15  Score=18.31  Aligned_cols=18  Identities=17%  Similarity=0.383  Sum_probs=7.0

Q ss_pred             eEEEEEEeCCCcceEEEE
Q psy6739          14 QIEVTFDIDANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a   31 (56)
                      -..|..++|.||.+.+..
T Consensus        35 L~rvsvsv~~~G~~~~~~   52 (73)
T PF08772_consen   35 LKRVSVSVDEDGKIKLHL   52 (73)
T ss_dssp             -EEEE-B--SS---B---
T ss_pred             ceEEEEEECCCCCEEEEe
Confidence            378999999999887654


No 102
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain. Rabphilin is found neurons and in neuroendrocrine cells, while Doc2 is found not only in the brain but in tissues, including mast cells, chromaffin cells, and osteoblasts.  Rabphilin and Doc2s share highly homologous tandem C2 domains, although their N-terminal structures are completely different: rabphilin contains an N-terminal Rab-binding domain (RBD),7 whereas Doc2 contains an N-terminal Munc13-1-interacting domain (MID). C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain
Probab=36.43  E-value=65  Score=16.56  Aligned_cols=19  Identities=32%  Similarity=0.378  Sum_probs=14.7

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+.+.||.+ +.|+|.+.
T Consensus         3 ~~~~~l~y~~~~~~L~V~v~   22 (123)
T cd04035           3 TLEFTLLYDPANSALHCTII   22 (123)
T ss_pred             EEEEEEEEeCCCCEEEEEEE
Confidence            58899999976 77887643


No 103
>PF15283 DUF4595:  Domain of unknown function (DUF4595) with porin-like fold
Probab=35.67  E-value=89  Score=17.93  Aligned_cols=15  Identities=33%  Similarity=0.441  Sum_probs=11.3

Q ss_pred             eEEEEEEeCCCcceE
Q psy6739          14 QIEVTFDIDANGILN   28 (56)
Q Consensus        14 ~i~V~f~~d~nGil~   28 (56)
                      .-.-+|+||.+|.|.
T Consensus        71 ~~t~~FtYn~~~qL~   85 (197)
T PF15283_consen   71 TDTYTFTYNADGQLT   85 (197)
T ss_pred             EEEEEEEECCCCceE
Confidence            467788999777764


No 104
>PF10296 DUF2404:  Putative integral membrane protein conserved region (DUF2404);  InterPro: IPR019411  This is entry represents a domain of unknown function found in mitochondrial distribution and morphology proteins Mdm12 and Mdm34, and in maintenance of mitochondrial morphology protein Mmm1. These proteins are components of the ERMES/MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria []. 
Probab=34.83  E-value=66  Score=16.14  Aligned_cols=25  Identities=20%  Similarity=0.181  Sum_probs=16.3

Q ss_pred             CCCCcCeEEEEEEeCCCcceEEEEE
Q psy6739           8 APRGVPQIEVTFDIDANGILNVTAI   32 (56)
Q Consensus         8 ~p~g~~~i~V~f~~d~nGil~V~a~   32 (56)
                      .+.|...+++.+.|+.+..+++++.
T Consensus        64 ~~~g~~~~~~dv~Y~G~~~l~l~t~   88 (91)
T PF10296_consen   64 DPDGELWIEFDVSYSGGFSLTLETK   88 (91)
T ss_pred             CCCCCEEEEEEEEEcCCeEEEEEEE
Confidence            4556556777777777666666654


No 105
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as 
Probab=34.12  E-value=71  Score=16.31  Aligned_cols=19  Identities=26%  Similarity=0.300  Sum_probs=15.1

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      ++.+++.|+.. |.|+|.+.
T Consensus         4 ~l~~~l~~~~~~~~L~V~vi   23 (125)
T cd04031           4 RIQIQLWYDKVTSQLIVTVL   23 (125)
T ss_pred             EEEEEEEEeCCCCEEEEEEE
Confidence            58899999974 88987754


No 106
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. ScHsp26 is temperature-regulated, it switches from an inactive to a chaperone-active form upon elevation in temperature. It associates into large 24-mers storage forms which upon heat shock disassociate into dimers. These dimers initiate the interaction with non-native substrate proteins and re-assemble into large globular assemblies having one monomer of substrate bound per dimer. This group also contains Arabidopsis thaliana (Ath) Hsp15.7, a peroxisomal matrix protein which can complement the morphological phenotype of S. cerevisiae mutants deficient in Hsps26. AthHsp15.7 is minimally expressed under normal conditions and is strongly induced by heat and oxidative st
Probab=33.82  E-value=58  Score=16.15  Aligned_cols=17  Identities=12%  Similarity=0.421  Sum_probs=11.7

Q ss_pred             EEEEeCCCcceEEEEEe
Q psy6739          17 VTFDIDANGILNVTAIE   33 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~   33 (56)
                      +.+.++.++.|+|++.-
T Consensus        25 i~i~v~~~~~L~I~g~~   41 (92)
T cd06472          25 VKVEVEDGRVLRISGER   41 (92)
T ss_pred             EEEEEeCCCEEEEEEEe
Confidence            44455656789999864


No 107
>cd00528 MoaC MoaC family. Members of this family are involved in molybdenum cofactor (Moco) biosynthesis, an essential cofactor of a diverse group of redox enzymes. MoaC, a small hexameric protein, converts, together with MoaA, a guanosine derivative to the precursor Z by inserting the carbon-8 of the purine between the 2' and 3' ribose carbon atoms, which is the first of three phases of Moco biosynthesis.
Probab=33.18  E-value=93  Score=17.39  Aligned_cols=27  Identities=26%  Similarity=0.578  Sum_probs=18.1

Q ss_pred             cCeEEEEEEeCCC-cceEEEEEeCcCCc
Q psy6739          12 VPQIEVTFDIDAN-GILNVTAIEKSTGK   38 (56)
Q Consensus        12 ~~~i~V~f~~d~n-Gil~V~a~~~~~~~   38 (56)
                      ...++|.|.++.+ +-+++.++....++
T Consensus        67 l~~v~v~~~~~~~~~~i~i~~~v~~~~~   94 (136)
T cd00528          67 LTGVDVDFELDEDTSGVRIRATVRTTGK   94 (136)
T ss_pred             ceEEEEEEEEcCCCCEEEEEEEEEEecC
Confidence            3468999999987 35766666544443


No 108
>PLN02982 galactinol-raffinose galactosyltransferase/ghydrolase, hydrolyzing O-glycosyl compounds
Probab=33.12  E-value=1e+02  Score=22.35  Aligned_cols=19  Identities=26%  Similarity=0.279  Sum_probs=16.4

Q ss_pred             EEEEEEeCCCcceEEEEEe
Q psy6739          15 IEVTFDIDANGILNVTAIE   33 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~   33 (56)
                      .+|.|.|+.+|+|+|...-
T Consensus       833 ~ev~F~y~~~g~l~~~lp~  851 (865)
T PLN02982        833 KEVGFEWEEEGKLSFFVPW  851 (865)
T ss_pred             eEeeeEECCCCeEEEEccC
Confidence            5899999999999998753


No 109
>cd08677 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles. C2 domain
Probab=32.98  E-value=85  Score=16.87  Aligned_cols=20  Identities=20%  Similarity=0.408  Sum_probs=15.3

Q ss_pred             eEEEEEEeCCC-cceEEEEEe
Q psy6739          14 QIEVTFDIDAN-GILNVTAIE   33 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~~   33 (56)
                      ++..++.||.. |.|+|.+..
T Consensus         2 ~l~fsL~Y~~~~~~L~V~vik   22 (118)
T cd08677           2 KLHYSLSYDKQKAELHVNILE   22 (118)
T ss_pred             eEEEEEEEcCcCCEEEEEEEE
Confidence            68888999955 889988543


No 110
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
Probab=32.68  E-value=57  Score=21.08  Aligned_cols=25  Identities=40%  Similarity=0.526  Sum_probs=18.6

Q ss_pred             CCCCCCCcCeEEEEEEeCCCcceEEE
Q psy6739           5 IPPAPRGVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus         5 ip~~p~g~~~i~V~f~~d~nGil~V~   30 (56)
                      |+..|.... ++|...+|.+|+--+.
T Consensus       338 I~~Lp~d~v-VEvp~~v~~~G~~p~~  362 (423)
T cd05297         338 IPNLPDDVV-VEVPALVDRNGIHPEK  362 (423)
T ss_pred             CCCCCCCcE-EEEeeEEcCCCceecc
Confidence            455676754 9999999999985443


No 111
>PF04398 DUF538:  Protein of unknown function, DUF538;  InterPro: IPR007493 This family consists of several plant proteins of unknown function.; PDB: 1YDU_A.
Probab=32.63  E-value=73  Score=16.93  Aligned_cols=24  Identities=25%  Similarity=0.613  Sum_probs=13.9

Q ss_pred             CCCC--CCCCcCeEEEEEEeCCC-cceEEEE
Q psy6739           4 SIPP--APRGVPQIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus         4 ~ip~--~p~g~~~i~V~f~~d~n-Gil~V~a   31 (56)
                      |+|+  .|.+.    ..|.+|.+ |-++|.-
T Consensus        10 glP~GLLP~~v----~~y~l~~~tG~f~v~l   36 (110)
T PF04398_consen   10 GLPRGLLPLGV----TEYGLNRDTGFFWVKL   36 (110)
T ss_dssp             S-TT-TTTSSS-----EEEE-TTT-SEEEE-
T ss_pred             CCCCCcCCCCc----eEEEEecCCcEEEEEe
Confidence            4554  56663    58899988 9998874


No 112
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate  disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein
Probab=32.51  E-value=61  Score=21.10  Aligned_cols=25  Identities=32%  Similarity=0.511  Sum_probs=19.4

Q ss_pred             CCCCCCCcCeEEEEEEeCCCcceEEE
Q psy6739           5 IPPAPRGVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus         5 ip~~p~g~~~i~V~f~~d~nGil~V~   30 (56)
                      ||..|.... |+|...+|.+|+--+.
T Consensus       330 I~~Lp~d~v-VEvp~~v~~~G~~P~~  354 (419)
T cd05296         330 IPGLPDDAV-VEVPCVVDADGAHPLP  354 (419)
T ss_pred             CCCCCCCCE-EEEeEEEcCCCceecc
Confidence            556777765 9999999999986544


No 113
>PLN02711 Probable galactinol--sucrose galactosyltransferase
Probab=32.46  E-value=1.1e+02  Score=22.04  Aligned_cols=29  Identities=17%  Similarity=0.120  Sum_probs=19.9

Q ss_pred             EEEEEEeCCCcceEEEEEeCcCCceEEEEE
Q psy6739          15 IEVTFDIDANGILNVTAIEKSTGKENKITI   44 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~~~~~~~~~~~i   44 (56)
                      .+|.|.||. |+++|...-...+....+++
T Consensus       747 ~~~~f~y~~-g~~~~~~~~~~~~~~~~v~~  775 (777)
T PLN02711        747 EEVEFGYED-CMVVVQVPWSGSSGLSLIEY  775 (777)
T ss_pred             EEeeeEecC-CEEEEEecCCCcCCceeEEE
Confidence            589999998 99998876544443344443


No 114
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain  (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps.
Probab=32.45  E-value=30  Score=16.41  Aligned_cols=14  Identities=21%  Similarity=0.600  Sum_probs=7.9

Q ss_pred             EEEEeCCCcceEEEE
Q psy6739          17 VTFDIDANGILNVTA   31 (56)
Q Consensus        17 V~f~~d~nGil~V~a   31 (56)
                      ++..++. |+|+|++
T Consensus        73 i~a~~~~-G~L~I~~   86 (88)
T cd06464          73 IKASLEN-GVLTITL   86 (88)
T ss_pred             cEEEEeC-CEEEEEE
Confidence            3333443 8887765


No 115
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains.  Synaptotagmin 1, a member of the class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules.  It functions as a Ca2+ sensor for fast exocytosis. It, like synaptotagmin-2, has an N-glycosylated N-terminus. Synaptotagmin 4, a member of class 4 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmin-11, has an Asp to Ser substitution in its C2A domain. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: 
Probab=32.16  E-value=83  Score=16.52  Aligned_cols=19  Identities=21%  Similarity=0.296  Sum_probs=14.5

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      ++.+++.|+.+ |.|+|.+.
T Consensus         3 ~l~~~l~y~~~~~~l~V~Vi   22 (136)
T cd08402           3 DICFSLRYVPTAGKLTVVIL   22 (136)
T ss_pred             EEEEEeEEcCCCCeEEEEEE
Confidence            58889999965 88887643


No 116
>PF12014 DUF3506:  Domain of unknown function (DUF3506);  InterPro: IPR021894  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 131 to 148 amino acids in length. This domain has a conserved KLTGD sequence motif. 
Probab=31.76  E-value=52  Score=18.39  Aligned_cols=27  Identities=44%  Similarity=0.692  Sum_probs=17.3

Q ss_pred             CccCCCCCCCCcCeEEEEEE---eCCCcceEEEE
Q psy6739           1 ELTSIPPAPRGVPQIEVTFD---IDANGILNVTA   31 (56)
Q Consensus         1 ~l~~ip~~p~g~~~i~V~f~---~d~nGil~V~a   31 (56)
                      +|+|-|..|+|+    |+|.   +...|.+.+.-
T Consensus        69 KLTGDpNVPrGe----vtF~A~DiG~~~~i~~a~   98 (134)
T PF12014_consen   69 KLTGDPNVPRGE----VTFRADDIGPGGRIRVAH   98 (134)
T ss_pred             EecCCCCCcCcc----EEEEecccCCCccccccc
Confidence            477888899986    3443   44566666543


No 117
>PF01967 MoaC:  MoaC family;  InterPro: IPR002820 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [, ].  In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner []. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF []. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 (Q39054 from SWISSPROT) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) []. This entry contains the molybdenum cofactor biosynthesis protein MoaC.; GO: 0006777 Mo-molybdopterin cofactor biosynthetic process; PDB: 2EKN_B 1EKS_A 1EKR_A 3JQM_D 2IIH_A 3JQJ_I 2IDE_K 3JQK_A 2OHD_B 2EEY_A.
Probab=31.20  E-value=71  Score=17.82  Aligned_cols=23  Identities=26%  Similarity=0.549  Sum_probs=16.2

Q ss_pred             CeEEEEEEeCCCc-ceEEEEEeCc
Q psy6739          13 PQIEVTFDIDANG-ILNVTAIEKS   35 (56)
Q Consensus        13 ~~i~V~f~~d~nG-il~V~a~~~~   35 (56)
                      ..++|.|.++.++ .+.|+++...
T Consensus        68 ~~v~v~~~~~~~~~~v~v~~~v~t   91 (136)
T PF01967_consen   68 THVDVDFELDEDESSVEVRATVKT   91 (136)
T ss_dssp             EEEEEEEEEETTETEEEEEEEEEE
T ss_pred             cEEEEEEEEcCCCcEEEEEEEEEE
Confidence            4688999999875 4666665443


No 118
>PF09912 DUF2141:  Uncharacterized protein conserved in bacteria (DUF2141);  InterPro: IPR018673  This family of conserved hypothetical proteins has no known function. 
Probab=31.07  E-value=65  Score=16.96  Aligned_cols=20  Identities=40%  Similarity=0.572  Sum_probs=11.2

Q ss_pred             CCCcCeEEEEEEeCCCcceE
Q psy6739           9 PRGVPQIEVTFDIDANGILN   28 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~   28 (56)
                      |.|...|.|--..|.||.|.
T Consensus        51 p~G~YAi~v~hD~N~NgklD   70 (112)
T PF09912_consen   51 PPGTYAIAVFHDENGNGKLD   70 (112)
T ss_pred             CCccEEEEEEEeCCCCCcCC
Confidence            44555555555555666554


No 119
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16. Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain.   Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicle
Probab=30.60  E-value=88  Score=16.34  Aligned_cols=19  Identities=37%  Similarity=0.644  Sum_probs=14.7

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+++.|+.. +.|+|.+.
T Consensus         4 ~l~~sl~Y~~~~~~L~V~Vi   23 (124)
T cd08389           4 DLDVAFEYDPSARKLTVTVI   23 (124)
T ss_pred             EEEEEEEECCCCCEEEEEEE
Confidence            58999999975 57888753


No 120
>PRK11055 galM galactose-1-epimerase; Provisional
Probab=30.53  E-value=1e+02  Score=19.37  Aligned_cols=24  Identities=17%  Similarity=0.243  Sum_probs=16.5

Q ss_pred             CcCeEEEEEEeCCCcceEEEEEeC
Q psy6739          11 GVPQIEVTFDIDANGILNVTAIEK   34 (56)
Q Consensus        11 g~~~i~V~f~~d~nGil~V~a~~~   34 (56)
                      |...++|+|+++.++.|+++.+..
T Consensus       134 g~l~~~vtY~L~~~~~l~i~~~a~  157 (342)
T PRK11055        134 GNLGATVTYRLTDDNRVSITYRAT  157 (342)
T ss_pred             eEEEEEEEEEEcCCCeEEEEEEEE
Confidence            345688999998776666665443


No 121
>PRK15076 alpha-galactosidase; Provisional
Probab=29.70  E-value=70  Score=20.87  Aligned_cols=26  Identities=35%  Similarity=0.494  Sum_probs=19.7

Q ss_pred             CCCCCCCcCeEEEEEEeCCCcceEEEE
Q psy6739           5 IPPAPRGVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         5 ip~~p~g~~~i~V~f~~d~nGil~V~a   31 (56)
                      ||..|.... |+|...+|.+|+--+..
T Consensus       335 I~~Lp~d~v-VEvp~~v~~~G~~P~~~  360 (431)
T PRK15076        335 IDNLPQGCC-VEVPCLVDRNGIQPTKV  360 (431)
T ss_pred             CCCCCCCCE-EEEeEEEcCCcceeeec
Confidence            566777765 99999999999865443


No 122
>PF15091 DUF4554:  Domain of unknown function (DUF4554)
Probab=29.45  E-value=52  Score=21.74  Aligned_cols=20  Identities=30%  Similarity=0.702  Sum_probs=17.3

Q ss_pred             CeEEEEEEeCCCcceEEEEE
Q psy6739          13 PQIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~   32 (56)
                      ++|+..|++-.||+|+-+..
T Consensus        19 pkirf~Fsvkvngvls~eiF   38 (458)
T PF15091_consen   19 PKIRFNFSVKVNGVLSKEIF   38 (458)
T ss_pred             cceEEEEEEEECcEeehhhh
Confidence            57999999999999987654


No 123
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 17 is located in the brain, kidney, and prostate and is thought to be a peripheral membrane protein. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycling step of synaptic vesicles.  C2 domains fold into an 8-standed beta-
Probab=29.45  E-value=96  Score=16.42  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=14.6

Q ss_pred             eEEEEEEeCCC-cceEEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTAI   32 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~   32 (56)
                      +|.+.+.|+.+ |.|+|.+.
T Consensus         2 ~i~~~l~y~~~~~~L~V~vi   21 (135)
T cd08410           2 ELLLSLNYLPSAGRLNVDII   21 (135)
T ss_pred             cEEEEEEECCCCCeEEEEEE
Confidence            48889999866 88888643


No 124
>KOG3194|consensus
Probab=29.08  E-value=62  Score=20.19  Aligned_cols=20  Identities=25%  Similarity=0.488  Sum_probs=16.6

Q ss_pred             EEEEEEeCCCcceEEEEEeC
Q psy6739          15 IEVTFDIDANGILNVTAIEK   34 (56)
Q Consensus        15 i~V~f~~d~nGil~V~a~~~   34 (56)
                      -+|.|.+|.+|.|.+..-..
T Consensus       236 sKv~lR~DerGvLS~qimi~  255 (279)
T KOG3194|consen  236 SKVLLRMDERGVLSVQIMIQ  255 (279)
T ss_pred             heEEEEEcCCcEEEEEEEEe
Confidence            57899999999999886543


No 125
>PF12930 DUF3836:  Family of unknown function (DUF3836);  InterPro: IPR024339 This entry represents a family of bacterial proteins of unknown function.; PDB: 3MSW_A.
Probab=28.87  E-value=65  Score=17.71  Aligned_cols=19  Identities=26%  Similarity=0.565  Sum_probs=15.2

Q ss_pred             CeEEEEEEeCCCcceEEEE
Q psy6739          13 PQIEVTFDIDANGILNVTA   31 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a   31 (56)
                      +..+=.|.||.+|.|.-.-
T Consensus        60 ~~~KY~Y~YD~~grl~eK~   78 (132)
T PF12930_consen   60 PHLKYNYKYDDNGRLTEKE   78 (132)
T ss_dssp             EEEEEEEEEETTTTEEEEE
T ss_pred             hheEEEEEECCCCCEeeee
Confidence            5677889999999987653


No 126
>PF04205 FMN_bind:  FMN-binding domain;  InterPro: IPR007329 This conserved region includes the FMN-binding site of the NqrC protein [] as well as the NosR and NirI regulatory proteins.; GO: 0010181 FMN binding, 0016020 membrane; PDB: 3LWX_A 2KZX_A 3DCZ_A 3O6U_D.
Probab=28.74  E-value=75  Score=15.15  Aligned_cols=20  Identities=40%  Similarity=0.647  Sum_probs=12.7

Q ss_pred             eEEEEEEeCCCcce-EEEEEe
Q psy6739          14 QIEVTFDIDANGIL-NVTAIE   33 (56)
Q Consensus        14 ~i~V~f~~d~nGil-~V~a~~   33 (56)
                      .|.|.+.+|.||.+ .|....
T Consensus         5 ~i~v~v~i~~dg~I~~v~~~~   25 (81)
T PF04205_consen    5 PITVTVTIDKDGKITDVKILE   25 (81)
T ss_dssp             EEEEEEEEETTTEEEEEEEEE
T ss_pred             eEEEEEEEeCCCEEEEEEEee
Confidence            47777888886664 455444


No 127
>PF14601 TFX_C:  DNA_binding protein, TFX, C-term; PDB: 1NR3_A.
Probab=28.74  E-value=79  Score=16.13  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=12.0

Q ss_pred             eEEEEEEeCCCcceEEE
Q psy6739          14 QIEVTFDIDANGILNVT   30 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~   30 (56)
                      +=++...++.||.|.|.
T Consensus        68 ~~~~~I~i~~dG~l~V~   84 (84)
T PF14601_consen   68 KEDFEIYITEDGELRVR   84 (84)
T ss_dssp             SS-EEEEESSSSSEEE-
T ss_pred             cccEEEEEcCCCcEEeC
Confidence            34577788999999874


No 128
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins. C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner.  Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode.  Munc13 is the mammalian homolog which are expressed in the brain.  There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters.  Unc13 and Munc13 contain both C1 and C2 domains.  There are two C2 related domains present, one central and one at the carboxyl end.  Munc13-1 contains a third C2-like domain.  Munc13 interacts with syntaxin, s
Probab=28.53  E-value=99  Score=16.26  Aligned_cols=18  Identities=22%  Similarity=0.111  Sum_probs=13.5

Q ss_pred             eEEEEEEeCCC-cceEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a   31 (56)
                      +|.+++.|+.. +.|+|.+
T Consensus         4 ~l~~~l~y~~~~~~L~V~V   22 (133)
T cd04009           4 VLTVKAYYRASEQSLRVEI   22 (133)
T ss_pred             EEEEEEEEcCCCCEEEEEE
Confidence            58899999974 6677654


No 129
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18.5, HSP 18.55 and HSP 19.3. sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Transcription of the genes encoding Lp HSP 18.5, 18.55 and 19.3 is regulated by a variety of stresses including heat, cold and ethanol. Early growing L. plantarum cells contain elevated levels of these mRNAs which rapidly fall of as the cells enter stationary phase. Also belonging to this group is Bifidobacterium breve (Bb) HSP20 and Oenococcus oenis (syn. Leuconostoc oenos) (Oo) HSP18.  Transcription of the gene encoding BbHSP20 is strongly induced following heat or osmotic shock, and that of the gene encoding OoHSP18 following heat, ethanol or acid shock. OoHSP18 is peripherally associated with the cytoplasmic me
Probab=27.88  E-value=43  Score=16.58  Aligned_cols=9  Identities=44%  Similarity=0.840  Sum_probs=7.3

Q ss_pred             CCcceEEEE
Q psy6739          23 ANGILNVTA   31 (56)
Q Consensus        23 ~nGil~V~a   31 (56)
                      .||+|+|++
T Consensus        83 ~dGvL~I~l   91 (93)
T cd06471          83 ENGVLKITL   91 (93)
T ss_pred             ECCEEEEEE
Confidence            789998875


No 130
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 3, a member of class 3 synaptotagmins, is located in the brain and localized to the active zone and plasma membrane.  It functions as a Ca2+ sensor for fast exocytosis. It, along with synaptotagmins 5,6, and 10, has disulfide bonds at its N-terminus. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles.  It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind
Probab=27.56  E-value=1e+02  Score=16.12  Aligned_cols=20  Identities=20%  Similarity=0.275  Sum_probs=14.9

Q ss_pred             eEEEEEEeCCC-cceEEEEEe
Q psy6739          14 QIEVTFDIDAN-GILNVTAIE   33 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a~~   33 (56)
                      +|.+.+.|+.. |.|+|.+..
T Consensus         2 ~l~~~~~y~~~~~~L~V~v~~   22 (134)
T cd08403           2 ELMFSLCYLPTAGRLTLTIIK   22 (134)
T ss_pred             eEEEEEEEcCCCCEEEEEEEE
Confidence            47888888866 788887543


No 131
>PF03633 Glyco_hydro_65C:  Glycosyl hydrolase family 65, C-terminal domain ;  InterPro: IPR005194 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This family of glycosyl hydrolases (GH65 from CAZY) contains this domain and includes vacuolar acid trehalase and maltose phosphorylases. Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown [].; PDB: 1H54_A.
Probab=27.49  E-value=71  Score=14.27  Aligned_cols=25  Identities=16%  Similarity=0.317  Sum_probs=9.3

Q ss_pred             CCCCCCcCeEEEEEEeCCCcceEEEE
Q psy6739           6 PPAPRGVPQIEVTFDIDANGILNVTA   31 (56)
Q Consensus         6 p~~p~g~~~i~V~f~~d~nGil~V~a   31 (56)
                      |..|+++..+..+|.|=.. .|.|++
T Consensus         1 P~LP~~w~~l~F~~~~rg~-~l~v~i   25 (54)
T PF03633_consen    1 PRLPKQWSSLSFRLRYRGH-WLEVEI   25 (54)
T ss_dssp             ----TT-SEEEEEEEETTE-EEEEEE
T ss_pred             CcCCCccCEeEEEEEECCE-EEEEEE
Confidence            3456676655444444322 244444


No 132
>PF11604 CusF_Ec:  Copper binding periplasmic protein CusF;  InterPro: IPR021647  CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil. CusF forms a five-stranded beta-barrel OB fold. Cu(I) binds to H36, M47 and M49 which are conserved residues in the protein []. ; PDB: 2L55_A 2VB3_X 1ZEQ_X 2QCP_X 3E6Z_X 2VB2_X.
Probab=27.48  E-value=84  Score=15.10  Aligned_cols=15  Identities=20%  Similarity=0.468  Sum_probs=6.5

Q ss_pred             EEEEEEeCCCcceEE
Q psy6739          15 IEVTFDIDANGILNV   29 (56)
Q Consensus        15 i~V~f~~d~nGil~V   29 (56)
                      |..+|..+.+|...|
T Consensus        49 V~F~~~~~~~~~~~I   63 (70)
T PF11604_consen   49 VRFTFERTDDGSYVI   63 (70)
T ss_dssp             EEEEEEEETTCEEEE
T ss_pred             EEEEEEECCCCcEEE
Confidence            444444444443333


No 133
>TIGR00581 moaC molybdenum cofactor biosynthesis protein MoaC. MoaC catalyzes an early step in molybdenum cofactor biosynthesis in E. coli. The Arabidopsis homolog Cnx3 complements MoaC deficiency in E. coli (MUID:95197640). Eukarotic members of this family branch within the bacterial branch, with the archaeal members as an apparent outgroup. This protein is absent in a number of the pathogens with smaller genomes, including Mycoplasmas, Chlamydias, and spirochetes, but is found in most other complete genomes to date. The homolog form Synechocystis sp. is fused to a MobA-homologous region and is an outlier to all other bacterial forms by both neighbor-joining and UPGMA analyses. Members of this family are well-conserved. The seed for this model excludes both archaeal sequences and the most divergent bacterial sequences, but still finds all candidate MoaC sequences easily between trusted and noise cutoffs. We suggest that sequences branching outside the set that contains all seed members
Probab=27.03  E-value=1.3e+02  Score=17.07  Aligned_cols=21  Identities=14%  Similarity=0.401  Sum_probs=14.4

Q ss_pred             cCeEEEEEEeCCCcceEEEEEe
Q psy6739          12 VPQIEVTFDIDANGILNVTAIE   33 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~~   33 (56)
                      ...++|.|.++.++ +.|.++.
T Consensus        78 l~~v~v~~~~~~~~-i~v~~~v   98 (147)
T TIGR00581        78 LSKVEVELTVREDR-VEIRATV   98 (147)
T ss_pred             ceEEEEEEEEcCCE-EEEEEEE
Confidence            34699999999875 4454443


No 134
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=26.97  E-value=1.5e+02  Score=17.66  Aligned_cols=26  Identities=23%  Similarity=0.419  Sum_probs=19.2

Q ss_pred             eEEEEEEeCCCcceEEE-EEeCcCCce
Q psy6739          14 QIEVTFDIDANGILNVT-AIEKSTGKE   39 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~-a~~~~~~~~   39 (56)
                      .++-+|-+|.+|++.-. +.+...|+.
T Consensus       123 a~R~~FIIDp~g~ir~~~v~~~~iGRn  149 (194)
T COG0450         123 ALRGTFIIDPDGVIRHILVNPLTIGRN  149 (194)
T ss_pred             ceeEEEEECCCCeEEEEEEecCCCCcC
Confidence            59999999999998644 444445664


No 135
>PF11359 gpUL132:  Glycoprotein UL132;  InterPro: IPR021023  Glycoprotein UL132 is a low-abundance structural component of Human herpesvirus 5 []. The function of this protein is not fully understood. 
Probab=26.84  E-value=87  Score=19.05  Aligned_cols=29  Identities=21%  Similarity=0.418  Sum_probs=24.6

Q ss_pred             EEeCCCcceEEEEEeCcCCceEEEEEEcC
Q psy6739          19 FDIDANGILNVTAIEKSTGKENKITITND   47 (56)
Q Consensus        19 f~~d~nGil~V~a~~~~~~~~~~~~i~~~   47 (56)
                      +-.+.+|-|..+......|+...+.|++.
T Consensus       157 iyf~k~gnldtsfvnpnyg~~spm~ies~  185 (235)
T PF11359_consen  157 IYFDKDGNLDTSFVNPNYGRGSPMTIESH  185 (235)
T ss_pred             EEEccCCCccceeeCCCCCCCCCceeecc
Confidence            44678899988999999999999999864


No 136
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=26.76  E-value=61  Score=18.44  Aligned_cols=16  Identities=31%  Similarity=0.399  Sum_probs=13.5

Q ss_pred             eEEEEEEeCCCcceEE
Q psy6739          14 QIEVTFDIDANGILNV   29 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V   29 (56)
                      ..+.||-||.+|.+.-
T Consensus       119 ~~R~TfvId~dG~I~~  134 (157)
T COG1225         119 IERSTFVIDPDGKIRY  134 (157)
T ss_pred             ccceEEEECCCCeEEE
Confidence            4789999999999753


No 137
>PF11739 DctA-YdbH:  Dicarboxylate transport;  InterPro: IPR021730  In certain bacterial families this protein is expressed from the ydbH gene, and there is a suggestion that this is a form of DctA or dicarboxylate transport protein. Dicarboxylate transport proteins are found in aerobic bacteria which grow on succinate or other C4-dicarboxylates []. 
Probab=26.59  E-value=1.4e+02  Score=17.27  Aligned_cols=22  Identities=23%  Similarity=0.357  Sum_probs=17.8

Q ss_pred             eEEEEEEeCCCcceEEEEEeCc
Q psy6739          14 QIEVTFDIDANGILNVTAIEKS   35 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a~~~~   35 (56)
                      ...+++.|+.+|.|.+.++-..
T Consensus       147 ~l~~~i~~~~~G~l~l~~~l~G  168 (207)
T PF11739_consen  147 RLSSSIDYDPDGELTLGLRLKG  168 (207)
T ss_pred             EEEEEeecCCCccEEEEEEEee
Confidence            4788999999999888876544


No 138
>TIGR01953 NusA transcription termination factor NusA. This model describes NusA, or N utilization substance protein A, a bacterial transcription termination factor. It binds to RNA polymerase alpha subunit and promotes termination at certain RNA hairpin structures. It is named for the interaction in E. coli of phage lambda antitermination protein N with the N-utilization substance, consisting of NusA, NusB, NusE (ribosomal protein S10), and nusG. This model represents a region of NusA shared in all bacterial forms, and including an S1 (pfam00575) and a KH (pfam00013) RNA binding domains. Proteobacterial forms have an additional C-terminal region, not included in this model, with two repeats of 50-residue domain rich in acidic amino acids.
Probab=26.38  E-value=1.8e+02  Score=18.57  Aligned_cols=27  Identities=26%  Similarity=0.580  Sum_probs=21.5

Q ss_pred             CCcceEEEEEeCcCCceEEEEEEcCCC
Q psy6739          23 ANGILNVTAIEKSTGKENKITITNDRG   49 (56)
Q Consensus        23 ~nGil~V~a~~~~~~~~~~~~i~~~~~   49 (56)
                      .||++++.+..+..|....+.+.++..
T Consensus       214 ~dG~VeI~~iaR~pG~RtKvAV~s~~~  240 (341)
T TIGR01953       214 ADGIIEIKKIAREPGYRTKIAVESNDE  240 (341)
T ss_pred             cCCeEEEEEEeeCCcceeEEEEEcCCC
Confidence            578888998888999998888766433


No 139
>PF08212 Lipocalin_2:  Lipocalin-like domain;  InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]. This is an eight stranded antiparallel beta-barrel with a repeated + 1 topology enclosing a internal ligand binding site [, ]. The name 'lipocalin' has been proposed [] for this protein family, but cytosolic fatty-acid binding proteins are also included. The sequences of most members of the family, the core or kernal lipocalins, are characterised by three short conserved stretches of residues, while others, the outlier lipocalin group, share only one or two of these [, ]. Proteins known to belong to this family include alpha-1-microglobulin (protein HC); alpha-1-acid glycoprotein (orosomucoid) []; aphrodisin; apolipoprotein D; beta-lactoglobulin; complement component C8 gamma chain []; crustacyanin []; epididymal-retinoic acid binding protein (E-RABP) []; insectacyanin; odorant-binding protein (OBP); human pregnancy-associated endometrial alpha-2 globulin; probasin (PB), a rat prostatic protein; prostaglandin D synthase (5.3.99.2 from EC) []; purpurin; Von Ebner's gland protein (VEGP) []; and lizard epididymal secretory protein IV (LESP IV) [].; GO: 0005488 binding; PDB: 3EBW_B 1QWD_A 2ACO_A 3MBT_A.
Probab=26.24  E-value=1.2e+02  Score=16.33  Aligned_cols=34  Identities=21%  Similarity=0.416  Sum_probs=21.6

Q ss_pred             CCcCeEEEEEEeCCCcceEEEEEeC-cCCceEEEE
Q psy6739          10 RGVPQIEVTFDIDANGILNVTAIEK-STGKENKIT   43 (56)
Q Consensus        10 ~g~~~i~V~f~~d~nGil~V~a~~~-~~~~~~~~~   43 (56)
                      ++...+...|+...+|.+.|.-... .+|+...+.
T Consensus        22 ~~~~~~~a~Yt~~~dg~i~V~n~~~~~~g~~~~~~   56 (143)
T PF08212_consen   22 RGCVCVTAEYTLRDDGTISVRNSCRRPDGKIKTIR   56 (143)
T ss_dssp             TT-ECEEEEEEE-TTS-EEEEEEEEETTTCCCEEE
T ss_pred             ceeeeeeeeEEEcCCCEEEEEEEEEcCCCCEEEEE
Confidence            4555688999999999988886655 556544443


No 140
>PRK15172 putative aldose-1-epimerase; Provisional
Probab=26.12  E-value=1.6e+02  Score=18.02  Aligned_cols=20  Identities=25%  Similarity=0.275  Sum_probs=13.0

Q ss_pred             CeEEEEEEeCCCcceEEEEE
Q psy6739          13 PQIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a~   32 (56)
                      ..++++|+++.+..|+++.+
T Consensus       126 ~~~~v~y~L~~~~~L~i~~~  145 (300)
T PRK15172        126 LASQVIYSLDAATGLSVEIA  145 (300)
T ss_pred             EEEEEEEEEccCCeEEEEEE
Confidence            46888899986545554433


No 141
>PF07661 MORN_2:  MORN repeat variant;  InterPro: IPR011652 This entry represents an apparent variant of the IPR003409 from INTERPRO repeat.
Probab=25.94  E-value=47  Score=11.63  Aligned_cols=14  Identities=21%  Similarity=-0.052  Sum_probs=9.7

Q ss_pred             EEEeCCCcceEEEE
Q psy6739          18 TFDIDANGILNVTA   31 (56)
Q Consensus        18 ~f~~d~nGil~V~a   31 (56)
                      ...++.||.|....
T Consensus         5 ~~~yy~nG~l~~~~   18 (22)
T PF07661_consen    5 WKFYYENGKLKSEG   18 (22)
T ss_pred             EEEEeCCCCEEEEE
Confidence            34678888887654


No 142
>cd01759 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride lipase.  Lipases hydrolyze phospholipids and triglycerides to generate fatty acids for energy production or for storage and to release inositol phosphates that act as second messengers. The central role of triglyceride lipases is in energy production. The proposed function of PLAT/LH2 domains is to mediate interaction with lipids or membrane bound proteins.
Probab=25.42  E-value=1.2e+02  Score=16.20  Aligned_cols=32  Identities=19%  Similarity=0.267  Sum_probs=20.5

Q ss_pred             CeEEEEEEeC--CCcceEEEEEeCcCCceEEEEEE
Q psy6739          13 PQIEVTFDID--ANGILNVTAIEKSTGKENKITIT   45 (56)
Q Consensus        13 ~~i~V~f~~d--~nGil~V~a~~~~~~~~~~~~i~   45 (56)
                      .+|.|+|.-.  .+|.++|+.. ...|.+..+.+.
T Consensus         3 Yqv~V~~s~~~~~~g~~~vsL~-G~~g~s~~~~i~   36 (113)
T cd01759           3 YKVSVTLSGKKKVTGTILVSLY-GNKGNTRQYEIF   36 (113)
T ss_pred             EEEEEEEecccccCceEEEEEE-cCCCCccceEEE
Confidence            3567777664  7888888766 344555555554


No 143
>TIGR02636 galM_Leloir galactose mutarotase. Members of this protein family act as galactose mutarotase (D-galactose 1-epimerase) and participate in the Leloir pathway for galactose/glucose interconversion. All members of the seed alignment for this model are found in gene clusters with other enzymes of the Leloir pathway. This enzyme family belongs to the aldose 1-epimerase family, described by pfam model pfam01263. However, the enzyme described as aldose 1-epimerase itself (EC 5.1.3.3) is called broadly specific for D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose. The restricted genome context for genes in this family suggests members should act primarily on D-galactose.
Probab=24.97  E-value=1.8e+02  Score=18.12  Aligned_cols=23  Identities=17%  Similarity=0.312  Sum_probs=15.1

Q ss_pred             CcCeEEEEEEeCCCcceEEEEEe
Q psy6739          11 GVPQIEVTFDIDANGILNVTAIE   33 (56)
Q Consensus        11 g~~~i~V~f~~d~nGil~V~a~~   33 (56)
                      |...++|+|+++.++-|+++.+.
T Consensus       129 g~l~~~vtY~L~~~~~L~i~~~a  151 (335)
T TIGR02636       129 GNLTVSVTYTLTDDNELTIEYEA  151 (335)
T ss_pred             eEEEEEEEEEECCCCEEEEEEEE
Confidence            34568899999666656655443


No 144
>PF02191 OLF:  Olfactomedin-like domain;  InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []. Members of this extracellular domain-family have since been shown to be present in several metazoan proteins, such as latrophilins, myocilins, optimedins and noelins, the latter being involved in the generation of neural crest cells. Myocilin is of considerable interest, as mutations in its olfactomedin-domain can lead to glaucoma []. The olfactomedin-domains in myocilin and optimedin are essential for the interaction between these two proteins [].; GO: 0005515 protein binding
Probab=24.94  E-value=1.7e+02  Score=17.73  Aligned_cols=26  Identities=27%  Similarity=0.533  Sum_probs=21.0

Q ss_pred             eEEEEEEeCCCcceEEEEEeCcCCce
Q psy6739          14 QIEVTFDIDANGILNVTAIEKSTGKE   39 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a~~~~~~~~   39 (56)
                      .-.+.|.+|++|+=-+-++....|.-
T Consensus       123 ~t~iD~AvDE~GLWvIYat~~~~g~i  148 (250)
T PF02191_consen  123 YTDIDFAVDENGLWVIYATEDNNGNI  148 (250)
T ss_pred             CceEEEEEcCCCEEEEEecCCCCCcE
Confidence            36799999999998888887776653


No 145
>PHA02762 hypothetical protein; Provisional
Probab=24.89  E-value=77  Score=15.08  Aligned_cols=15  Identities=33%  Similarity=0.406  Sum_probs=12.1

Q ss_pred             eEEEEEEeCCCcceE
Q psy6739          14 QIEVTFDIDANGILN   28 (56)
Q Consensus        14 ~i~V~f~~d~nGil~   28 (56)
                      .--||.-+|.||.+.
T Consensus        27 ~afvtigide~g~ia   41 (62)
T PHA02762         27 EAFVTIGIDENDKIS   41 (62)
T ss_pred             cEEEEEeECCCCcEE
Confidence            356899999999864


No 146
>PRK00095 mutL DNA mismatch repair protein; Reviewed
Probab=24.65  E-value=1.4e+02  Score=20.42  Aligned_cols=29  Identities=14%  Similarity=0.407  Sum_probs=21.4

Q ss_pred             CCcCeEEEEEEeCCCcceEEEEEeCcCCceE
Q psy6739          10 RGVPQIEVTFDIDANGILNVTAIEKSTGKEN   40 (56)
Q Consensus        10 ~g~~~i~V~f~~d~nGil~V~a~~~~~~~~~   40 (56)
                      +|...|+|.+.  .+|...|++.|.+.|...
T Consensus        37 Agat~I~v~i~--~~g~~~i~V~DnG~Gi~~   65 (617)
T PRK00095         37 AGATRIDIEIE--EGGLKLIRVRDNGCGISK   65 (617)
T ss_pred             CCCCEEEEEEE--eCCeEEEEEEEcCCCCCH
Confidence            44456777774  568888888998888864


No 147
>COG2847 Copper(I)-binding protein [Inorganic ion transport and    metabolism]
Probab=24.41  E-value=1.5e+02  Score=16.88  Aligned_cols=28  Identities=29%  Similarity=0.438  Sum_probs=22.0

Q ss_pred             CCCCCcCeEEEEEEeCCCcceEEEEEeCc
Q psy6739           7 PAPRGVPQIEVTFDIDANGILNVTAIEKS   35 (56)
Q Consensus         7 ~~p~g~~~i~V~f~~d~nGil~V~a~~~~   35 (56)
                      |...|. +|.+++..+..|.+.|.+....
T Consensus       115 pl~eGd-~v~vtL~f~~~~~~~v~~~v~~  142 (151)
T COG2847         115 PLKEGD-KVPVTLKFEKAGKVTVEAPVKK  142 (151)
T ss_pred             CccCCC-EEEEEEEEecCCeEEEEEEEec
Confidence            455665 5999999999999999876643


No 148
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW. This model describes the anti-sigma B factor also known as serine-protein kinase RsbW. Sigma B controls the general stress regulon in B subtilis and is activated by cell stresses such as stationary phase and heat shock. RsbW binds to sigma B and prevents formation of the transcription complex at the promoter. RsbV (anti-anti-sigma factor) binds to RsbW to inhibit association with sigma B, however RsbW can phosphorylate RsbV, causing disassociation of the RsbV/RsbW complex. Low ATP level or environmental stress causes the dephosphorylation of RsbV.
Probab=24.39  E-value=1.4e+02  Score=16.47  Aligned_cols=25  Identities=16%  Similarity=0.347  Sum_probs=19.0

Q ss_pred             eEEEEEEeCCCcceEEEEEeCcCCce
Q psy6739          14 QIEVTFDIDANGILNVTAIEKSTGKE   39 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a~~~~~~~~   39 (56)
                      .|.|+|..+. +.|.+.+.|.+.|-.
T Consensus        66 ~I~I~~~~~~-~~l~i~V~D~G~gfd   90 (159)
T TIGR01924        66 EIGISFHIYE-DRLEIIVSDQGDSFD   90 (159)
T ss_pred             eEEEEEEEeC-CEEEEEEEEcccccC
Confidence            5888888765 558899998877653


No 149
>PLN00194 aldose 1-epimerase; Provisional
Probab=24.27  E-value=1.3e+02  Score=18.81  Aligned_cols=21  Identities=14%  Similarity=0.197  Sum_probs=13.6

Q ss_pred             cCeEEEEEEeCCCcceEEEEE
Q psy6739          12 VPQIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~   32 (56)
                      ...++|+|+++.++.|+|+.+
T Consensus       137 ~~~~~v~Y~L~~~~~L~i~~~  157 (337)
T PLN00194        137 DLSVTVTYTLLSSNTLRLDME  157 (337)
T ss_pred             EEEEEEEEEECCCCeEEEEEE
Confidence            356788888876555555543


No 150
>cd09024 Aldose_epim_lacX Aldose 1-epimerase, similar to Lactococcus lactis lacX. Proteins similar to Lactococcus lactis lacX are uncharacterized members of aldose-1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=23.93  E-value=1.7e+02  Score=17.65  Aligned_cols=20  Identities=15%  Similarity=0.380  Sum_probs=11.7

Q ss_pred             CeEEEEEEeCCCcc-eEEEEE
Q psy6739          13 PQIEVTFDIDANGI-LNVTAI   32 (56)
Q Consensus        13 ~~i~V~f~~d~nGi-l~V~a~   32 (56)
                      .+++++|+++.+++ ++.+++
T Consensus       107 ~~~~~~y~L~~~~L~i~~~v~  127 (288)
T cd09024         107 FELRVTYTLEGNTLKVTYEVK  127 (288)
T ss_pred             EEEEEEEEEeCCEEEEEEEEE
Confidence            35778888875543 444444


No 151
>PF02772 S-AdoMet_synt_M:  S-adenosylmethionine synthetase, central domain;  InterPro: IPR022629  The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold. This entry represents the central domain and is found in association with PF00438 from PFAM and PF02773 from PFAM. S-adenosylmethionine synthetase (MAT, 2.5.1.6 from EC) is the enzyme that catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP []. AdoMet is an important methyl donor for transmethylation and is also the propylamino donor in polyamine biosynthesis. In bacteria there is a single isoform of AdoMet synthetase (gene metK), there are two in budding yeast (genes SAM1 and SAM2) and in mammals while in plants there is generally a multigene family. The sequence of AdoMet synthetase is highly conserved throughout isozymes and species. The active sites of both the Escherichia coli and rat liver MAT reside between two subunits, with contributions from side chains of residues from both subunits, resulting in a dimer as the minimal catalytic entity. The side chains that contribute to the ligand binding sites are conserved between the two proteins. In the structures of complexes with the E. coli enzyme, the phosphate groups have the same positions in the (PPi plus Pi) complex and the (ADP plus Pi) complex, and are located at the bottom of a deep cavity with the adenosyl group nearer the entrance []; GO: 0004478 methionine adenosyltransferase activity; PDB: 3S82_B 2OBV_A 3RV2_A 1FUG_A 1RG9_D 1XRA_A 1P7L_C 1XRB_A 1MXA_A 1MXB_A ....
Probab=23.81  E-value=1e+02  Score=16.77  Aligned_cols=18  Identities=28%  Similarity=0.523  Sum_probs=12.5

Q ss_pred             eEEEEEEeCCCcc-eEEEE
Q psy6739          14 QIEVTFDIDANGI-LNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGi-l~V~a   31 (56)
                      +.+|++.|+.||. ..|..
T Consensus        54 KsQVtveY~~~~~P~ri~t   72 (120)
T PF02772_consen   54 KSQVTVEYDENGKPVRIDT   72 (120)
T ss_dssp             EEEEEEEEEETTEEEEEEE
T ss_pred             ceeEEEeeccCCceeeeeE
Confidence            6889999987765 44443


No 152
>PF11353 DUF3153:  Protein of unknown function (DUF3153);  InterPro: IPR021499  This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=23.47  E-value=1.6e+02  Score=17.06  Aligned_cols=25  Identities=4%  Similarity=0.118  Sum_probs=19.3

Q ss_pred             CCCcCeEEEEEEeCCCcceEEEEEe
Q psy6739           9 PRGVPQIEVTFDIDANGILNVTAIE   33 (56)
Q Consensus         9 p~g~~~i~V~f~~d~nGil~V~a~~   33 (56)
                      =.|+.++++...++.++.+.....-
T Consensus        11 LsGCVr~~~~i~~~~~d~i~l~~~l   35 (209)
T PF11353_consen   11 LSGCVRVDAGITFSGDDRIKLAWRL   35 (209)
T ss_pred             hcceEEEEEEEEECCCCeEEEEEEe
Confidence            3588889999999999976665543


No 153
>PLN02355 probable galactinol--sucrose galactosyltransferase 1
Probab=23.44  E-value=1.9e+02  Score=20.78  Aligned_cols=19  Identities=21%  Similarity=0.319  Sum_probs=15.6

Q ss_pred             EEEEEEeCCC-cceEEEEEe
Q psy6739          15 IEVTFDIDAN-GILNVTAIE   33 (56)
Q Consensus        15 i~V~f~~d~n-Gil~V~a~~   33 (56)
                      .+|.|.||.+ |+|+|..--
T Consensus       725 ~~~~f~y~~~~g~~~~~~~~  744 (758)
T PLN02355        725 KEVEFRYEEGSGLVTFDLGV  744 (758)
T ss_pred             eEeeeEEcCCCCeEEEEcCC
Confidence            5899999986 999988743


No 154
>PRK12328 nusA transcription elongation factor NusA; Provisional
Probab=23.34  E-value=2.2e+02  Score=18.59  Aligned_cols=27  Identities=11%  Similarity=0.283  Sum_probs=22.3

Q ss_pred             CCcceEEEEEeCcCCceEEEEEEcCCC
Q psy6739          23 ANGILNVTAIEKSTGKENKITITNDRG   49 (56)
Q Consensus        23 ~nGil~V~a~~~~~~~~~~~~i~~~~~   49 (56)
                      .+|++++.+..+..|....+.+.+...
T Consensus       222 ~dG~VeIk~IARepG~RtKVAV~S~d~  248 (374)
T PRK12328        222 KDGEVIIIHSARIPGERAKVALFSNNP  248 (374)
T ss_pred             cCCeEEEEEEeccCcceeEEEEEcCCC
Confidence            589999999999999998888866433


No 155
>PRK09202 nusA transcription elongation factor NusA; Validated
Probab=23.23  E-value=2.4e+02  Score=18.92  Aligned_cols=29  Identities=28%  Similarity=0.657  Sum_probs=22.8

Q ss_pred             CCcceEEEEEeCcCCceEEEEEEcCCCCC
Q psy6739          23 ANGILNVTAIEKSTGKENKITITNDRGRL   51 (56)
Q Consensus        23 ~nGil~V~a~~~~~~~~~~~~i~~~~~~l   51 (56)
                      .+|++++.+..+..|.+..+.+.+...++
T Consensus       216 ~~G~ieIk~iaR~pG~RaKvAV~s~d~~i  244 (470)
T PRK09202        216 ADGLIEIKAIARDPGSRAKIAVKSNDPRI  244 (470)
T ss_pred             ccCeEEEEEEeecCcceeEEEEEcCCCCC
Confidence            47999999999999999888887654333


No 156
>PF01863 DUF45:  Protein of unknown function DUF45;  InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=23.06  E-value=1.3e+02  Score=16.87  Aligned_cols=17  Identities=24%  Similarity=0.464  Sum_probs=12.7

Q ss_pred             EEEEeCCCcceEEEEEe
Q psy6739          17 VTFDIDANGILNVTAIE   33 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~   33 (56)
                      +.+.++.+|-+.|+|-.
T Consensus         3 i~l~v~~dg~i~V~aP~   19 (205)
T PF01863_consen    3 IRLRVDPDGEIVVSAPP   19 (205)
T ss_pred             EEEEEcCCCEEEEEECC
Confidence            56778888888888743


No 157
>TIGR03000 plancto_dom_1 Planctomycetes uncharacterized domain TIGR03000. Domains described by this model are found, so far, only in the Planctomycetes (Pirellula sp. strain 1 and Gemmata obscuriglobus), in up to six proteins per genome, and may be duplicated within a protein. The function is unknown.
Probab=22.99  E-value=1.2e+02  Score=15.27  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=13.8

Q ss_pred             CCCCCCc-CeEEEEEEeCCCcc
Q psy6739           6 PPAPRGV-PQIEVTFDIDANGI   26 (56)
Q Consensus         6 p~~p~g~-~~i~V~f~~d~nGi   26 (56)
                      |+.+.|. ...+|+-+++.||.
T Consensus        34 ~~L~~G~~y~Y~v~a~~~~dG~   55 (75)
T TIGR03000        34 PPLEAGKEYEYTVTAEYDRDGR   55 (75)
T ss_pred             CCCCCCCEEEEEEEEEEecCCc
Confidence            4445553 44777888888885


No 158
>PF11954 DUF3471:  Domain of unknown function (DUF3471);  InterPro: IPR021860 This entry represents the C-terminal domain of a family of peptidases which belong to MEROPS peptidase family S12, clan SE. The structure of the Pyrococcus abyssi Pab87 peptidase has been determined at 2.2 A resolution []. Pab87 is a self-compartmentalizing proteases that orchestrates protein turnover through an original architecture characterised by a central catalytic chamber. 
Probab=22.93  E-value=96  Score=15.46  Aligned_cols=14  Identities=36%  Similarity=0.712  Sum_probs=10.5

Q ss_pred             EEEEEEeCCCcceE
Q psy6739          15 IEVTFDIDANGILN   28 (56)
Q Consensus        15 i~V~f~~d~nGil~   28 (56)
                      ..++|..|.+|.++
T Consensus        66 ~~i~F~~d~~G~v~   79 (100)
T PF11954_consen   66 AQITFERDADGKVT   79 (100)
T ss_pred             CEEEEEECCCCCEE
Confidence            45889999888643


No 159
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=22.85  E-value=1.3e+02  Score=19.72  Aligned_cols=22  Identities=14%  Similarity=0.258  Sum_probs=15.9

Q ss_pred             CCCCCCcCeEEEEEEeCCCcceE
Q psy6739           6 PPAPRGVPQIEVTFDIDANGILN   28 (56)
Q Consensus         6 p~~p~g~~~i~V~f~~d~nGil~   28 (56)
                      ++...|- ...|.|.++.||.|.
T Consensus       320 ~~~~~gk-tc~VrI~LapDG~V~  341 (387)
T PRK09510        320 ASSYAGK-TCTLRIKLAPDGTLL  341 (387)
T ss_pred             CccccCc-eEEEEEEEcCCCcEE
Confidence            3444453 588999999999864


No 160
>PRK12343 putative molybdenum cofactor biosynthesis protein MoaC; Reviewed
Probab=22.83  E-value=1.6e+02  Score=16.77  Aligned_cols=25  Identities=20%  Similarity=0.501  Sum_probs=16.1

Q ss_pred             cCeEEEEEEeCCCcceEEEEEeCcCC
Q psy6739          12 VPQIEVTFDIDANGILNVTAIEKSTG   37 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~~~~~~   37 (56)
                      ...++|.|.++.++ +.|.++....+
T Consensus        75 l~~v~v~~~~~~~~-v~v~~~v~~~~   99 (151)
T PRK12343         75 ITGVDVDFEVGEDG-IEARVTVKTTY   99 (151)
T ss_pred             ceEEEEEEEEcCCE-EEEEEEEEEcC
Confidence            34688999998774 55555544433


No 161
>PRK14499 molybdenum cofactor biosynthesis protein MoaC/MOSC-domain-containing protein; Provisional
Probab=22.76  E-value=2.1e+02  Score=18.06  Aligned_cols=26  Identities=15%  Similarity=0.482  Sum_probs=17.9

Q ss_pred             cCeEEEEEEeCCC-cceEEEEEeCcCC
Q psy6739          12 VPQIEVTFDIDAN-GILNVTAIEKSTG   37 (56)
Q Consensus        12 ~~~i~V~f~~d~n-Gil~V~a~~~~~~   37 (56)
                      ...++|.|.++.+ +.+++.++....+
T Consensus        80 i~~v~v~~~~~~~~~~v~~~~~v~~~~  106 (308)
T PRK14499         80 LSGVDVSYEINREEGYIEAVSEVKTEA  106 (308)
T ss_pred             cceeEEEEEECCCCCeEEEEEEEEEcC
Confidence            3468999999987 4577766554443


No 162
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. It is thought to be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues and is Ca2+ independent. Human synaptotagmin 15 has 2 alternatively spliced forms that encode proteins with different C-termini.  The larger, SYT15a, contains a N-terminal TM region, a putative fatty-acylation site, and 2 tandem C terminal C2 domains.  The smaller, SYT15b, lacks the C-terminal portion of the second C2 domain.  Unlike most other synaptotagmins it is nearly absent in the brain and rather is found in the heart, lungs, skeletal muscle, and testis.  Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 id
Probab=22.67  E-value=1.4e+02  Score=15.91  Aligned_cols=18  Identities=17%  Similarity=0.399  Sum_probs=14.2

Q ss_pred             eEEEEEEeCCC-cceEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a   31 (56)
                      +|.+.+.|+.. +.|+|.+
T Consensus         3 ~i~~sl~y~~~~~~L~V~V   21 (137)
T cd08409           3 DIQISLTYNPTLNRLTVVV   21 (137)
T ss_pred             EEEEEEEECCCCCeEEEEE
Confidence            58899999964 7788774


No 163
>TIGR03027 pepcterm_export putative polysaccharide export protein, PEP-CTERM sytem-associated. This protein family belongs to the larger set of polysaccharide biosynthesis/export proteins described by Pfam model pfam02563. Members of this family are variable in either containing of lacking a 78-residue insert, but appear to fall within a single clade, nevertheless, where the regions in which the gene is found encode components of the PEP-CTERM/EpsH proposed exosortase protein sorting system.
Probab=22.54  E-value=72  Score=17.71  Aligned_cols=18  Identities=11%  Similarity=0.429  Sum_probs=12.7

Q ss_pred             CeEEEEEEeCCCcceEEE
Q psy6739          13 PQIEVTFDIDANGILNVT   30 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~   30 (56)
                      +.....+.++.||.+++-
T Consensus        17 ~~~~~~~~V~~dG~I~lP   34 (165)
T TIGR03027        17 PELSGSVPVRPDGKITTP   34 (165)
T ss_pred             cccccceEECCCCeEeec
Confidence            345567888888888754


No 164
>PRK13598 hisB imidazoleglycerol-phosphate dehydratase; Provisional
Probab=22.37  E-value=1.5e+02  Score=17.55  Aligned_cols=20  Identities=40%  Similarity=0.591  Sum_probs=15.6

Q ss_pred             CcCeEEEEEEeCCCcceEEE
Q psy6739          11 GVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus        11 g~~~i~V~f~~d~nGil~V~   30 (56)
                      .+..|+|.+.+|..|..+|+
T Consensus        12 ~ET~I~v~l~Ldg~g~~~i~   31 (193)
T PRK13598         12 KETKIEVFLDIDRKGEIKVS   31 (193)
T ss_pred             cceEEEEEEEeCCCCceEEe
Confidence            34568999999988887765


No 165
>PF13211 DUF4019:  Protein of unknown function (DUF4019)
Probab=22.32  E-value=1.1e+02  Score=15.95  Aligned_cols=19  Identities=42%  Similarity=0.644  Sum_probs=12.0

Q ss_pred             cCCCCCCCCcCeEEEEEEeC
Q psy6739           3 TSIPPAPRGVPQIEVTFDID   22 (56)
Q Consensus         3 ~~ip~~p~g~~~i~V~f~~d   22 (56)
                      ..+|..|.|.. +-|.|.-.
T Consensus        61 ~~~pg~P~G~Y-v~v~f~T~   79 (105)
T PF13211_consen   61 TSLPGAPDGEY-VVVQFQTT   79 (105)
T ss_pred             cCCCCCCCceE-EEEEEEeE
Confidence            35677888875 55555543


No 166
>PF09260 DUF1966:  Domain of unknown function (DUF1966);  InterPro: IPR015340  Alpha-amylase is classified as family 13 of the glycosyl hydrolases and is present in archaea, bacteria, plants and animals. Alpha-amylase is an essential enzyme in alpha-glucan metabolism, acting to catalyse the hydrolysis of alpha-1,4-glucosidic bonds of glycogen, starch and related polysaccharides. Although all alpha-amylases possess the same catalytic function, they can vary with respect to sequence. In general, they are composed of three domains: a TIM barrel containing the active site residues and chloride ion-binding site (domain A), a long loop region inserted between the third beta strand and the alpha-helix of domain A that contains calcium-binding site(s) (domain B), and a C-terminal beta-sheet domain that appears to show some variability in sequence and length between amylases (domain C) []. Amylases have at least one conserved calcium-binding site, as calcium is essential for the stability of the enzyme. The chloride-binding functions to activate the enzyme, which acts by a two-step mechanism involving a catalytic nucleophile base (usually an Asp) and a catalytic proton donor (usually a Glu) that are responsible for the formation of the beta-linked glycosyl-enzyme intermediate.  This domain is found in various fungal alpha-amylase proteins. Its exact function has not, as yet, been defined []. ; GO: 0004556 alpha-amylase activity, 0005509 calcium ion binding, 0016052 carbohydrate catabolic process; PDB: 2AAA_A 2GUY_A 2TAA_B 6TAA_A 2GVY_B 7TAA_A 3KWX_A.
Probab=22.23  E-value=98  Score=15.83  Aligned_cols=15  Identities=33%  Similarity=0.685  Sum_probs=9.3

Q ss_pred             EEEeCCCcceEEEEE
Q psy6739          18 TFDIDANGILNVTAI   32 (56)
Q Consensus        18 ~f~~d~nGil~V~a~   32 (56)
                      ++..|.+|.|+|...
T Consensus        58 ~~tv~~~G~l~v~m~   72 (91)
T PF09260_consen   58 SYTVDSNGTLTVPMS   72 (91)
T ss_dssp             EEE--TTS-EEEEES
T ss_pred             EEEECCCCEEEEEEc
Confidence            677888999888764


No 167
>PF04200 Lipoprotein_17:  Lipoprotein associated domain;  InterPro: IPR007326 This presumed domain is about 100 amino acids in length. It is found in lipoproteins of unknown function and is most abundant in Mycoplasma pulmonis. The domain is found in up to five copies in some proteins.; PDB: 3K63_A 2KRT_A 3JVC_A.
Probab=21.42  E-value=1e+02  Score=14.64  Aligned_cols=27  Identities=22%  Similarity=0.284  Sum_probs=15.0

Q ss_pred             eEEEEEEe---CCCcceEEEEEeCcCCceE
Q psy6739          14 QIEVTFDI---DANGILNVTAIEKSTGKEN   40 (56)
Q Consensus        14 ~i~V~f~~---d~nGil~V~a~~~~~~~~~   40 (56)
                      .+.+.+..   |.+|.|+|.+.-...+...
T Consensus        44 ~~~~~~~~~~nd~~Gtl~v~~~~~~~~~~~   73 (84)
T PF04200_consen   44 SFSIKIVNNANDENGTLTVKVKLSKNNKSK   73 (84)
T ss_dssp             EEEEEEE-THHHHHTEEEEEEEETTT--EE
T ss_pred             EEEEEEccCCcCCCCEEEEEEEEEECCEEE
Confidence            34444433   4669999988875444343


No 168
>PF03174 CHB_HEX_C:  Chitobiase/beta-hexosaminidase C-terminal domain;  InterPro: IPR004867 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. This short domain is found in members of the glycoside hydrolase family 20 (GH20 from CAZY) and represents the C-terminal domain in chitobiases and beta-hexosaminidases 3.2.1.52 from EC. It is composed of a beta sandwich structure []. The function of this domain is unknown. ; GO: 0004563 beta-N-acetylhexosaminidase activity, 0005975 carbohydrate metabolic process; PDB: 1C7T_A 1QBA_A 1QBB_A 1C7S_A.
Probab=21.36  E-value=75  Score=15.17  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=4.6

Q ss_pred             EEeCCCcceEEEEEeCc
Q psy6739          19 FDIDANGILNVTAIEKS   35 (56)
Q Consensus        19 f~~d~nGil~V~a~~~~   35 (56)
                      |.++.++.|.+.+.+.+
T Consensus        49 i~i~~~~~vka~a~~~~   65 (75)
T PF03174_consen   49 ITIPESGTVKARAFDNG   65 (75)
T ss_dssp             C--B--S--EEEEE-TT
T ss_pred             EEeCCCcEEEEEEEcCC
Confidence            44445555555444433


No 169
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional
Probab=21.34  E-value=2.3e+02  Score=18.00  Aligned_cols=27  Identities=11%  Similarity=0.051  Sum_probs=18.0

Q ss_pred             cCeEEEEEEeCCCc---ceEEEEEeCcCCc
Q psy6739          12 VPQIEVTFDIDANG---ILNVTAIEKSTGK   38 (56)
Q Consensus        12 ~~~i~V~f~~d~nG---il~V~a~~~~~~~   38 (56)
                      -..++|.|.++.+.   -++|.++....++
T Consensus        81 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  110 (346)
T PRK14500         81 IHGCKFDINIVYQKRDLEIFLQCAVKTNYK  110 (346)
T ss_pred             cceeEEEEEECCccCcceEEEEEEEEECCC
Confidence            34688999999874   4777666544443


No 170
>cd09019 galactose_mutarotase_like galactose mutarotase_like. Galactose mutarotase catalyzes the conversion of beta-D-galactose to alpha-D-galactose. Beta-D-galactose is produced by the degradation of lactose, a disaccharide composed of beta-D-glucose and beta-D-galactose. This epimerization reaction is the first step in the four-step Leloir pathway, which converts galactose into metabolically important glucose. This epimerization step is followed by the phosophorylation of alpha-D-galactose by galactokinase, an enzyme which can only act on the alpha anomer. A glutamate and a histidine residue of the galactose mutarotase have been shown to be critical for catalysis, the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Galactose mutarotase is a member of the aldose-1-epimerase superfamily.
Probab=21.26  E-value=1.8e+02  Score=17.93  Aligned_cols=21  Identities=14%  Similarity=0.232  Sum_probs=14.6

Q ss_pred             cCeEEEEEEeCCCcceEEEEE
Q psy6739          12 VPQIEVTFDIDANGILNVTAI   32 (56)
Q Consensus        12 ~~~i~V~f~~d~nGil~V~a~   32 (56)
                      ...++|+|+++.++.|+|+.+
T Consensus       125 ~~~~~v~y~L~~~~~L~i~~~  145 (326)
T cd09019         125 NLTVTVTYTLTDDNELTIEYE  145 (326)
T ss_pred             EEEEEEEEEECCCCEEEEEEE
Confidence            346889999988566666543


No 171
>PF14564 Membrane_bind:  Membrane binding; PDB: 1YHP_A 2B1O_A.
Probab=21.19  E-value=1.3e+02  Score=16.11  Aligned_cols=16  Identities=19%  Similarity=0.430  Sum_probs=12.3

Q ss_pred             EEEEEeCC-CcceEEEE
Q psy6739          16 EVTFDIDA-NGILNVTA   31 (56)
Q Consensus        16 ~V~f~~d~-nGil~V~a   31 (56)
                      .|-|+||. +|.+++.-
T Consensus        70 svYFkY~~s~g~V~~~~   86 (110)
T PF14564_consen   70 SVYFKYNPSTGEVSIRK   86 (110)
T ss_dssp             EEEEEEETTTTEEEEE-
T ss_pred             eEEEEECCCCCeEEEee
Confidence            47899997 79988765


No 172
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 12, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 13, do not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recycl
Probab=21.15  E-value=1.5e+02  Score=15.91  Aligned_cols=18  Identities=17%  Similarity=0.180  Sum_probs=14.4

Q ss_pred             eEEEEEEeCCC-cceEEEE
Q psy6739          14 QIEVTFDIDAN-GILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~n-Gil~V~a   31 (56)
                      +|.+++.|+.. +.|+|.+
T Consensus         3 ~i~~sL~Y~~~~~~L~V~V   21 (136)
T cd08406           3 EILLSLSYLPTAERLTVVV   21 (136)
T ss_pred             EEEEEEEEcCCCCEEEEEE
Confidence            58999999965 7788874


No 173
>KOG0104|consensus
Probab=21.01  E-value=1.1e+02  Score=22.21  Aligned_cols=18  Identities=33%  Similarity=0.634  Sum_probs=15.9

Q ss_pred             eEEEEEEeCCCcceEEEE
Q psy6739          14 QIEVTFDIDANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a   31 (56)
                      .|.+.|.+|..|++.|+-
T Consensus       512 GIk~~F~~D~Sgi~~v~~  529 (902)
T KOG0104|consen  512 GIKASFSLDLSGIVLVSR  529 (902)
T ss_pred             CceEEEEEcCcCceEEee
Confidence            389999999999998874


No 174
>cd01081 Aldose_epim aldose 1-epimerase superfamily. Aldose 1-epimerases or mutarotases are key enzymes of carbohydrate metabolism; they catalyze the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate and the histidine as the active site acid to protonate the C-5 ring oxygen.
Probab=20.81  E-value=1.9e+02  Score=16.79  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=7.7

Q ss_pred             CeEEEEEEeCCCc
Q psy6739          13 PQIEVTFDIDANG   25 (56)
Q Consensus        13 ~~i~V~f~~d~nG   25 (56)
                      ..++++|+++.++
T Consensus       113 ~~l~~ty~L~~~~  125 (284)
T cd01081         113 LELTVTYTLDADT  125 (284)
T ss_pred             EEEEEEEEEeCCe
Confidence            3466677766643


No 175
>PF04014 Antitoxin-MazE:  Antidote-toxin recognition MazE;  InterPro: IPR007159 This domain is found in AbrB from Bacillus subtilis. The product of the abrB gene is an ambiactive repressor and activator of the transcription of genes expressed during the transition state between vegetative growth and the onset of stationary phase and sporulation []. AbrB is thought to interact directly with the transcription initiation regions of genes under its control []. AbrB contains a helix-turn-helix structure, but this domain ends before the helix-turn-helix begins []. The product of the B. subtilis gene spoVT is another member of this family and is also a transcriptional regulator []. DNA-binding activity in this AbrB homologue requires hexamerisation []. Another family member has been isolated from the Sulfolobus solfataricus and has been identified as a homologue of bacterial repressor-like proteins. The Escherichia coli family member SohA or Prl1F appears to be bifunctional and is able to regulate its own expression as well as relieve the export block imposed by high-level synthesis of beta-galactosidase hybrid proteins [].; PDB: 2L66_A 2GLW_A 3TND_D 2W1T_B 2RO5_B 2FY9_A 2RO3_B 1UB4_C 3ZVK_G 1YFB_B ....
Probab=20.53  E-value=99  Score=13.42  Aligned_cols=16  Identities=19%  Similarity=0.571  Sum_probs=10.7

Q ss_pred             EEEEEeCCCcceEEEE
Q psy6739          16 EVTFDIDANGILNVTA   31 (56)
Q Consensus        16 ~V~f~~d~nGil~V~a   31 (56)
                      +|.+.++.+|.|.++.
T Consensus        26 ~v~i~~~~~g~i~i~p   41 (47)
T PF04014_consen   26 EVEIEVEGDGKIVIRP   41 (47)
T ss_dssp             EEEEEEETTSEEEEEE
T ss_pred             EEEEEEeCCCEEEEEE
Confidence            4777788887665543


No 176
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins. RIMs are believed to organize specialized sites of the plasma membrane called active zones.  They also play a role in controlling neurotransmitter release, plasticity processes, as well as memory and learning.  RIM contains an N-terminal zinc finger domain, a PDZ domain, and two C-terminal C2 domains (C2A, C2B).  C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins.  Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as
Probab=20.49  E-value=1.7e+02  Score=16.14  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=13.4

Q ss_pred             eEEEEEEeCCCcceEEEE
Q psy6739          14 QIEVTFDIDANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d~nGil~V~a   31 (56)
                      +|++++.|+ .|.|+|.+
T Consensus        19 ~l~lsl~y~-~~~L~V~V   35 (146)
T cd04028          19 DIQLGLYDK-KGQLEVEV   35 (146)
T ss_pred             eEEEEEEeC-CCEEEEEE
Confidence            588888885 78899874


No 177
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins.  IbpA and IbpB are 16 kDa small heat shock proteins (sHsps). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. IbpA and IbpB are produced during high-level production of various heterologous proteins, specifically human prorenin, renin and bovine insulin-like growth factor 2 (bIGF-2), and are strongly associated with inclusion bodies containing these heterologous proteins. IbpA and IbpB work as an integrated system to stabilize thermally aggregated proteins in a disaggregation competent state.  The chaperone activity of IbpB is also significantly elevated as the temperature increases from normal to heat shock. The high temperature results in the disassociation of 2-3-MDa IbpB oligomers into smaller approximately 6
Probab=20.43  E-value=70  Score=15.91  Aligned_cols=9  Identities=33%  Similarity=0.726  Sum_probs=6.8

Q ss_pred             CCcceEEEE
Q psy6739          23 ANGILNVTA   31 (56)
Q Consensus        23 ~nGil~V~a   31 (56)
                      .||+|+|+.
T Consensus        80 ~~GvL~I~l   88 (90)
T cd06470          80 ENGLLTIDL   88 (90)
T ss_pred             eCCEEEEEE
Confidence            578888865


No 178
>cd07914 IGPD Imidazoleglycerol-phosphate dehydratase. Imidazoleglycerol-phosphate dehydratase (IGPD; EC 4.2.1.19) catalyzes the dehydration of imidazole glycerol phosphate to imidazole acetol phosphate, the sixth step of histidine biosynthesis in plants and microorganisms where the histidine is synthesized de novo. There is an internal repeat in the protein domain that is related by pseudo-dyad symmetry, perhaps as a result of an ancient gene duplication. The apo-form of IGPD exists as a catalytically inactive trimer which, in the presence of specific divalent metal cations such as manganese (Mn2+), cobalt (Co2+), cadmium (Cd2+), nickel (Ni2+), iron (Fe2+) and zinc (Zn2+), assembles to form a biologically active high molecular weight metalloenzyme; a 24-mer with 4-3-2 symmetry. Each 24-mer has 24 active sites, and contains around 1.5 metal ions per monomer, each monomer contributing residues to three separate active sites. IGPD enzymes are monofunctional in fungi, plants, archaea and s
Probab=20.41  E-value=1.5e+02  Score=17.53  Aligned_cols=20  Identities=25%  Similarity=0.466  Sum_probs=15.4

Q ss_pred             CcCeEEEEEEeCCCcceEEE
Q psy6739          11 GVPQIEVTFDIDANGILNVT   30 (56)
Q Consensus        11 g~~~i~V~f~~d~nGil~V~   30 (56)
                      .+..|+|.+.+|..|..+|+
T Consensus         8 ~ET~I~v~l~LDg~g~~~i~   27 (190)
T cd07914           8 KETDIEVELNLDGTGKSKID   27 (190)
T ss_pred             cceEEEEEEEeCCCCcccee
Confidence            45579999999988877665


No 179
>KOG4824|consensus
Probab=20.40  E-value=2.2e+02  Score=17.29  Aligned_cols=27  Identities=26%  Similarity=0.102  Sum_probs=17.7

Q ss_pred             EEEEeCCCcceEEEEEeC--cCCceEEEE
Q psy6739          17 VTFDIDANGILNVTAIEK--STGKENKIT   43 (56)
Q Consensus        17 V~f~~d~nGil~V~a~~~--~~~~~~~~~   43 (56)
                      +...++.||.|+|...+.  .+|....++
T Consensus        71 ~y~~~nkngkI~Vln~~v~r~dG~~n~ie   99 (224)
T KOG4824|consen   71 AYTFDNKNGKIHVLNECVHRPDGKINFIE   99 (224)
T ss_pred             eeEecCCCceEEEeeeeeecCCCccceee
Confidence            333445699999998776  666654443


No 180
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only]
Probab=20.38  E-value=2.4e+02  Score=17.82  Aligned_cols=28  Identities=29%  Similarity=0.395  Sum_probs=21.0

Q ss_pred             EEEEEeCCCcceEEEEEeCcCCceEEEE
Q psy6739          16 EVTFDIDANGILNVTAIEKSTGKENKIT   43 (56)
Q Consensus        16 ~V~f~~d~nGil~V~a~~~~~~~~~~~~   43 (56)
                      -+++.+|.+|.|.++.........-.+.
T Consensus        78 ~Lt~~V~~dgslk~tGk~~Kd~~nP~I~  105 (288)
T COG4814          78 SLTMTVDVDGSLKVTGKISKDAKNPIIE  105 (288)
T ss_pred             ceEEEEcCCCcEEEeeeecccCCCCeEE
Confidence            3788899999999998776666554333


No 181
>PF10297 Hap4_Hap_bind:  Minimal binding motif of Hap4 for binding to Hap2/3/5   ;  InterPro: IPR018287 This entry represents an essential domain of the transcription activator Hap4 that allows it to associate with Hap2, Hap3 and Hap5 to form the Hap complex [, ]. In Saccharomyces cerevisiae (Baker's yeast), the haem-activated protein complex Hap2/3/4/5 plays a major role in the transcription of genes involved in respiration []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=20.31  E-value=60  Score=11.71  Aligned_cols=6  Identities=50%  Similarity=1.536  Sum_probs=3.4

Q ss_pred             CCCCCC
Q psy6739           5 IPPAPR   10 (56)
Q Consensus         5 ip~~p~   10 (56)
                      |||.|+
T Consensus         7 lPprpk   12 (17)
T PF10297_consen    7 LPPRPK   12 (17)
T ss_pred             cCCCCC
Confidence            566554


No 182
>PF07773 DUF1619:  Protein of unknown function (DUF1619);  InterPro: IPR011677 This is a group of sequences derived from hypothetical eukaryotic proteins. The region in question is approximately 330 residues long and has a cysteine rich N terminus.
Probab=20.19  E-value=2.2e+02  Score=17.25  Aligned_cols=19  Identities=21%  Similarity=0.466  Sum_probs=14.5

Q ss_pred             CeEEEEEEeCCCcceEEEE
Q psy6739          13 PQIEVTFDIDANGILNVTA   31 (56)
Q Consensus        13 ~~i~V~f~~d~nGil~V~a   31 (56)
                      .+++..|.++..||..|.+
T Consensus       229 ~~v~y~~~~n~t~I~~v~v  247 (294)
T PF07773_consen  229 LEVHYVFTYNGTGITSVSV  247 (294)
T ss_pred             EEEEEEEEECCCccEEEEE
Confidence            4578888899999766664


No 183
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13. Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain.  It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium.  Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).  The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and  binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B).  C2B also regulates also the recy
Probab=20.04  E-value=1.7e+02  Score=15.92  Aligned_cols=18  Identities=17%  Similarity=0.126  Sum_probs=14.3

Q ss_pred             eEEEEEEeC-CCcceEEEE
Q psy6739          14 QIEVTFDID-ANGILNVTA   31 (56)
Q Consensus        14 ~i~V~f~~d-~nGil~V~a   31 (56)
                      +|.+.+.|+ ..|.|+|.+
T Consensus         3 el~~sL~Y~~~~~~L~V~V   21 (138)
T cd08407           3 EVLLSISYLPAANRLLVVV   21 (138)
T ss_pred             EEEEEEEEeCCCCeEEEEE
Confidence            588999998 558888875


Done!