Query         psy6754
Match_columns 79
No_of_seqs    52 out of 54
Neff          3.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:35:03 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6754.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6754hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2548|consensus              100.0   7E-37 1.5E-41  251.1   5.9   76    1-79      1-76  (653)
  2 PF09750 DRY_EERY:  Alternative  99.8 2.9E-22 6.3E-27  137.0   2.2   41   39-79      1-41  (122)
  3 KOG1847|consensus               99.0 5.5E-11 1.2E-15  101.1   1.4   43   37-79     30-72  (878)
  4 PF08216 CTNNBL:  Catenin-beta-  60.2      16 0.00035   25.0   3.6   33    9-41     25-57  (108)
  5 PF06886 TPX2:  Targeting prote  56.3      11 0.00025   22.8   2.2   15   20-34      4-18  (57)
  6 cd01234 PH_CADPS CADPS (Ca2+-d  42.4     9.8 0.00021   26.7   0.3   19   30-48     39-57  (117)
  7 KOG2570|consensus               34.2      92   0.002   26.1   4.8   38    4-42    330-367 (420)
  8 PF02216 B:  B domain;  InterPr  33.0      17 0.00037   22.4   0.3   27   23-49     24-50  (54)
  9 PF04991 LicD:  LicD family;  I  32.0      16 0.00036   24.8   0.2   17   63-79     21-37  (205)
 10 PF14402 7TM_transglut:  7 tran  31.2      24 0.00052   28.3   1.0   43   33-75     27-69  (313)
 11 PF07225 NDUF_B4:  NADH-ubiquin  30.3 1.7E+02  0.0036   20.4   5.0   32   19-59     33-64  (125)
 12 cd02683 MIT_1 MIT: domain cont  28.0 1.4E+02  0.0031   18.5   4.0   26   10-35     50-75  (77)
 13 cd03441 R_hydratase_like (R)-h  28.0      48   0.001   20.3   1.8   29   39-67     17-45  (127)
 14 PF15084 DUF4550:  Domain of un  27.0      22 0.00047   24.2   0.1   26   41-73     23-48  (99)
 15 COG3805 DodA Aromatic ring-cle  25.5      44 0.00094   23.5   1.4   23   39-61      4-26  (120)
 16 PF07845 DUF1636:  Protein of u  25.4      32  0.0007   23.4   0.7   20   57-76     87-106 (116)
 17 PF09043 Lys-AminoMut_A:  D-Lys  24.7      92   0.002   26.6   3.3   62    8-76    116-177 (509)
 18 PF11538 Snurportin1:  Snurport  24.4      77  0.0017   18.2   2.1   16   22-37     16-31  (40)
 19 cd03449 R_hydratase (R)-hydrat  22.4      71  0.0015   19.7   1.8   29   39-67     20-48  (128)
 20 PF04212 MIT:  MIT (microtubule  22.4 1.7E+02  0.0038   17.0   4.1   20   10-29     49-68  (69)
 21 COG5469 Predicted metal-bindin  21.6      41 0.00089   24.4   0.6   19   58-76    108-126 (143)
 22 PF12286 DUF3622:  Protein of u  21.4 1.1E+02  0.0024   19.8   2.5   20    9-28     51-70  (71)

No 1  
>KOG2548|consensus
Probab=100.00  E-value=7e-37  Score=251.15  Aligned_cols=76  Identities=66%  Similarity=1.070  Sum_probs=74.9

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcchhhhheeccceeeeChHHHhhhcCCCceeccCCCCCCcccC
Q psy6754           1 MWHEARKQEKKIRGLMVDYKRRAERRRDYYEKIRADPTQFIQIHGRPCKIHLDPSVALAADSPSTMMSWQGDRDIMIDR   79 (79)
Q Consensus         1 MwhEARkqEk~ir~~m~d~rkRaErr~~~~e~~k~DP~q~Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~dilIDR   79 (79)
                      ||||||+|||+||+|||||+||||||+.||||+++||+|||||||++|+||+|++||+|+|+ ++||  |||.+|||||
T Consensus         1 MWHEARrqEkkvr~~mvd~rKRAERRr~yyekirkDP~QflQ~hGrr~kvhlD~gva~AaEd-~~lm--QGd~~n~idr   76 (653)
T KOG2548|consen    1 MWHEARRQEKKVRDMMVDYRKRAERRRIYYEKIRKDPIQFLQAHGRRYKVHLDDGVAQAAED-NILM--QGDSTNQIDR   76 (653)
T ss_pred             CccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCHHHHHHHhchhheeeccHHHHHhccc-hhhh--cccccchhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999 8888  9999999997


No 2  
>PF09750 DRY_EERY:  Alternative splicing regulator  ;  InterPro: IPR019147  This entry represents the conserved N-terminal region of SWAP (suppressor-of-white-apricot protein) splice factor proteins. This region contains two highly conserved motifs, viz: DRY and EERY, which appear to be the sites for alternative splicing of exons 2 and 3 of the SWAP mRNA []. These proteins are thus thought to be involved in auto-regulation of pre-mRNA splicing. Most family members are associated with two Surp domains (IPR000061 from INTERPRO) and an arginine/serine-rich binding region towards the C terminus. 
Probab=99.85  E-value=2.9e-22  Score=136.96  Aligned_cols=41  Identities=46%  Similarity=0.880  Sum_probs=40.5

Q ss_pred             hhhhheeccceeeeChHHHhhhcCCCceeccCCCCCCcccC
Q psy6754          39 QFIQIHGRPCKIHLDPSVALAADSPSTMMSWQGDRDIMIDR   79 (79)
Q Consensus        39 q~Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~dilIDR   79 (79)
                      |||+|||++||||+|+++|.|++++++|||||||++|||||
T Consensus         1 q~L~V~G~~cklf~D~~~a~~~~~~~~LiPW~Gd~~~lIDR   41 (122)
T PF09750_consen    1 QFLQVFGYACKLFRDDEVAQAIESGKHLIPWQGDPDLLIDR   41 (122)
T ss_pred             CceEEEeEeeeeecCHHHHHHHhCcCCcccCCCCcccceeH
Confidence            79999999999999999999999999999999999999998


No 3  
>KOG1847|consensus
Probab=99.04  E-value=5.5e-11  Score=101.07  Aligned_cols=43  Identities=30%  Similarity=0.534  Sum_probs=41.2

Q ss_pred             cchhhhheeccceeeeChHHHhhhcCCCceeccCCCCCCcccC
Q psy6754          37 PTQFIQIHGRPCKIHLDPSVALAADSPSTMMSWQGDRDIMIDR   79 (79)
Q Consensus        37 P~q~Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~dilIDR   79 (79)
                      .+--|.||||+|+||.|+..|.+.+++.+||||+||++|+|||
T Consensus        30 ~~~dLlVfGya~~~F~dD~~a~~v~~~~hlVpw~GDp~~~IDR   72 (878)
T KOG1847|consen   30 HTMDLLVFGYAALFFDDDSMATFVNSPTHLVPWNGDPSLFIDR   72 (878)
T ss_pred             ceeeEEEeeeehhccCchHHHHhhcCCceecccCCChhhhccc
Confidence            5667999999999999999999999999999999999999998


No 4  
>PF08216 CTNNBL:  Catenin-beta-like, Arm-motif containing nuclear;  InterPro: IPR013180 This domain is found in eukaryotic proteins. A human nuclear protein with this domain (Q8WYA6 from SWISSPROT) is thought to have a role in apoptosis [].
Probab=60.18  E-value=16  Score=25.00  Aligned_cols=33  Identities=21%  Similarity=0.534  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCCcchhh
Q psy6754           9 EKKIRGLMVDYKRRAERRRDYYEKIRADPTQFI   41 (79)
Q Consensus         9 Ek~ir~~m~d~rkRaErr~~~~e~~k~DP~q~L   41 (79)
                      ++.||++...-.|+..+=++-=.|...||+.||
T Consensus        25 ~~~lkklvl~fek~i~kN~e~R~K~~ddP~KFm   57 (108)
T PF08216_consen   25 EAWLKKLVLSFEKRINKNQEMRIKYPDDPEKFM   57 (108)
T ss_pred             HHHHHHHHHHHHHHHHHhHHHHHhCCCCHHHHH
Confidence            578999999999988887777788899999998


No 5  
>PF06886 TPX2:  Targeting protein for Xklp2 (TPX2);  InterPro: IPR009675 This family represents a conserved region approximately 60 residues long within the eukaryotic targeting protein for Xklp2 (TPX2). Xklp2 is a kinesin-like protein localised on centrosomes throughout the cell cycle and on spindle pole microtubules during metaphase. In Xenopus, it has been shown that Xklp2 protein is required for centrosome separation and maintenance of spindle bi-polarity []. TPX2 is a microtubule-associated protein that mediates the binding of the C-terminal domain of Xklp2 to microtubules. It is phosphorylated during mitosis in a microtubule-dependent way [].
Probab=56.31  E-value=11  Score=22.77  Aligned_cols=15  Identities=33%  Similarity=0.711  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHh
Q psy6754          20 KRRAERRRDYYEKIR   34 (79)
Q Consensus        20 rkRaErr~~~~e~~k   34 (79)
                      -.||+.|+.||.+..
T Consensus         4 ~~RA~~R~eF~~kl~   18 (57)
T PF06886_consen    4 DERAEERKEFDKKLE   18 (57)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            469999999998864


No 6  
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain. CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain. CADPS is a calcium-dependent activator involved in secretion. It contains a central PH domain that binds to phosphoinositide 4,5  bisphosphate containing liposomes. However,  membrane association may also be mediated by binding to phosphatidlyserine via general electrostatic interactions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=42.36  E-value=9.8  Score=26.72  Aligned_cols=19  Identities=42%  Similarity=0.854  Sum_probs=15.6

Q ss_pred             HHHHhCCcchhhhheeccc
Q psy6754          30 YEKIRADPTQFIQIHGRPC   48 (79)
Q Consensus        30 ~e~~k~DP~q~Lqv~G~~c   48 (79)
                      |...|.||+.+||+.|+--
T Consensus        39 y~ekks~P~e~~qldGyTv   57 (117)
T cd01234          39 YREKKAEPTEFIQLDGYTV   57 (117)
T ss_pred             hhhhcCCchhheeecceEE
Confidence            4556889999999999853


No 7  
>KOG2570|consensus
Probab=34.16  E-value=92  Score=26.05  Aligned_cols=38  Identities=29%  Similarity=0.595  Sum_probs=29.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcchhhh
Q psy6754           4 EARKQEKKIRGLMVDYKRRAERRRDYYEKIRADPTQFIQ   42 (79)
Q Consensus         4 EARkqEk~ir~~m~d~rkRaErr~~~~e~~k~DP~q~Lq   42 (79)
                      |-....++|.+++.. =.+-++|++||-+.+.||..||.
T Consensus       330 eI~alD~kI~~li~~-ine~~~rr~Ff~~Fs~dPvefin  367 (420)
T KOG2570|consen  330 EIAALDRKITELIQQ-INESKERRDFFLEFSKDPVEFIN  367 (420)
T ss_pred             HHHHHHHHHHHHHHH-HHHHHHHHHHHHHhhhCHHHHHH
Confidence            445667888887544 45677888999999999999984


No 8  
>PF02216 B:  B domain;  InterPro: IPR003132 This entry represents the immunoglobulin-binding domain found in the Staphylococcus aureus virulence factor protein A (SpA). Protein A contains five highly homologous Ig-binding domains in tandem (designated domains E, D, A, B and C), which share a common structure consisting of three helices in a closed left-handed twist. Protein A can exist in both secreted and membrane-bound forms, and has two distinct Ig-binding activities: each domain can bind Fc-gamma (the constant region of IgG involved in effector functions) and Fab (the Ig fragment responsible for antigen recognition) [].; GO: 0019865 immunoglobulin binding, 0009405 pathogenesis; PDB: 1EDL_A 1EDI_A 1EDJ_A 1EDK_A 2B88_A 2B87_A 2B89_A 1FC2_C 1DEE_H 1ZXG_A ....
Probab=32.99  E-value=17  Score=22.45  Aligned_cols=27  Identities=22%  Similarity=0.496  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHhCCcchhhhheeccce
Q psy6754          23 AERRRDYYEKIRADPTQFIQIHGRPCK   49 (79)
Q Consensus        23 aErr~~~~e~~k~DP~q~Lqv~G~~ck   49 (79)
                      .|+|-.|...+|.||.++-.|++.+-|
T Consensus        24 eeQrn~yI~~lKddPs~sq~v~~ea~k   50 (54)
T PF02216_consen   24 EEQRNGYIQSLKDDPSRSQNVFSEAKK   50 (54)
T ss_dssp             HHHHHHHHHHHHH-GCCHHHHHHHHHH
T ss_pred             HHHHHhHHHHHhhChHHHHHHHHHHHH
Confidence            578999999999999999888776543


No 9  
>PF04991 LicD:  LicD family;  InterPro: IPR007074 The LicD family of proteins show high sequence similarity and are involved in phosphorylcholine metabolism. There is evidence to show that LicD2 mutants have a reduced ability to take up choline, have decreased ability to adhere to host cells and are less virulent []. Fukutin, which is a member of the LicD family, is a human protein which may be involved in the modification of glycan moieties of alpha-dystroglycan; defects in Fukutin are associated with congential muscular dystrophy [].
Probab=31.98  E-value=16  Score=24.83  Aligned_cols=17  Identities=29%  Similarity=0.626  Sum_probs=14.2

Q ss_pred             CCceeccCCCCCCcccC
Q psy6754          63 PSTMMSWQGDRDIMIDR   79 (79)
Q Consensus        63 ~~~liPWqGd~dilIDR   79 (79)
                      -++.|||--|-||.+-|
T Consensus        21 h~gfIPWDDDiDi~m~r   37 (205)
T PF04991_consen   21 HGGFIPWDDDIDIGMPR   37 (205)
T ss_pred             cCCCCCCCCcccEEeeH
Confidence            47899999999998754


No 10 
>PF14402 7TM_transglut:  7 transmembrane helices usually fused to an inactive transglutaminase
Probab=31.22  E-value=24  Score=28.31  Aligned_cols=43  Identities=12%  Similarity=0.319  Sum_probs=33.7

Q ss_pred             HhCCcchhhhheeccceeeeChHHHhhhcCCCceeccCCCCCC
Q psy6754          33 IRADPTQFIQIHGRPCKIHLDPSVALAADSPSTMMSWQGDRDI   75 (79)
Q Consensus        33 ~k~DP~q~Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~di   75 (79)
                      +++.|+++++|+--.-=+..||.-+...-..+.|+=|.|+.+.
T Consensus        27 r~q~l~~~lev~~~~~W~~f~p~tg~~g~p~n~L~W~~g~~~l   69 (313)
T PF14402_consen   27 RRQSLEPWLEVFNGGKWVLFNPRTGEQGLPENFLLWWRGDESL   69 (313)
T ss_pred             cccCcHhHHheeeCCeEEEECCCCCCcCCCCCEEEEEECCccc
Confidence            6789999999999999999999887766655666656666554


No 11 
>PF07225 NDUF_B4:  NADH-ubiquinone oxidoreductase B15 subunit (NDUFB4);  InterPro: IPR009866  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family contains human NADH-ubiquinone oxidoreductase subunit NDUFB4 and related sequences.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=30.28  E-value=1.7e+02  Score=20.41  Aligned_cols=32  Identities=25%  Similarity=0.325  Sum_probs=22.2

Q ss_pred             HHHHHHHHHHHHHHHhCCcchhhhheeccceeeeChHHHhh
Q psy6754          19 YKRRAERRRDYYEKIRADPTQFIQIHGRPCKIHLDPSVALA   59 (79)
Q Consensus        19 ~rkRaErr~~~~e~~k~DP~q~Lqv~G~~cki~~D~~~a~a   59 (79)
                      ++.||+=|++ |-+...||.        .+-+-.||++..-
T Consensus        33 ~a~Ra~Lk~e-Ylkq~~nP~--------~~gli~DPAL~Rw   64 (125)
T PF07225_consen   33 AAIRARLKRE-YLKQYNNPH--------RKGLIFDPALQRW   64 (125)
T ss_pred             HHHHHHHHHH-HHHHcCCCC--------CCCccCChHHHHH
Confidence            3444444444 578899999        6677889998743


No 12 
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules. This sub-family of MIT domains is found in proteins with unknown function, co-occuring with an as yet undescribed domain. The molecular function of the MIT domain is unclear.
Probab=27.98  E-value=1.4e+02  Score=18.51  Aligned_cols=26  Identities=23%  Similarity=0.411  Sum_probs=21.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhC
Q psy6754          10 KKIRGLMVDYKRRAERRRDYYEKIRA   35 (79)
Q Consensus        10 k~ir~~m~d~rkRaErr~~~~e~~k~   35 (79)
                      ..|+..+..|..|||.-+.+..+.+.
T Consensus        50 ~~~r~ki~eY~~RAE~Lk~~l~~~~~   75 (77)
T cd02683          50 KNLRQKISEYMDRAEAIKKRLDQEKE   75 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            45899999999999999999876553


No 13 
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase].  Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  The structure of the monomer includes a five-strand antiparallel beta-sheet wrapped around a central alpha helix, referred to as a hot dog fold.  The active site lies within a substrate-binding tunnel formed by the homodimer.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE),  and the fatty acid synthase beta subunit.
Probab=27.96  E-value=48  Score=20.31  Aligned_cols=29  Identities=34%  Similarity=0.532  Sum_probs=20.2

Q ss_pred             hhhhheeccceeeeChHHHhhhcCCCcee
Q psy6754          39 QFIQIHGRPCKIHLDPSVALAADSPSTMM   67 (79)
Q Consensus        39 q~Lqv~G~~cki~~D~~~a~a~e~~~~li   67 (79)
                      .|-.+.|-.-.||.|++.|.....+...+
T Consensus        17 ~fa~~~gd~npiH~d~~~A~~~~~~~~i~   45 (127)
T cd03441          17 LFARLSGDPNPIHVDPEYAKAAGFGGRIA   45 (127)
T ss_pred             HHHHHhCCCCccccCHHHHHhCCCCCcee
Confidence            45566777888999999887655444443


No 14 
>PF15084 DUF4550:  Domain of unknown function (DUF4550)
Probab=27.01  E-value=22  Score=24.17  Aligned_cols=26  Identities=19%  Similarity=0.501  Sum_probs=19.3

Q ss_pred             hhheeccceeeeChHHHhhhcCCCceeccCCCC
Q psy6754          41 IQIHGRPCKIHLDPSVALAADSPSTMMSWQGDR   73 (79)
Q Consensus        41 Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~   73 (79)
                      +-|+|..+|||.+.+.       .+..||.-+.
T Consensus        23 vV~f~~~AKvF~e~~~-------K~~~~w~~gd   48 (99)
T PF15084_consen   23 VVVFGNVAKVFLENES-------KTVKPWHEGD   48 (99)
T ss_pred             EEEecceeeEEEcCCc-------eEeeeEecCC
Confidence            5689999999998733       6777777433


No 15 
>COG3805 DodA Aromatic ring-cleaving dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=25.54  E-value=44  Score=23.52  Aligned_cols=23  Identities=22%  Similarity=0.358  Sum_probs=19.2

Q ss_pred             hhhhheeccceeeeChHHHhhhc
Q psy6754          39 QFIQIHGRPCKIHLDPSVALAAD   61 (79)
Q Consensus        39 q~Lqv~G~~cki~~D~~~a~a~e   61 (79)
                      ..|-|.|..+.||.|++.+.-+|
T Consensus         4 es~nIt~fHAHvYFD~a~~~~Ae   26 (120)
T COG3805           4 ESLNITMFHAHVYFDPAQAIVAE   26 (120)
T ss_pred             cccceeeEEEEEEEChHHHHHHH
Confidence            34789999999999998877665


No 16 
>PF07845 DUF1636:  Protein of unknown function (DUF1636);  InterPro: IPR012863 The sequences featured in this family are derived from a number of hypothetical prokaryotic proteins. The region in question is approximately 130 amino acids long. 
Probab=25.43  E-value=32  Score=23.40  Aligned_cols=20  Identities=30%  Similarity=0.584  Sum_probs=15.5

Q ss_pred             HhhhcCCCceeccCCCCCCc
Q psy6754          57 ALAADSPSTMMSWQGDRDIM   76 (79)
Q Consensus        57 a~a~e~~~~liPWqGd~dil   76 (79)
                      .++++++.+++||..-|..|
T Consensus        87 ~~Y~~s~dG~vp~~~rP~~l  106 (116)
T PF07845_consen   87 ALYAASPDGLVPWRERPEGL  106 (116)
T ss_pred             HHHHhCCCCccccccCCHHH
Confidence            45678899999999877543


No 17 
>PF09043 Lys-AminoMut_A:  D-Lysine 5,6-aminomutase alpha subunit;  InterPro: IPR015130 This domain is found in proteins involved in the 1,2 rearrangement of the terminal amino group of DL-lysine and of L-beta-lysine, using adenosylcobalamin (AdoCbl) and pyridoxal-5'-phosphate as cofactors. The structure is predominantly a PLP-binding TIM barrel domain, with several additional alpha-helices and beta-strands at the N and C termini. These helices and strands form an intertwined accessory clamp structure that wraps around the sides of the TIM barrel and extends up toward the Ado ligand of the Cbl cofactor, providing most of the interactions observed between the protein and the Ado ligand of the Cbl, suggesting that its role is mainly in stabilising AdoCbl in the precatalytic resting state. ; PDB: 3KP1_A 3KOW_A 3KOZ_A 3KOY_B 3KOX_A 3KP0_C 1XRS_A.
Probab=24.71  E-value=92  Score=26.64  Aligned_cols=62  Identities=23%  Similarity=0.196  Sum_probs=44.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhCCcchhhhheeccceeeeChHHHhhhcCCCceeccCCCCCCc
Q psy6754           8 QEKKIRGLMVDYKRRAERRRDYYEKIRADPTQFIQIHGRPCKIHLDPSVALAADSPSTMMSWQGDRDIM   76 (79)
Q Consensus         8 qEk~ir~~m~d~rkRaErr~~~~e~~k~DP~q~Lqv~G~~cki~~D~~~a~a~e~~~~liPWqGd~dil   76 (79)
                      -+..++..+.--+++-+.|.+|.+++-.-|..+|-|.=-.-.||-|--.++|+       .|+|-.-|+
T Consensus       116 ~~~~~~~~~~~i~~~r~~Re~~~~~~g~~p~P~iy~iVAtG~iyeDi~qaraA-------A~~GAD~Ia  177 (509)
T PF09043_consen  116 LRPYAKEGIERIDANRKEREEYIERIGPGPKPVIYVIVATGNIYEDIRQARAA-------ARQGADIIA  177 (509)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHH--ECSSEEEEEE-SS-HHHHHHHHHHH-------HHTT-SEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCeEEEEEecCchHHHHHHHHHH-------HHcCCCEEE
Confidence            34556677777778888899999999888888888888888899888777766       477655443


No 18 
>PF11538 Snurportin1:  Snurportin1;  InterPro: IPR024721 Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor []. Snurportin-1 interacts with m3G-cap where it enhances the m3G-cap dependent nuclear import of U snRNPs in Xenopus laevis oocytes and digitonin-permeabilized HeLa cells []. This entry represents the snurportin-1 N-terminal importin beta binding domain (IBB). The essential role of the IBB domain for snurportin-1 function suggests that snurportin-1 cooperates with importin beta in mediating nuclear import of snRNPs.; GO: 0005515 protein binding; PDB: 3LWW_D 3NC0_E 3NBZ_E 2Q5D_C 3NBY_B 3GB8_B 3GJX_B 2QNA_B 2P8Q_B.
Probab=24.45  E-value=77  Score=18.22  Aligned_cols=16  Identities=31%  Similarity=0.696  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHhCCc
Q psy6754          22 RAERRRDYYEKIRADP   37 (79)
Q Consensus        22 RaErr~~~~e~~k~DP   37 (79)
                      -+|||+.++|..+.-=
T Consensus        16 Q~eRR~~~Le~QK~kR   31 (40)
T PF11538_consen   16 QEERRREFLERQKNKR   31 (40)
T ss_dssp             HHHHHHHHHHHHHSHH
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            4789999998887643


No 19 
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.  The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer.  A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=22.42  E-value=71  Score=19.71  Aligned_cols=29  Identities=24%  Similarity=0.279  Sum_probs=19.8

Q ss_pred             hhhhheeccceeeeChHHHhhhcCCCcee
Q psy6754          39 QFIQIHGRPCKIHLDPSVALAADSPSTMM   67 (79)
Q Consensus        39 q~Lqv~G~~cki~~D~~~a~a~e~~~~li   67 (79)
                      .|-.+.|-.--||.|++.|.++.-+....
T Consensus        20 ~fa~~~gd~npiH~D~~~A~~~g~~~~i~   48 (128)
T cd03449          20 LFAELSGDFNPIHLDEEYAKKTRFGGRIA   48 (128)
T ss_pred             HHHHHhCCCCCccCCHHHHhhCCCCCcee
Confidence            45566777778999999887654444433


No 20 
>PF04212 MIT:  MIT (microtubule interacting and transport) domain;  InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking.; PDB: 2DL1_A 2JQK_A 1WR0_A 2CPT_A 2JQH_A 2V6Y_A 2JQ9_A 2K3W_A 1YXR_A 3EAB_E ....
Probab=22.38  E-value=1.7e+02  Score=16.99  Aligned_cols=20  Identities=35%  Similarity=0.689  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy6754          10 KKIRGLMVDYKRRAERRRDY   29 (79)
Q Consensus        10 k~ir~~m~d~rkRaErr~~~   29 (79)
                      ..|+..|..|-.|||-.+.+
T Consensus        49 ~~l~~k~~~yl~RAE~lk~~   68 (69)
T PF04212_consen   49 QALRQKMKEYLERAEKLKEY   68 (69)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhh
Confidence            45999999999999988765


No 21 
>COG5469 Predicted metal-binding protein [Function unknown]
Probab=21.64  E-value=41  Score=24.36  Aligned_cols=19  Identities=21%  Similarity=0.517  Sum_probs=15.1

Q ss_pred             hhhcCCCceeccCCCCCCc
Q psy6754          58 LAADSPSTMMSWQGDRDIM   76 (79)
Q Consensus        58 ~a~e~~~~liPWqGd~dil   76 (79)
                      .+..+..+|+||-+-|+-|
T Consensus       108 ly~~~~dG~~pw~~rPe~L  126 (143)
T COG5469         108 LYANSADGLVPWRKRPEPL  126 (143)
T ss_pred             HhhhcccCccccccCChhH
Confidence            3467889999999988754


No 22 
>PF12286 DUF3622:  Protein of unknown function (DUF3622);  InterPro: IPR022069  This family of proteins is found in bacteria. Proteins in this family are typically between 72 and 107 amino acids in length. There is a conserved VSK sequence motif. 
Probab=21.44  E-value=1.1e+02  Score=19.79  Aligned_cols=20  Identities=25%  Similarity=0.581  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q psy6754           9 EKKIRGLMVDYKRRAERRRD   28 (79)
Q Consensus         9 Ek~ir~~m~d~rkRaErr~~   28 (79)
                      |+-|++.+-..-.|++|+++
T Consensus        51 e~eL~~fl~n~~~RN~Rka~   70 (71)
T PF12286_consen   51 EKELKSFLENQAERNERKAE   70 (71)
T ss_pred             HHHHHHHHHHHHHHhHhhhc
Confidence            78899999999999999863


Done!