RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy6758
(101 letters)
>gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho
GTPase-activating protein 9 and similar proteins. This
subfamily is composed of Rho GTPase-activating proteins
including mammalian ARHGAP9, and vertebrate ARHGAPs 12
and 27. RhoGAPs (or ARHGAPs) bind to Rho proteins and
enhance the hydrolysis rates of bound GTP. ARHGAP9
functions as a GAP for Rac and Cdc42, but not for RhoA.
It negatively regulates cell migration and adhesion. It
also acts as a docking protein for the MAP kinases Erk2
and p38alpha, and may facilitate cross-talk between the
Rho GTPase and MAPK pathways to control actin
remodeling. ARHGAP27, also called CAMGAP1, shows GAP
activity towards Rac1 and Cdc42. It binds the adaptor
protein CIN85 and may play a role in clathrin-mediated
endocytosis. ARHGAP12 has been shown to display GAP
activity towards Rac1. It plays a role in regulating
HFG-driven cell growth and invasiveness. ARHGAPs in
this subfamily contain SH3, WW, Pleckstin homology
(PH), and RhoGAP domains. SH3 domains bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs; they play a
role in the regulation of enzymes by intramolecular
interactions, changing the subcellular localization of
signal pathway components and mediate multiprotein
complex assemblies.
Length = 54
Score = 75.5 bits (186), Expect = 7e-20
Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSS-GKPFYVPASY 59
+ VLY F+Y+ KDG+ V I+EGE+ L+KK+N DWWQV R KPFYVPA Y
Sbjct: 1 YVVVLYPFEYTGKDGRKVSIKEGERFLLLKKSNDDWWQVRRPGDSKPFYVPAQY 54
>gnl|CDD|213019 cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho
GTPase-activating protein 9 and similar proteins. Rho
GTPase-activating proteins (RhoGAPs or ARHGAPs) bind to
Rho proteins and enhance the hydrolysis rates of bound
GTP. ARHGAP9 functions as a GAP for Rac and Cdc42, but
not for RhoA. It negatively regulates cell migration
and adhesion. It also acts as a docking protein for the
MAP kinases Erk2 and p38alpha, and may facilitate
cross-talk between the Rho GTPase and MAPK pathways to
control actin remodeling. It contains SH3, WW,
Pleckstin homology (PH), and RhoGAP domains. SH3
domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 57
Score = 66.5 bits (162), Expect = 2e-16
Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR----SSGKPFYVPASY 59
L LY + Y+ DG+ V I EGE+ L++KTN DWWQV R S+ +P +VPA+Y
Sbjct: 2 LCALYAYQYTGADGRQVSIAEGERFLLLRKTNSDWWQVRRLEAPSTSRPLFVPATY 57
>gnl|CDD|213002 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rho
GTPase-activating protein 27. Rho GTPase-activating
proteins (RhoGAPs or ARHGAPs) bind to Rho proteins and
enhance the hydrolysis rates of bound GTP. ARHGAP27,
also called CAMGAP1, shows GAP activity towards Rac1
and Cdc42. It binds the adaptor protein CIN85 and may
play a role in clathrin-mediated endocytosis. It
contains SH3, WW, Pleckstin homology (PH), and RhoGAP
domains. SH3 domains bind to proline-rich ligands with
moderate affinity and selectivity, preferentially to
PxxP motifs; they play a role in the regulation of
enzymes by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 57
Score = 61.8 bits (150), Expect = 2e-14
Identities = 23/54 (42%), Positives = 36/54 (66%), Gaps = 1/54 (1%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRS-SGKPFYVPASYVEV 62
V + F+Y+ KDG+ V I+ E+ L+++TN+ WW V R +PFY+PA YV+
Sbjct: 4 VEHAFEYTGKDGRLVSIKPNERYILLRRTNEHWWHVRRDKGTRPFYIPAKYVKE 57
>gnl|CDD|213003 cd12070, SH3_ARHGAP12, Src Homology 3 domain of Rho
GTPase-activating protein 12. Rho GTPase-activating
proteins (RhoGAPs or ARHGAPs) bind to Rho proteins and
enhance the hydrolysis rates of bound GTP. ARHGAP12 has
been shown to display GAP activity towards Rac1. It
plays a role in regulating hepatocyte growth factor
(HGF)-driven cell growth and invasiveness. It contains
SH3, WW, Pleckstin homology (PH), and RhoGAP domains.
SH3 domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 60
Score = 54.6 bits (131), Expect = 1e-11
Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 2/55 (3%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVE 61
++V YD+DY KD K V I++GE+ L+KKTN DWWQV + + KPFYVPA YV+
Sbjct: 3 IEVEYDYDYEAKDRKIV-IKQGERYILVKKTNDDWWQVKKDENSKPFYVPAQYVK 56
>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein
interacting with Nck, 90 kDa (SPIN90). SPIN90 is also
called NCK interacting protein with SH3 domain
(NCKIPSD), Dia-interacting protein (DIP), 54 kDa
vimentin-interacting protein (VIP54), or
WASP-interacting SH3-domain protein (WISH). It is an
F-actin binding protein that regulates actin
polymerization and endocytosis. It associates with the
Arp2/3 complex near actin filaments and determines
filament localization at the leading edge of
lamellipodia. SPIN90 is expressed in the early stages
of neuronal differentiation and plays a role in
regulating growth cone dynamics and neurite outgrowth.
It also interacts with IRSp53 and regulates cell
motility by playing a role in the formation of membrane
protrusions. SPIN90 contains an N-terminal SH3 domain,
a proline-rich domain, and a C-terminal VCA
(verprolin-homology and cofilin-like acidic) domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 52.7 bits (127), Expect = 6e-11
Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 2/54 (3%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ LYDF + + + EGE L++++N WW V SG+ YVPA+YV+
Sbjct: 2 YRALYDF--KSAEPNTLSFSEGETFLLLERSNAHWWLVTNHSGETGYVPANYVK 53
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains. Src homology 3 (SH3)
domains bind to target proteins through sequences
containing proline and hydrophobic amino acids.
Pro-containing polypeptides may bind to SH3 domains in
2 different binding orientations.
Length = 56
Score = 47.5 bits (114), Expect = 6e-09
Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
Query: 6 VTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
++ LYD+ D + ++G+ + +++K++ WW+ GK P++YVE
Sbjct: 3 PQVRALYDYTAQDPDE--LSFKKGDIITVLEKSDDGWWKGRLGRGKEGLFPSNYVE 56
>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of
Cdc42-Interacting Protein 4. This subfamily is
composed of Cdc42-Interacting Protein 4 (CIP4), Formin
Binding Protein 17 (FBP17), FormiN Binding Protein
1-Like (FNBP1L), and similar proteins. CIP4 and FNBP1L
are Cdc42 effectors that bind Wiskott-Aldrich syndrome
protein (WASP) and function in endocytosis. CIP4 and
FBP17 bind to the Fas ligand and may be implicated in
the inflammatory response. CIP4 may also play a role in
phagocytosis. It functions downstream of Cdc42 in
PDGF-dependent actin reorganization and cell migration,
and also regulates the activity of PDGFRbeta. It uses
Src as a substrate in regulating the invasiveness of
breast tumor cells. CIP4 may also play a role in the
pathogenesis of Huntington's disease. Members of this
subfamily typically contain an N-terminal F-BAR
(FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain, a
central Cdc42-binding HR1 domain, and a C-terminal SH3
domain. The SH3 domain of CIP4 associates with Gapex-5,
a Rab31 GEF. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 43.4 bits (103), Expect = 3e-07
Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
LYDFD T +G + ++EGE L ++++ D W +V +++G YVP SY+EV
Sbjct: 3 TALYDFD-GTSEGT-LSMEEGEILLVLEEDGGDGWTRVRKNNGDEGYVPTSYIEV 55
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily. Src Homology 3
(SH3) domains are protein interaction domains that bind
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. Thus, they
are referred to as proline-recognition domains (PRDs).
SH3 domains are less selective and show more diverse
specificity compared to other PRDs. They have been
shown to bind peptide sequences that lack the PxxP
motif; examples include the PxxDY motif of Eps8 and the
RKxxYxxY sequence in SKAP55. SH3 domain containing
proteins play versatile and diverse roles in the cell,
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies, among others. Many members of this
superfamily are adaptor proteins that associate with a
number of protein partners, facilitating complex
formation and signal transduction.
Length = 51
Score = 42.8 bits (102), Expect = 3e-07
Identities = 12/51 (23%), Positives = 28/51 (54%), Gaps = 2/51 (3%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
+ LYD++ D + ++G+ + +++K + WW+ + G+ PA+Y
Sbjct: 3 RALYDYEAQDDDE--LSFKKGDIITVLEKDDDGWWEGELNGGREGLFPANY 51
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. The third SH3 domain of
Sla1p can bind ubiquitin while retaining the ability to
bind proline-rich ligands; monoubiquitination of target
proteins signals internalization and sorting through
the endocytic pathway. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 42.7 bits (101), Expect = 5e-07
Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLI-KKTNKDWWQVIR-SSGKPFYVPASYVEV 62
KVLYDFD + D + ++EG+ ++++ K +KDWW V S+GK VPASY+E+
Sbjct: 4 KVLYDFDAQSDD--ELTVKEGDVVYILDDKKSKDWWMVENVSTGKEGVVPASYIEI 57
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain. SH3 (Src homology 3) domains are
often indicative of a protein involved in signal
transduction related to cytoskeletal organisation.
First described in the Src cytoplasmic tyrosine kinase.
The structure is a partly opened beta barrel.
Length = 47
Score = 40.2 bits (95), Expect = 4e-06
Identities = 11/49 (22%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPA 57
LYD+ D + ++G+ + +++K++ WW+ GK +P+
Sbjct: 1 VALYDYTAREPD--ELSFKKGDIIIVLEKSDDGWWKGRLKGGKEGLIPS 47
>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha
Spectrin. Spectrin is a major structural component of
the red blood cell membrane skeleton and is important
in erythropoiesis and membrane biogenesis. It is a
flexible, rope-like molecule composed of two subunits,
alpha and beta, which consist of many spectrin-type
repeats. Alpha and beta spectrin associate to form
heterodimers and tetramers; spectrin tetramer formation
is critical for red cell shape and deformability.
Defects in alpha spectrin have been associated with
inherited hemolytic anemias including hereditary
spherocytosis (HSp), hereditary elliptocytosis (HE),
and hereditary pyropoikilocytosis (HPP). Alpha spectrin
contains a middle SH3 domain and a C-terminal EF-hand
binding motif in addition to multiple spectrin repeats.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 39.8 bits (93), Expect = 6e-06
Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
V+ +DY K + V +++G+ L L+ +NKDWW+V + + +VPA+YV+
Sbjct: 1 CVVALYDYQEKSPREVSMKKGDILTLLNSSNKDWWKV-EVNDRQGFVPAAYVK 52
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
Tyrosine Kinases. The Tec (Tyrosine kinase expressed
in hepatocellular carcinoma) subfamily is composed of
Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and
similar proteins. They are cytoplasmic (or nonreceptor)
tyr kinases containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. Most Tec subfamily members (except Rlk)
also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. In addition, some
members contain the Tec homology (TH) domain, which
contains proline-rich and zinc-binding regions. Tec
kinases are expressed mainly by haematopoietic cells,
although Tec and Bmx are also found in endothelial
cells. B-cells express Btk and Tec, while T-cells
express Itk, Txk, and Tec. Collectively, Tec kinases
are expressed in a variety of myeloid cells such as
mast cells, platelets, macrophages, and dendritic
cells. Each Tec kinase shows a distinct cell-type
pattern of expression. The function of Tec kinases in
lymphoid cells have been studied extensively. They play
important roles in the development, differentiation,
maturation, regulation, survival, and function of
B-cells and T-cells. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 38.4 bits (90), Expect = 2e-05
Identities = 11/48 (22%), Positives = 28/48 (58%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+D+ + + +++GE+ ++ +N+ WW+ +G Y+P++YV
Sbjct: 6 YDFQPIEPGDLPLEKGEEYVVLDDSNEHWWRARDKNGNEGYIPSNYVT 53
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
and similar proteins. Sorting nexins (SNXs) are Phox
homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNXs differ from each
other in their lipid-binding specificity, subcellular
localization and specific function in the endocytic
pathway. This subfamily consists of SH3 domain
containing SNXs including SNX9, SNX18, SNX33, and
similar proteins. SNX9 is localized to plasma membrane
endocytic sites and acts primarily in clathrin-mediated
endocytosis, while SNX18 is localized to peripheral
endosomal structures, and acts in a trafficking pathway
that is clathrin-independent but relies on AP-1 and
PACS1. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 38.5 bits (90), Expect = 2e-05
Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
+ LYDFD + ++ GE L + ++ D W + S G+ P+SYVE+
Sbjct: 3 RALYDFDSQPSGE--LSLRAGEVLTITRQDVGDGWLEGRNSRGEVGLFPSSYVEI 55
>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor
proteins. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2 (also called Nckbeta or
Growth factor receptor-bound protein 4, Grb4), which
show partly overlapping functions but also bind
distinct targets. Their SH3 domains are involved in
recruiting downstream effector molecules, such as the
N-WASP/Arp2/3 complex, which when activated induces
actin polymerization that results in the production of
pedestals, or protrusions of the plasma membrane. The
first SH3 domain of Nck proteins preferentially binds
the PxxDY sequence, which is present in the CD3e
cytoplasmic tail. This binding inhibits phosphorylation
by Src kinases, resulting in the downregulation of TCR
surface expression. SH3 domains are protein interaction
domains that usually bind to proline-rich ligands with
moderate affinity and selectivity, preferentially a
PxxP motif. They play versatile and diverse roles in
the cell including the regulation of enzymes, changing
the subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 51
Score = 37.8 bits (88), Expect = 4e-05
Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
V+ +DY+ + + + I++ EKL L+ + K WW+V SS + YVP++YV
Sbjct: 2 VVAKYDYTAQGDQELSIKKNEKLTLLDDS-KHWWKVQNSSNQTGYVPSNYV 51
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine
N-methyltransferase 2. PRMT2, also called HRMT1L1,
belongs to the arginine methyltransferase protein
family. It functions as a coactivator to both estrogen
receptor alpha (ER-alpha) and androgen receptor (AR),
presumably through arginine methylation. The ER-alpha
transcription factor is involved in cell proliferation,
differentiation, morphogenesis, and apoptosis, and is
also implicated in the development and progression of
breast cancer. PRMT2 and its variants are upregulated
in breast cancer cells and may be involved in
modulating the ER-alpha signaling pathway during
formation of breast cancer. PRMT2 also plays a role in
regulating the function of E2F transcription factors,
which are critical cell cycle regulators, by binding to
the retinoblastoma gene product (RB). It contains an
N-terminal SH3 domain and an AdoMet binding domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 37.4 bits (87), Expect = 5e-05
Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
D+ D + + G+KL +++K + DWW +G Y+PAS++
Sbjct: 7 DFVATDDSQLSFESGDKLLVLRKPSVDWWWA-EHNGCCGYIPASHL 51
>gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding
Protein 17. Formin Binding Protein 17 (FBP17), also
called FormiN Binding Protein 1 (FNBP1), is involved in
dynamin-mediated endocytosis. It is recruited to
clathrin-coated pits late in the endocytosis process
and may play a role in the invagination and scission
steps. FBP17 binds in vivo to tankyrase, a protein
involved in telomere maintenance and mitogen activated
protein kinase (MAPK) signaling. It contains an
N-terminal F-BAR (FES-CIP4 Homology and
Bin/Amphiphysin/Rvs) domain, a Cdc42-binding HR1
domain, and a C-terminal SH3 domain. The SH3 domain of
the related protein, CIP4, associates with Gapex-5, a
Rab31 GEF. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 36.5 bits (84), Expect = 1e-04
Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEVY 63
T K LY F+ ++ + + EGE L++I++ D W ++ R+ + YVP SY+EVY
Sbjct: 2 TCKALYPFE--GQNEGTISVAEGEMLYVIEEDKGDGWTRIRRNEDEEGYVPTSYIEVY 57
>gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding
Protein 1-Like. FormiN Binding Protein 1-Like
(FNBP1L), also known as Toca-1 (Transducer of
Cdc42-dependent actin assembly), forms a complex with
neural Wiskott-Aldrich syndrome protein (N-WASP). The
FNBP1L/N-WASP complex induces the formation of
filopodia and endocytic vesicles. FNBP1L is required
for Cdc42-induced actin assembly and is essential for
autophagy of intracellular pathogens. It contains an
N-terminal F-BAR domain, a central Cdc42-binding HR1
domain, and a C-terminal SH3 domain. The SH3 domain of
the related protein, CIP4, associates with Gapex-5, a
Rab31 GEF. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 36.5 bits (84), Expect = 1e-04
Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
K LY FD + +G ++EGE L++I++ D W + + +G+ YVP SY+E+
Sbjct: 4 KALYPFD-GSNEGTLA-MKEGEVLYIIEEDKGDGWTRARKQNGEEGYVPTSYIEI 56
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity
signaling protein Sho1p. Sho1p (or Sho1), also called
SSU81 (Suppressor of SUA8-1 mutation), is a yeast
membrane protein that regulates adaptation to high salt
conditions by activating the HOG (high-osmolarity
glycerol) pathway. High salt concentrations lead to the
localization to the membrane of the MAPKK Pbs2, which
is then activated by the MAPKK Ste11 and in turn,
activates the MAPK Hog1. Pbs2 is localized to the
membrane though the interaction of its PxxP motif with
the SH3 domain of Sho1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 36.2 bits (84), Expect = 2e-04
Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+ LY +D S D + ++GE + + T+ WWQ +S+G+ P++Y+++
Sbjct: 1 RARALYPYDASPDDPNELSFEKGE-ILEVSDTSGKWWQARKSNGETGICPSNYLQL 55
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like
Protein Tyrosine Kinases. Src subfamily members
include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes,
and Brk. Src (or c-Src) proteins are cytoplasmic (or
non-receptor) PTKs which are anchored to the plasma
membrane. They contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). However,
Brk lacks the N-terminal myristoylation sites. Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. They were identified as the first
proto-oncogene products, and they regulate cell
adhesion, invasion, and motility in cancer cells, and
tumor vasculature, contributing to cancer progression
and metastasis. Src kinases are overexpressed in a
variety of human cancers, making them attractive
targets for therapy. They are also implicated in acute
inflammatory responses and osteoclast function. Src,
Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
Hck, Fgr, Lyn, and Brk show a limited expression
pattern. This subfamily also includes Drosophila
Src42A, Src oncogene at 42A (also known as Dsrc41)
which accumulates at sites of cell-cell or cell-matrix
adhesion, and participates in Drosphila development and
wound healing. It has been shown to promote tube
elongation in the tracheal system, is essential for
proper cell-cell matching during dorsal closure, and
regulates cell-cell contacts in developing Drosophila
eyes. The SH3 domain of Src kinases contributes to
substrate recruitment by binding adaptor
proteins/substrates, and regulation of kinase activity
through an intramolecular interaction. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 36.0 bits (84), Expect = 2e-04
Identities = 16/50 (32%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASY 59
LYD++ T D + ++G++L ++ ++ DWW S+GK Y+P++Y
Sbjct: 5 LYDYEARTDDD--LSFKKGDRLQILDDSDGDWWLARHLSTGKEGYIPSNY 52
>gnl|CDD|212812 cd11879, SH3_Bem1p_2, Second Src Homology 3 domain of Bud
emergence protein 1 and similar domains. Members of
this subfamily bear similarity to Saccharomyces
cerevisiae Bem1p, containing two Src Homology 3 (SH3)
domains at the N-terminus, a central PX domain, and a
C-terminal PB1 domain. Bem1p is a scaffolding protein
that is critical for proper Cdc42p activation during
bud formation in yeast. During budding and mating,
Bem1p migrates to the plasma membrane where it can
serve as an adaptor for Cdc42p and some other proteins.
Bem1p also functions as an effector of the G1 cyclin
Cln3p and the cyclin-dependent kinase Cdc28p in
promoting vacuolar fusion. SH3 domains bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs; they play a
role in the regulation of enzymes by intramolecular
interactions, changing the subcellular localization of
signal pathway components and mediate multiprotein
complex assemblies.
Length = 56
Score = 36.2 bits (84), Expect = 2e-04
Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 4/55 (7%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQV--IRSSGKPFYVPASYVEV 62
VLYDF D + + G+ + + +N +W+ I G P +P S+VE+
Sbjct: 4 VLYDFKAERPD--ELDAKAGDAIIICAHSNYEWFVAKPIGRLGGPGLIPVSFVEI 56
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox
subunit of NADPH oxidase and similar domains. This
family is composed of the tandem SH3 domains of p47phox
subunit of NADPH oxidase and Nox Organizing protein 1
(NoxO1), the four SH3 domains of Tks4 (Tyr kinase
substrate with four SH3 domains), the five SH3 domains
of Tks5, the SH3 domain of obscurin, Myosin-I, and
similar domains. Most members of this group also
contain Phox homology (PX) domains, except for obscurin
and Myosin-I. p47phox and NoxO1 are regulators of the
phagocytic NADPH oxidase complex (also called Nox2 or
gp91phox) and nonphagocytic NADPH oxidase Nox1,
respectively. They play roles in the activation of
their respective NADPH oxidase, which catalyzes the
transfer of electrons from NADPH to molecular oxygen to
form superoxide. Tks proteins are Src substrates and
scaffolding proteins that play important roles in the
formation of podosomes and invadopodia, the dynamic
actin-rich structures that are related to cell
migration and cancer cell invasion. Obscurin is a giant
muscle protein that plays important roles in the
organization and assembly of the myofibril and the
sarcoplasmic reticulum. Type I myosins (Myosin-I) are
actin-dependent motors in endocytic actin structures
and actin patches. They play roles in membrane traffic
in endocytic and secretory pathways, cell motility, and
mechanosensing. Myosin-I contains an N-terminal
actin-activated ATPase, a phospholipid-binding TH1
(tail homology 1) domain, and a C-terminal extension
which includes an F-actin-binding TH2 domain, an SH3
domain, and an acidic peptide that participates in
activating the Arp2/3complex. The SH3 domain of
myosin-I is required for myosin-I-induced actin
polymerization. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 36.1 bits (84), Expect = 2e-04
Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ D++ D + +QEGE + +++K + WW V R K +VPASY+E
Sbjct: 4 AIADYEAQGDDE--ISLQEGEVVEVLEKNDSGWWYV-RKGDKEGWVPASYLE 52
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10
Regulator of Kinase adaptor proteins. CRK adaptor
proteins consists of SH2 and SH3 domains, which bind
tyrosine-phosphorylated peptides and proline-rich
motifs, respectively. They function downstream of
protein tyrosine kinases in many signaling pathways
started by various extracellular signals, including
growth and differentiation factors. Cellular CRK
(c-CRK) contains a single SH2 domain, followed by
N-terminal and C-terminal SH3 domains. It is involved
in the regulation of many cellular processes including
cell growth, motility, adhesion, and apoptosis. CRK has
been implicated in the malignancy of various human
cancers. The N-terminal SH3 domain of CRK binds a
number of target proteins including DOCK180, C3G, SOS,
and cABL. The CRK family includes two alternatively
spliced protein forms, CRKI and CRKII, that are
expressed by the CRK gene, and the CRK-like (CRKL)
protein, which is expressed by a distinct gene (CRKL).
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 35.4 bits (82), Expect = 3e-04
Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
++ L+DF + D + + ++GE L +I+K + WW S GK +P YVE
Sbjct: 2 YVRALFDFPGN--DDEDLPFKKGEILTVIRKPEEQWWNARNSEGKTGMIPVPYVE 54
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast
stimulating factor 1. OSTF1, also named OSF or SH3P2,
is a signaling protein containing SH3 and
ankyrin-repeat domains. It acts through a Src-related
pathway to enhance the formation of osteoclasts and
bone resorption. It also acts as a negative regulator
of cell motility. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 35.4 bits (82), Expect = 3e-04
Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ LYD++ D +EG+ L++ K++ +WW+ GK +P++YVE
Sbjct: 3 RALYDYEAQHPDELS--FEEGDLLYISDKSDPNWWKA-TCGGKTGLIPSNYVE 52
>gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of
Interleukin-2-inducible T-cell Kinase. ITK (also known
as Tsk or Emt) is a cytoplasmic (or nonreceptor) tyr
kinase containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. It also contains an N-terminal
pleckstrin homology (PH) domain, which binds the
products of PI3K and allows membrane recruitment and
activation, and the Tec homology (TH) domain, which
contains proline-rich and zinc-binding regions. ITK is
expressed in T-cells and mast cells, and is important
in their development and differentiation. Of the three
Tec kinases expressed in T-cells, ITK plays the
predominant role in T-cell receptor (TCR) signaling. It
is activated by phosphorylation upon TCR crosslinking
and is involved in the pathway resulting in
phospholipase C-gamma1 activation and actin
polymerization. It also plays a role in the downstream
signaling of the T-cell costimulatory receptor CD28,
the T-cell surface receptor CD2, and the chemokine
receptor CXCR4. In addition, ITK is crucial for the
development of T-helper(Th)2 effector responses. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 35.4 bits (81), Expect = 4e-04
Identities = 16/51 (31%), Positives = 29/51 (56%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
V+ +DY T D + + ++ E+ L+ + WW+V +G YVP+SY+
Sbjct: 3 VIALYDYQTNDPQELALRYNEEYHLLDSSEIHWWRVQDKNGHEGYVPSSYL 53
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
and related proteins. This subfamily includes
cortactin, Abp1 (actin-binding protein 1),
hematopoietic lineage cell-specific protein 1 (HS1),
and similar proteins. These proteins are involved in
regulating actin dynamics through direct or indirect
interaction with the Arp2/3 complex, which is required
to initiate actin polymerization. They all contain at
least one C-terminal SH3 domain. Cortactin and HS1 bind
Arp2/3 and actin through an N-terminal region that
contains an acidic domain and several copies of a
repeat domain found in cortactin and HS1. Abp1 binds
actin via an N-terminal actin-depolymerizing factor
(ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
through two acidic domains. Mammalian Abp1 does not
directly interact with Arp2/3; instead, it regulates
actin dynamics indirectly by interacting with dynamin
and WASP family proteins. The C-terminal region of
these proteins acts as an adaptor or scaffold that can
connect membrane trafficking and signaling proteins
that bind the SH3 domain within the actin network. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 35.0 bits (81), Expect = 5e-04
Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
K LYD Y + + EG+ + I++ ++ WW + + G+ PA+YVE
Sbjct: 3 KALYD--YQAAEDNEISFVEGDIITQIEQIDEGWWLGVNAKGQKGLFPANYVE 53
>gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of
Cdc42-Interacting Protein 4, Bzz1 and similar domains.
This subfamily is composed of Cdc42-Interacting Protein
4 (CIP4) and similar proteins such as Formin Binding
Protein 17 (FBP17) and FormiN Binding Protein 1-Like
(FNBP1L), as well as yeast Bzz1 (or Bzz1p). CIP4 and
FNBP1L are Cdc42 effectors that bind Wiskott-Aldrich
syndrome protein (WASP) and function in endocytosis.
CIP4 and FBP17 bind to the Fas ligand and may be
implicated in the inflammatory response. CIP4 may also
play a role in phagocytosis. Bzz1 is also a
WASP/Las17-interacting protein involved in endocytosis
and trafficking to the vacuole. It physically interacts
with type I myosins and functions in the early steps of
endocytosis. Members of this subfamily contain an
N-terminal F-BAR (FES-CIP4 Homology and
Bin/Amphiphysin/Rvs) domain as well as at least one
C-terminal SH3 domain. Bzz1 contains a second SH3
domain at the C-terminus. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 34.9 bits (80), Expect = 6e-04
Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
K LY F S++ + + EGEKL L+++ D W +V R +G+ YVP SY+ +
Sbjct: 3 KALYAFVGSSEG--TISMTEGEKLSLVEEDKGDGWTRVRRDTGEEGYVPTSYIRI 55
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk
Protein Tyrosine Kinases. Fyn and Yrk (Yes-related
kinase) are members of the Src subfamily of proteins,
which are cytoplasmic (or non-receptor) PTKs. Fyn,
together with Lck, plays a critical role in T-cell
signal transduction by phosphorylating ITAM
(immunoreceptor tyr activation motif) sequences on
T-cell receptors, ultimately leading to the
proliferation and differentiation of T-cells. In
addition, Fyn is involved in the myelination of
neurons, and is implicated in Alzheimer's and
Parkinson's diseases. Yrk has been detected only in
chickens. It is primarily found in neuronal and
epithelial cells and in macrophages. It may play a role
in inflammation and in response to injury. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 34.6 bits (79), Expect = 6e-04
Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
LYD++ T+D + +GEK ++ + DWW+ ++G+ Y+P++YV
Sbjct: 6 LYDYEARTEDD--LSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYV 54
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine
Kinase. Yes (or c-Yes) is a member of the Src
subfamily of proteins, which are cytoplasmic (or
non-receptor) PTKs. c-Yes kinase is the cellular
homolog of the oncogenic protein (v-Yes) encoded by the
Yamaguchi 73 and Esh sarcoma viruses. It displays
functional overlap with other Src subfamily members,
particularly Src. It also shows some unique functions
such as binding to occludins, transmembrane proteins
that regulate extracellular interactions in tight
junctions. Yes also associates with a number of
proteins in different cell types that Src does not
interact with, like JAK2 and gp130 in pre-adipocytes,
and Pyk2 in treated pulmonary vein endothelial cells.
Although the biological function of Yes remains
unclear, it appears to have a role in regulating
cell-cell interactions and vesicle trafficking in
polarized cells. Src kinases contain an N-terminal SH4
domain with a myristoylation site, followed by SH3 and
SH2 domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 34.6 bits (79), Expect = 6e-04
Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
LYD++ T + + ++GE+ +I T DWW+ ++GK Y+P++YV
Sbjct: 6 LYDYEARTTED--LSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYV 54
>gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor
protein. Nck2 (also called Nckbeta or Growth factor
receptor-bound protein 4, Grb4) plays a crucial role in
connecting signaling pathways of tyrosine kinase
receptors and important effectors in actin dynamics and
cytoskeletal remodeling. It binds neuronal signaling
proteins such as ephrinB and Disabled-1 (Dab-1)
exclusively. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2, which show partly
overlapping functions but also bind distinct targets.
The first SH3 domain of Nck2 binds the PxxDY sequence
in the CD3e cytoplasmic tail; this binding inhibits
phosphorylation by Src kinases, resulting in the
downregulation of TCR surface expression. SH3 domains
are protein interaction domains that usually bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially a PxxP motif. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 34.7 bits (79), Expect = 6e-04
Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 1/52 (1%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
V+ +DY+ + + + I++ E+L+L+ + K WW+V ++ + YVP++YVE
Sbjct: 6 VIAKWDYTAQQDQELDIKKNERLWLLDDS-KTWWRVRNAANRTGYVPSNYVE 56
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine
Kinase. Src (or c-Src) is a cytoplasmic (or
non-receptor) PTK and is the vertebrate homolog of the
oncogenic protein (v-Src) from Rous sarcoma virus.
Together with other Src subfamily proteins, it is
involved in signaling pathways that regulate cytokine
and growth factor responses, cytoskeleton dynamics,
cell proliferation, survival, and differentiation. Src
also play a role in regulating cell adhesion, invasion,
and motility in cancer cells, and tumor vasculature,
contributing to cancer progression and metastasis.
Elevated levels of Src kinase activity have been
reported in a variety of human cancers. Several
inhibitors of Src have been developed as anti-cancer
drugs. Src is also implicated in acute inflammatory
responses and osteoclast function. Src kinases contain
an N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 34.3 bits (78), Expect = 8e-04
Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
+DY ++ + ++GE+L ++ T DWW ++G+ Y+P++YV
Sbjct: 6 YDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYV 53
>gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor
protein. Nck1 (also called Nckalpha) plays a crucial
role in connecting signaling pathways of tyrosine
kinase receptors and important effectors in actin
dynamics and cytoskeletal remodeling. It binds and
activates RasGAP, resulting in the downregulation of
Ras. It is also involved in the signaling of
endothilin-mediated inhibition of cell migration. Nck
adaptor proteins regulate actin cytoskeleton dynamics
by linking proline-rich effector molecules to protein
tyrosine kinases and phosphorylated signaling
intermediates. They contain three SH3 domains and a
C-terminal SH2 domain. They function downstream of the
PDGFbeta receptor and are involved in Rho GTPase
signaling and actin dynamics. Vertebrates contain two
Nck adaptor proteins: Nck1 (also called Nckalpha) and
Nck2, which show partly overlapping functions but also
bind distinct targets. The first SH3 domain of Nck1
binds the PxxDY sequence in the CD3e cytoplasmic tail;
this binding inhibits phosphorylation by Src kinases,
resulting in the downregulation of TCR surface
expression. SH3 domains are protein interaction domains
that usually bind to proline-rich ligands with moderate
affinity and selectivity, preferentially a PxxP motif.
They play versatile and diverse roles in the cell
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 59
Score = 34.3 bits (78), Expect = 8e-04
Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 1/52 (1%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
V+ FDY + + + I++ E+L+L+ + K WW+V + K +VP++YVE
Sbjct: 5 VVAKFDYVAQQDQELDIKKNERLWLLDDS-KSWWRVRNAMNKTGFVPSNYVE 55
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and
similar domains. Bzz1 (or Bzz1p) is a
WASP/Las17-interacting protein involved in endocytosis
and trafficking to the vacuole. It physically interacts
with type I myosins and functions in the early steps of
endocytosis. Together with other proteins, it induces
membrane scission in yeast. Bzz1 contains an N-terminal
F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
central coiled-coil, and two C-terminal SH3 domains.
This model represents the first C-terminal SH3 domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 34.1 bits (79), Expect = 9e-04
Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVEV 62
KVLYD+ S D V I EGE++ +++ + W +R SG+ VP SY+E+
Sbjct: 3 KVLYDYTASGDD--EVSISEGEEVTVLEPDDGSGWTKVRNGSGEEGLVPTSYIEI 55
>gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33.
SNX33 interacts with Wiskott-Aldrich syndrome protein
(WASP) and plays a role in the maintenance of cell
shape and cell cycle progression. It modulates the
shedding and endocytosis of cellular prion protein
(PrP(c)) and amyloid precursor protein (APP). SNXs are
Phox homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNX33 also contains
BAR and SH3 domains. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 33.4 bits (76), Expect = 0.002
Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
+ LY F K+ + IQE E+L + + + D W Q S G+ PASYVE+
Sbjct: 3 RALYSFQSENKE--EINIQENEELVIFSENSLDGWLQGQNSRGETGLFPASYVEI 55
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
expressed in hepatocellular carcinoma). Tec is a
cytoplasmic (or nonreceptor) tyr kinase containing Src
homology protein interaction domains (SH3, SH2)
N-terminal to the catalytic tyr kinase domain. It also
contains an N-terminal pleckstrin homology (PH) domain,
which binds the products of PI3K and allows membrane
recruitment and activation, and the Tec homology (TH)
domain, which contains proline-rich and zinc-binding
regions. It is more widely-expressed than other Tec
subfamily kinases. Tec is found in endothelial cells,
both B- and T-cells, and a variety of myeloid cells
including mast cells, erythroid cells, platelets,
macrophages and neutrophils. Tec is a key component of
T-cell receptor (TCR) signaling, and is important in
TCR-stimulated proliferation, IL-2 production and
phospholipase C-gamma1 activation. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 33.6 bits (77), Expect = 0.002
Identities = 13/47 (27%), Positives = 28/47 (59%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
+D+ + +R++ GE+ +++K + WW+ GK Y+P++YV
Sbjct: 7 YDFQPTEPHDLRLETGEEYVILEKNDVHWWKARDKYGKEGYIPSNYV 53
>gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor
Proteins. SLAPs are adaptor proteins with limited
similarity to Src family tyrosine kinases. They contain
an N-terminal SH3 domain followed by an SH2 domain, and
a unique C-terminal sequence. They function in
regulating the signaling, ubiquitination, and
trafficking of T-cell receptor (TCR) and B-cell
receptor (BCR) components. Vertebrates contain two
SLAPs, named SLAP (or SLA1) and SLAP2 (or SLA2). SLAP
has been shown to interact with the EphA receptor,
EpoR, Lck, PDGFR, Syk, CD79a, among others, while SLAP2
interacts with CSF1R. Both SLAPs interact with c-Cbl,
LAT, CD247, and Zap70. SLAP modulates TCR surface
expression levels as well as surface and total BCR
levels. As an adaptor to c-Cbl, SLAP increases the
ubiquitination, intracellular retention, and targeted
degradation of the BCR complex components. SLAP2 plays
a role in c-Cbl-dependent regulation of CSF1R, a
tyrosine kinase important for myeloid cell growth and
differentiation. The SH3 domain of SLAP forms a complex
with v-Abl. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 32.9 bits (75), Expect = 0.003
Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 4/55 (7%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
TL L D Y + + ++ GE L ++ DWW+V+ +G+ Y+P+ +V
Sbjct: 1 TLVALGD--YPSGGPAELSLRLGEPLTIVSD-EGDWWKVLSEVTGRESYIPSVHV 52
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal
peroxisomal membrane protein Pex13p. Pex13p, located
in the peroxisomal membrane, contains two transmembrane
regions and a C-terminal SH3 domain. It binds to the
peroxisomal targeting type I (PTS1) receptor Pex5p and
the docking factor Pex14p through its SH3 domain. It is
essential for both PTS1 and PTS2 protein import
pathways into the peroxisomal matrix. Pex13p binds
Pex14p, which contains a PxxP motif, in a classical
fashion to the proline-rich ligand binding site of its
SH3 domain. It binds the WxxxF/Y motif of Pex5p in a
novel site that does not compete with Pex14p binding.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 60
Score = 33.0 bits (76), Expect = 0.003
Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 6/59 (10%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNK-----DWWQVIRSSGKPFYVPASYVEV 62
+ LYDF + +++G+ + ++ KT+ +WW+ G+ + P++YVEV
Sbjct: 3 RALYDF-TPENPEMELSLKKGDIVAVLSKTDPLGRDSEWWKGRTRDGRIGWFPSNYVEV 60
>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase
Activating Proteins 1, 2, and 3. srGAP1, also called
Rho GTPase-Activating Protein 13 (ARHGAP13), is a
Cdc42- and RhoA-specific GAP and is expressed later in
the development of central nervous system tissues.
srGAP2 is expressed in zones of neuronal
differentiation. It plays a role in the regeneration of
neurons and axons. srGAP3, also called MEGAP (MEntal
disorder associated GTPase-Activating Protein), is a
Rho GAP with activity towards Rac1 and Cdc42. It
impacts cell migration by regulating actin and
microtubule cytoskeletal dynamics. The association
between srGAP3 haploinsufficiency and mental
retardation is under debate. srGAPs are Rho GAPs that
interact with Robo1, the transmembrane receptor of Slit
proteins. Slit proteins are secreted proteins that
control axon guidance and the migration of neurons and
leukocytes. srGAPs contain an N-terminal F-BAR domain,
a Rho GAP domain, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 32.6 bits (74), Expect = 0.003
Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
FDY + + + ++G L L + + DWW+ R +G VP Y+ V
Sbjct: 6 FDYVGRSARELSFKKGASLLLYHRASDDWWEG-RHNGIDGLVPHQYIVV 53
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3
domain of Fungal Actin-binding protein 1. Abp1 is an
adaptor protein that functions in receptor-mediated
endocytosis and vesicle trafficking. It contains an
N-terminal actin-binding module, the
actin-depolymerizing factor (ADF) homology domain, a
central proline-rich region, and a C-terminal SH3
domain (many yeast Abp1 proteins contain two C-terminal
SH3 domains). Yeast Abp1 also contains two acidic
domains that bind directly to the Arp2/3 complex, which
is required to initiate actin polymerization. The SH3
domain of yeast Abp1 binds and localizes the kinases,
Ark1p and Prk1p, which facilitate actin patch
disassembly following vesicle internalization. It also
mediates the localization to the actin patch of the
synaptojanin-like protein, Sjl2p, which plays a key
role in endocytosis. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 32.8 bits (75), Expect = 0.003
Identities = 15/49 (30%), Positives = 27/49 (55%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+DY + + + EGE + I+ ++DWW S G+ P++YVE+
Sbjct: 6 YDYEKDEDNEIELVEGEIVTNIEMVDEDWWMGTNSKGESGLFPSNYVEL 54
>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine
kinase. BTK is a cytoplasmic (or nonreceptor) tyr
kinase containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. It also contains an N-terminal
pleckstrin homology (PH) domain, which binds the
products of PI3K and allows membrane recruitment and
activation, and the Tec homology (TH) domain with
proline-rich and zinc-binding regions. Btk is expressed
in B-cells, and a variety of myeloid cells including
mast cells, platelets, neutrophils, and dendrictic
cells. It interacts with a variety of partners, from
cytosolic proteins to nuclear transcription factors,
suggesting a diversity of functions. Stimulation of a
diverse array of cell surface receptors, including
antigen engagement of the B-cell receptor (BCR), leads
to PH-mediated membrane translocation of Btk and
subsequent phosphorylation by Src kinase and
activation. Btk plays an important role in the life
cycle of B-cells including their development,
differentiation, proliferation, survival, and
apoptosis. Mutations in Btk cause the primary
immunodeficiency disease, X-linked agammaglobulinaemia
(XLA) in humans. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 32.5 bits (74), Expect = 0.005
Identities = 14/52 (26%), Positives = 36/52 (69%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
KV+ +DY+ + + +++++GE+ +++++N WW+ +G+ Y+P++YV
Sbjct: 2 KVVALYDYTPMNAQDLQLRKGEEYVILEESNLPWWRARDKNGREGYIPSNYV 53
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 32.0 bits (73), Expect = 0.008
Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 8/58 (13%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR------SSGKPFYVPASY 59
K LYD Y + + IQE + L+L++K++ DWW+V VPA+Y
Sbjct: 2 YKALYD--YEPQTEDELTIQEDDILYLLEKSDDDWWKVKLKVNSSDDDEPVGLVPATY 57
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated
guanine nucleotide Exchange Factor 2. ASEF2, also
called Spermatogenesis-associated protein 13 (SPATA13),
is a GEF that localizes with actin at the leading edge
of cells and is important in cell migration and
adhesion dynamics. GEFs activate small GTPases by
exchanging bound GDP for free GTP. ASEF2 can activate
both Rac 1 and Cdc42, but only Rac1 activation is
necessary for increased cell migration and adhesion
turnover. Together with APC (adenomatous polyposis
coli) and Neurabin2, a scaffold protein that binds
F-actin, it is involved in regulating HGF-induced cell
migration. ASEF2 contains a SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 54
Score = 31.6 bits (71), Expect = 0.008
Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+D+ T D + + + G+ + +++ +NKDWW R+ + + PAS+V +
Sbjct: 7 WDHVTMDDQELAFKAGDVIRVLEASNKDWWWG-RNEDREAWFPASFVRL 54
>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine
kinase substrate (Tks) proteins. Tks proteins are Src
substrates and scaffolding proteins that play important
roles in the formation of podosomes and invadopodia,
the dynamic actin-rich structures that are related to
cell migration and cancer cell invasion. Vertebrates
contain two Tks proteins, Tks4 (Tyr kinase substrate
with four SH3 domains) and Tks5 (Tyr kinase substrate
with five SH3 domains), which display partially
overlapping but non-redundant functions. Both associate
with the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. Tks5
interacts with N-WASP and Nck, while Tks4 is essential
for the localization of MT1-MMP (membrane-type 1 matrix
metalloproteinase) to invadopodia. Tks proteins contain
an N-terminal Phox homology (PX) domain and four or
five SH3 domains. This model characterizes the third
SH3 domain of Tks proteins. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 30.9 bits (70), Expect = 0.014
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+F + +DG + Q+G+K+ +I K WW V + GK + P+SY+E
Sbjct: 7 EFQATIQDG--ISFQKGQKVEVIDKNPSGWWYV-KIDGKEGWAPSSYIE 52
>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin,
also called Sorbin and SH3 domain containing 3
(Sorbs3). Vinexin is also called Sorbs3, SH3P3, and
SH3-containing adapter molecule 1 (SCAM-1). It is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. Vinexin was first identified as
a vinculin binding protein; it is co-localized with
vinculin at cell-ECM and cell-cell adhesion sites.
There are several splice variants of vinexin: alpha,
which contains the SoHo and three SH3 domains and
displays tissue-specific expression; and beta, which
contains only the three SH3 domains and is widely
expressed. Vinexin alpha stimulates the accumulation of
F-actin at focal contact sites. Vinexin also promotes
keratinocyte migration and wound healing. The SH3
domains of vinexin have been reported to bind a number
of ligands including vinculin, WAVE2, DLG5, Abl, and
Cbl. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 31.1 bits (70), Expect = 0.016
Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 3/50 (6%)
Query: 16 YSTKDGKYVRI--QEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
Y+ K V + ++GE + LI+K N++W++ I +G+ PASYV+V
Sbjct: 7 YTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQV 56
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide
Synthase TRaffic INducer. Nostrin is expressed in
endothelial and epithelial cells and is involved in the
regulation, trafficking and targeting of endothelial
NOS (eNOS). It facilitates the endocytosis of eNOS by
coordinating the functions of dynamin and the
Wiskott-Aldrich syndrome protein (WASP). Increased
expression of Nostrin may be correlated to
preeclampsia. Nostrin contains an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 30.8 bits (70), Expect = 0.020
Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%)
Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+ Y+ + +Q G+ + + +K + WW +GK PA+YVE
Sbjct: 5 LYSYTANREDELSLQPGDIIEVHEKQDDGWWLG-ELNGKKGIFPATYVEE 53
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin
(or Nephrocystin-1). Nephrocystin contains an SH3
domain involved in signaling pathways that regulate
cell adhesion and cytoskeletal organization. It is a
protein that in humans is associated with juvenile
nephronophthisis, an inherited kidney disease
characterized by renal fibrosis that lead to chronic
renal failure in children. It is localized in cell-cell
junctions in renal duct cells, and is known to interact
with Ack1, an activated Cdc42-associated kinase. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 30.7 bits (70), Expect = 0.021
Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
L DF + ++GE L +I K WW S G VP +Y++V
Sbjct: 4 ALSDFQAEQEGDLSF--KKGEVLRIISKRADGWWLAENSKGNRGLVPKTYLKV 54
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
Kinase. Blk is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
It is expressed specifically in B-cells and is involved
in pre-BCR (B-cell receptor) signaling. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 30.6 bits (69), Expect = 0.021
Identities = 15/49 (30%), Positives = 34/49 (69%), Gaps = 4/49 (8%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRS--SGKPFYVPASYV 60
+D+ + + +++++GEKL ++K + +WW + +S +GK Y+P++YV
Sbjct: 6 YDFVPSNERDLQLKKGEKLQVLKS-DGEWW-LAKSLTTGKEGYIPSNYV 52
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase.
CSK is a cytoplasmic (or nonreceptor) tyr kinase
containing the Src homology domains, SH3 and SH2,
N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that
are anchored to the plasma membrane. To inhibit Src
kinases, CSK is translocated to the membrane via
binding to specific transmembrane proteins, G-proteins,
or adaptor proteins near the membrane. CSK catalyzes
the tyr phosphorylation of the regulatory C-terminal
tail of Src kinases, resulting in their inactivation.
It is expressed in a wide variety of tissues and plays
a role, as a regulator of Src, in cell proliferation,
survival, and differentiation, and consequently, in
cancer development and progression. In addition, CSK
also shows Src-independent functions. It is a critical
component in G-protein signaling, and plays a role in
cytoskeletal reorganization and cell migration. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 30.3 bits (69), Expect = 0.025
Identities = 11/51 (21%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
++++ + + ++G+ L ++ T KD W++ G+ +PA+YV+
Sbjct: 8 YNFNGASEEDLPFKKGDILTIVAVT-KDPNWYKAKNKDGREGMIPANYVQK 57
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor
proteins. This group contains the third SH3 domain of
Nck, the first SH3 domain of Caenorhabditis elegans
Ced-2 (Cell death abnormality protein 2), and similar
domains. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2 (also called Nckbeta or
Growth factor receptor-bound protein 4, Grb4), which
show partly overlapping functions but also bind
distinct targets. Their SH3 domains are involved in
recruiting downstream effector molecules, such as the
N-WASP/Arp2/3 complex, which when activated induces
actin polymerization that results in the production of
pedestals, or protrusions of the plasma membrane. The
third SH3 domain of Nck appears to prefer ligands with
a PxAPxR motif. SH3 domains are protein interaction
domains that usually bind to proline-rich ligands with
moderate affinity and selectivity, preferentially a
PxxP motif. Ced-2 is a cell corpse engulfment protein
that interacts with Ced-5 in a pathway that regulates
the activation of Ced-10, a Rac small GTPase.
Length = 56
Score = 30.4 bits (69), Expect = 0.026
Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKT--NKDWWQVIRSSGKPFYVPASYVEV 62
LY F + + ++GE+L +I+K + DWW+ + G VP +YVEV
Sbjct: 5 LYPFTGENDEE--LSFEKGERLEIIEKPEDDPDWWKARNALGTTGLVPRNYVEV 56
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated
guanine nucleotide Exchange Factor. ASEF, also called
ARHGEF4, exists in an autoinhibited form and is
activated upon binding of the tumor suppressor APC
(adenomatous polyposis coli). GEFs activate small
GTPases by exchanging bound GDP for free GTP. ASEF can
activate Rac1 or Cdc42. Truncated ASEF, which is found
in colorectal cancers, is constitutively active and has
been shown to promote angiogenesis and cancer cell
migration. ASEF contains a SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains. In its autoinhibited
form, the SH3 domain of ASEF forms an extensive
interface with the DH and PH domains, blocking the Rac
binding site. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 73
Score = 30.8 bits (69), Expect = 0.027
Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 5/51 (9%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWW--QVIRSSGKPFYVPASYVEV 62
+D+ T D + + + G+ + ++ TNK+WW +V+ S G + PAS+V +
Sbjct: 24 WDHVTMDDQELGFKAGDVIEVMDATNKEWWWGRVLDSEG---WFPASFVRL 71
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of
the p67phox subunit of NADPH oxidase and similar
proteins. This subfamily is composed of p67phox, NADPH
oxidase activator 1 (Noxa1), and similar proteins.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), and Noxa1 are homologs and are the cytosolic
subunits of the phagocytic (Nox2) and nonphagocytic
(Nox1) NADPH oxidase complexes, respectively. NADPH
oxidase catalyzes the transfer of electrons from NADPH
to oxygen during phagocytosis forming superoxide and
reactive oxygen species. p67phox and Noxa1 play
regulatory roles. p67phox contains N-terminal TPR,
first SH3 (or N-terminal or central SH3), PB1, and
C-terminal SH3 domains. Noxa1 has a similar domain
architecture except it is lacking the N-terminal SH3
domain. The TPR domain of both binds activated
GTP-bound Rac, while the C-terminal SH3 domain of
p67phox and Noxa1 binds the polyproline motif found at
the C-terminus of p47phox and Noxo1, respectively. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 29.8 bits (67), Expect = 0.039
Identities = 10/53 (18%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+V+ Y + + + +EG+ + ++ + N+ W + S G+ P +V
Sbjct: 1 QVVALHRYEAQGPEDLGFREGDTIDVLSEVNEAWLEG-HSDGRVGIFPKCFVV 52
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine
kinase substrate with four SH3 domains. Tks4, also
called SH3 and PX domain-containing protein 2B
(SH3PXD2B) or HOFI, is a Src substrate and scaffolding
protein that plays an important role in the formation
of podosomes and invadopodia, the dynamic actin-rich
structures that are related to cell migration and
cancer cell invasion. It is required in the formation
of functional podosomes, EGF-induced membrane ruffling,
and lamellipodia generation. It plays an important role
in cellular attachment and cell spreading. Tks4 is
essential for the localization of MT1-MMP
(membrane-type 1 matrix metalloproteinase) to
invadopodia. It contains an N-terminal Phox homology
(PX) domain and four SH3 domains. This model
characterizes the second SH3 domain of Tks4. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 30.0 bits (67), Expect = 0.043
Identities = 15/48 (31%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ Y+ +D + +++G + +I+K + WW+ IR GK + PASY++
Sbjct: 7 YPYTARDQDEINLEKGAVVEVIQKNLEGWWK-IRYQGKEGWAPASYLK 53
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and
SH3 domain containing 1 (Sorbs1), also called ponsin.
Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
associated protein). It is an adaptor protein
containing one sorbin homology (SoHo) and three SH3
domains. It binds Cbl and plays a major role in
regulating the insulin signaling pathway by enhancing
insulin-induced phosphorylation of Cbl. Sorbs1, like
vinexin, localizes at cell-ECM and cell-cell adhesion
sites where it binds vinculin, paxillin, and afadin. It
may function in the control of cell motility. Other
interaction partners of Sorbs1 include c-Abl, Sos,
flotillin, Grb4, ataxin-7, filamin C, among others. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 29.5 bits (66), Expect = 0.051
Identities = 12/49 (24%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
FD+ + K + +Q+G+ +++ K+ +++W++ G+ P SY+E+
Sbjct: 7 FDFKAQTLKELPLQKGDIVYIYKQIDQNWYEG-EHHGRVGIFPRSYIEL 54
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor
proteins. Abl interactor (Abi) proteins are adaptor
proteins serving as binding partners and substrates of
Abl tyrosine kinases. They are involved in regulating
actin cytoskeletal reorganization and play important
roles in membrane-ruffling, endocytosis, cell motility,
and cell migration. They localize to sites of actin
polymerization in epithelial adherens junction and
immune synapses, as well as to the leading edge of
lamellipodia. Vertebrates contain two Abi proteins,
Abi1 and Abi2. Abi1 displays a wide expression pattern
while Abi2 is highly expressed in the eye and brain.
Abi proteins contain a homeobox homology domain, a
proline-rich region, and a SH3 domain. The SH3 domain
of Abi binds to a PxxP motif in Abl. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 29.6 bits (67), Expect = 0.052
Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
KV+ +DY+ + QEG+ +++ KK + W++ + +G P +YVE
Sbjct: 1 KVVALYDYTADKDDELSFQEGDIIYVTKKNDDGWYEGV-LNGVTGLFPGNYVE 52
>gnl|CDD|227013 COG4667, COG4667, Predicted esterase of the alpha-beta hydrolase
superfamily [General function prediction only].
Length = 292
Score = 31.2 bits (71), Expect = 0.061
Identities = 18/72 (25%), Positives = 28/72 (38%), Gaps = 8/72 (11%)
Query: 24 VRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVEVYKKLSNGNRNNVENINPTME 82
Q+GE ++ +W VIR SS PFY + L G I+ ++
Sbjct: 124 TCRQDGEAVYYFLPDVFNWLDVIRASSAIPFYSEGVEINGKNYLDGG-------ISDSIP 176
Query: 83 KTRSYSEGNDKV 94
+ G DK+
Sbjct: 177 VKEAIRLGADKI 188
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan
Actin-binding protein 1. Abp1, also called
drebrin-like protein, is an adaptor protein that
functions in receptor-mediated endocytosis and vesicle
trafficking. It contains an N-terminal actin-binding
module, the actin-depolymerizing factor (ADF) homology
domain, a helical domain, and a C-terminal SH3 domain.
Mammalian Abp1, unlike yeast Abp1, does not contain an
acidic domain that interacts with the Arp2/3 complex.
It regulates actin dynamics indirectly by interacting
with dynamin and WASP family proteins. Abp1 deficiency
causes abnormal organ structure and function of the
spleen, heart, and lung of mice. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 54
Score = 29.3 bits (66), Expect = 0.064
Identities = 13/48 (27%), Positives = 23/48 (47%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+DY D + G+ + I++ ++ WW+ G PA+YVE
Sbjct: 6 YDYQAADDTEISFDPGDIITDIEQIDEGWWRGTGPDGTYGLFPANYVE 53
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of
Proline-Serine-Threonine Phosphatase-Interacting
Protein 1. PSTPIP1, also called CD2 Binding Protein 1
(CD2BP1), is mainly expressed in hematopoietic cells.
It is a binding partner of the cell surface receptor
CD2 and PTP-PEST, a tyrosine phosphatase which
functions in cell motility and Rac1 regulation. It also
plays a role in the activation of the Wiskott-Aldrich
syndrome protein (WASP), which couples actin
rearrangement and T cell activation. Mutations in the
gene encoding PSTPIP1 cause the autoinflammatory
disorder known as PAPA (pyogenic sterile arthritis,
pyoderma gangrenosum, and acne) syndrome. PSTPIP1
contains an N-terminal F-BAR domain, PEST motifs, and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 29.3 bits (66), Expect = 0.073
Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+DY+ ++ + I +G+ + +I+K WW V R+ K VP +Y+E
Sbjct: 6 YDYTAQEDDELSISKGDVVAVIEKGEDGWWTVERNGQKGL-VPGTYLE 52
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
GRB2-related adaptor protein. GRAP is a GRB-2 like
adaptor protein that is highly expressed in lymphoid
tissues. It acts as a negative regulator of T cell
receptor (TCR)-induced lymphocyte proliferation by
downregulating the signaling to the Ras/ERK pathway. It
has been identified as a regulator of TGFbeta signaling
in diabetic kidney tubules and may have a role in the
pathogenesis of the disease. GRAP contains an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. The C-terminal SH3 domains
(SH3c) of the related proteins, GRB2 and GRAP2, have
been shown to bind to classical PxxP motif ligands, as
well as to non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 29.0 bits (65), Expect = 0.075
Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
+D+S +D + + G+ + ++ + +WW+ R SG+ + P +YV
Sbjct: 6 YDFSAEDPSQLSFRRGDIIEVLDCPDPNWWRG-RISGRVGFFPRNYV 51
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein,
Palmitoylated 5 (or MAGUK p55 subfamily member 5).
MPP5, also called PALS1 (Protein associated with Lin7)
or Nagie oko protein in zebrafish or Stardust in
Drosophila, is a scaffolding protein which associates
with Crumbs homolog 1 (CRB1), CRB2, or CRB3 through its
PDZ domain and with PALS1-associated tight junction
protein (PATJ) or multi-PDZ domain protein 1 (MUPP1)
through its L27 domain. The resulting tri-protein
complexes are core proteins of the Crumb complex, which
localizes at tight junctions or subapical regions, and
is involved in the maintenance of apical-basal polarity
in epithelial cells and the morphogenesis and function
of photoreceptor cells. MPP5 is critical for the proper
stratification of the retina and is also expressed in T
lymphocytes where it is important for TCR-mediated
activation of NFkB. Drosophila Stardust exists in
several isoforms, some of which show opposing functions
in photoreceptor cells, which suggests that the
relative ratio of different Crumbs complexes regulates
photoreceptor homeostasis. MPP5 contains two L27
domains followed by the core of three domains
characteristic of MAGUK (membrane-associated guanylate
kinase) proteins: PDZ, SH3, and guanylate kinase (GuK).
In addition, it also contains the Hook (Protein 4.1
Binding) motif in between the SH3 and GuK domains. The
GuK domain in MAGUK proteins is enzymatically inactive;
instead, the domain mediates protein-protein
interactions and associates intramolecularly with the
SH3 domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 63
Score = 29.3 bits (66), Expect = 0.083
Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 7/42 (16%)
Query: 14 FDYSTKDGKYV-------RIQEGEKLFLIKKTNKDWWQVIRS 48
FDY +D Y+ Q+G+ L +I + + +WWQ R
Sbjct: 6 FDYDPEDDPYIPCRELGLSFQKGDILHVISQEDPNWWQAYRE 47
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper
integration site-1 (AHI-1). AHI-1, also called
Jouberin, is expressed in high levels in the brain,
gonad tissues, and skeletal muscle. It is an adaptor
protein that interacts with the small GTPase Rab8a and
regulates it distribution and function, affecting
cilium formation and vesicle transport. Mutations in
the AHI-1 gene can cause Joubert syndrome, a disorder
characterized by brainstem malformations, cerebellar
aplasia/hypoplasia, and retinal dystrophy. AHI-1
variation is also associated with susceptibility to
schizophrenia and type 2 diabetes mellitus progression.
AHI-1 contains WD40 and SH3 domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 29.0 bits (65), Expect = 0.086
Identities = 14/47 (29%), Positives = 25/47 (53%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
+DY+ + I G+ + ++ K N +WW +G+ Y PA+YV
Sbjct: 6 YDYTANRSDELTIHRGDIIRVLYKDNDNWWFGSLVNGQQGYFPANYV 52
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
Growth factor receptor-bound protein 2 (GRB2) and
related proteins. This family includes the adaptor
protein GRB2 and related proteins including Drosophila
melanogaster Downstream of receptor kinase (DRK),
Caenorhabditis elegans Sex muscle abnormal protein 5
(Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
and similar proteins. Family members contain an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. GRAP2 plays
an important role in T cell receptor (TCR) signaling by
promoting the formation of the SLP-76:LAT complex,
which couples the TCR to the Ras pathway. GRAP acts as
a negative regulator of T cell receptor (TCR)-induced
lymphocyte proliferation by downregulating the
signaling to the Ras/ERK pathway. The C-terminal SH3
domains (SH3c) of GRB2 and GRAP2 have been shown to
bind to classical PxxP motif ligands, as well as to
non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 28.7 bits (65), Expect = 0.088
Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 3/52 (5%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
LYDF+ + G+ + + G+ + ++ ++ DWW+ G+ PA+YV+
Sbjct: 5 LYDFN-PQEPGE-LEFRRGDIITVLDSSDPDWWKG-ELRGRVGIFPANYVQP 53
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like
Rho guanine nucleotide exchange factors. Members of
this family contain a SH3 domain followed by RhoGEF
(also called Dbl-homologous or DH) and Pleckstrin
Homology (PH) domains. They include the Rho guanine
nucleotide exchange factors ARHGEF9, ASEF (also called
ARHGEF4), ASEF2, and similar proteins. GEFs activate
small GTPases by exchanging bound GDP for free GTP.
ARHGEF9 specifically activates Cdc42, while both ASEF
and ASEF2 can activate Rac1 and Cdc42. ARHGEF9 is
highly expressed in the brain and it interacts with
gephyrin, a postsynaptic protein associated with GABA
and glycine receptors. ASEF plays a role in
angiogenesis and cell migration. ASEF2 is important in
cell migration and adhesion dynamics. ASEF exists in an
autoinhibited form and is activated upon binding of the
tumor suppressor APC (adenomatous polyposis coli),
leading to the activation of Rac1 or Cdc42. In its
autoinhibited form, the SH3 domain of ASEF forms an
extensive interface with the DH and PH domains,
blocking the Rac binding site. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 28.9 bits (65), Expect = 0.11
Identities = 12/49 (24%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+D+ T D + + + G+ + ++ ++KDWW + + PAS+V +
Sbjct: 6 WDHVTMDPEELGFKAGDVIEVLDMSDKDWWWG-SIRDEEGWFPASFVRL 53
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and
SH3 domain protein 1. Lasp1 is a cytoplasmic protein
that binds focal adhesion proteins and is involved in
cell signaling, migration, and proliferation. It is
overexpressed in several cancer cells including breast,
ovarian, bladder, and liver. In cancer cells, it can be
found in the nucleus; its degree of nuclear
localization correlates with tumor size and poor
prognosis. Lasp1 is a 36kD protein containing an
N-terminal LIM domain, two nebulin repeats, and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 59
Score = 28.8 bits (64), Expect = 0.12
Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDW-WQVIRSSGKPFYVPASYVE 61
+DY+ D V Q+G+ + +++ + W + + +G +PA+YVE
Sbjct: 9 YDYNAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVE 57
>gnl|CDD|212943 cd12010, SH3_SLAP, Src homology 3 domain of Src-Like Adaptor
Protein. SLAP (or SLA1) modulates TCR surface
expression levels as well as surface and total BCR
levels. As an adaptor to c-Cbl, SLAP increases the
ubiquitination, intracellular retention, and targeted
degradation of the BCR complex components. SLAP has
been shown to interact with the EphA receptor, EpoR,
Lck, PDGFR, Syk, CD79a, c-Cbl, LAT, CD247, and Zap70,
among others. SLAPs are adaptor proteins with limited
similarity to Src family tyrosine kinases. They contain
an N-terminal SH3 domain followed by an SH2 domain, and
a unique C-terminal sequence. The SH3 domain of SLAP
forms a complex with v-Abl. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 28.6 bits (64), Expect = 0.13
Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
L VL D Y + D GEKL ++ WW+V +G+ Y+P V
Sbjct: 1 FLAVLAD--YPSPDISEPIFHMGEKLRVLSD-EGGWWKVRSLQTGRENYIPGKCV 52
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase
Activating Protein 4. srGAP4, also called ARHGAP4, is
highly expressed in hematopoietic cells and may play a
role in lymphocyte differentiation. It is able to
stimulate the GTPase activity of Rac1, Cdc42, and RhoA.
In the nervous system, srGAP4 has been detected in
differentiating neurites and may be involved in axon
and dendritic growth. srGAPs are Rho GAPs that interact
with Robo1, the transmembrane receptor of Slit
proteins. Slit proteins are secreted proteins that
control axon guidance and the migration of neurons and
leukocytes. srGAPs contain an N-terminal F-BAR domain,
a Rho GAP domain, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 28.7 bits (64), Expect = 0.14
Identities = 10/31 (32%), Positives = 18/31 (58%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
FDY+ + + + + G+ L L K + DWW+
Sbjct: 8 FDYTGRTAQELSFKRGDVLLLHSKASSDWWR 38
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth
factor receptor kinase substrate 8 and similar
proteins. This group is composed of Eps8 and Eps8-like
proteins including Eps8-like 1-3, among others. These
proteins contain N-terminal Phosphotyrosine-binding
(PTB), central SH3, and C-terminal effector domains.
Eps8 binds either Abi1 (also called E3b1) or Rab5
GTPase activating protein RN-tre through its SH3
domain. With Abi1 and Sos1, it becomes part of a
trimeric complex that is required to activate Rac.
Together with RN-tre, it inhibits the internalization
of EGFR. The SH3 domains of Eps8 and similar proteins
recognize peptides containing a PxxDY motif, instead of
the classical PxxP motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity. They
play versatile and diverse roles in the cell including
the regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 28.4 bits (64), Expect = 0.14
Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVY 63
+VLYDF + ++ K + + +GE L ++ + + WW+V S G+ YVP + +E Y
Sbjct: 3 RVLYDF--TARNSKELSVLKGEYLEVLDDS-RQWWKVRNSRGQVGYVPHNILEPY 54
>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18.
SNX18 is localized to peripheral endosomal structures,
and acts in a trafficking pathway that is
clathrin-independent but relies on AP-1 and PACS1. It
binds FIP5 and is required for apical lumen formation.
It may also play a role in axonal elongation. SNXs are
Phox homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNX18 also contains
BAR and SH3 domains. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 28.4 bits (63), Expect = 0.15
Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
+ LYDF S G+ + ++E E L L + + + W + + S G PASYVEV
Sbjct: 3 RALYDFR-SENPGE-ISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVEV 55
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase
Activating Proteins. Slit-Robo GTPase Activating
Proteins (srGAPs) are Rho GAPs that interact with
Robo1, the transmembrane receptor of Slit proteins.
Slit proteins are secreted proteins that control axon
guidance and the migration of neurons and leukocytes.
Vertebrates contain three isoforms of srGAPs
(srGAP1-3), all of which are expressed during embryonic
and early development in the nervous system but with
different localization and timing. A fourth member has
also been reported (srGAP4, also called ARHGAP4).
srGAPs contain an N-terminal F-BAR domain, a Rho GAP
domain, and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 28.5 bits (64), Expect = 0.15
Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
FDY+ + + + ++G+ L L ++ + DWW+ + +G+ VP Y+
Sbjct: 6 FDYTGRSERELSFKKGDSLTLYRQVSDDWWRG-QLNGQDGLVPHKYI 51
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain
containing ring finger proteins. This model represents
the first SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
POSHER), SH3RF3 (POSH2), and similar domains. Members
of this family are scaffold proteins that function as
E3 ubiquitin-protein ligases. They all contain an
N-terminal RING finger domain and multiple SH3 domains;
SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
has three. SH3RF1 plays a role in calcium homeostasis
through the control of the ubiquitin domain protein
Herp. It may also have a role in regulating death
receptor mediated and JNK mediated apoptosis. SH3RF3
interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3RF2 acts
as an anti-apoptotic regulator of the JNK pathway by
binding to and promoting the degradation of SH3RF1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 28.5 bits (64), Expect = 0.15
Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
K LY+ Y K+ + ++G+ + L K+ +++W+ +GK + PASYV+V
Sbjct: 3 KALYN--YEGKEPGDLSFKKGDIILLRKRIDENWYHG-ECNGKQGFFPASYVQV 53
>gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor
Protein 2. SLAP2 plays a role in c-Cbl-dependent
regulation of CSF1R, a tyrosine kinase important for
myeloid cell growth and differentiation. It has been
shown to interact with CSF1R, c-Cbl, LAT, CD247, and
Zap70. SLAPs are adaptor proteins with limited
similarity to Src family tyrosine kinases. They contain
an N-terminal SH3 domain followed by an SH2 domain, and
a unique C-terminal sequence. They function in
regulating the signaling, ubiquitination, and
trafficking of T-cell receptor (TCR) and B-cell
receptor (BCR) components. The SH3 domain of SLAP forms
a complex with v-Abl. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 28.6 bits (64), Expect = 0.15
Identities = 13/36 (36%), Positives = 26/36 (72%), Gaps = 2/36 (5%)
Query: 26 IQEGEKLFLIKKTNKDWWQVIRS-SGKPFYVPASYV 60
I+ GE+L ++ + + DWW+V + +G+ Y+P++YV
Sbjct: 18 IRMGEQLTILSE-DGDWWKVSSAVTGRECYIPSNYV 52
>gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding
protein 4. SH3 domain-binding protein 4 (SH3BP4) is
also called transferrin receptor trafficking protein
(TTP). SH3BP4 is an endocytic accessory protein that
interacts with endocytic proteins including clathrin
and dynamin, and regulates the internalization of the
transferrin receptor (TfR). SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 28.1 bits (62), Expect = 0.17
Identities = 11/47 (23%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
DY + ++ +G+ L+++ + +WW ++ + Y+P+SYV+
Sbjct: 7 DYCPTNFTTLKFSKGDHLYVLDTSGGEWWYA-HNTTEMGYIPSSYVQ 52
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2.
Abi2 is highly expressed in the brain and eye. It
regulates actin cytoskeletal reorganization at adherens
junctions and dendritic spines, which is important in
cell morphogenesis, migration, and cognitive function.
Mice deficient with Abi2 show defects in orientation
and migration of lens fibers, neuronal migration,
dendritic spine morphology, as well as deficits in
learning and memory. Abi proteins are adaptor proteins
serving as binding partners and substrates of Abl
tyrosine kinases. They are involved in regulating actin
cytoskeletal reorganization and play important roles in
membrane-ruffling, endocytosis, cell motility, and cell
migration. Abi proteins contain a homeobox homology
domain, a proline-rich region, and a SH3 domain. The
SH3 domain of Abi binds to a PxxP motif in Abl. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 61
Score = 28.1 bits (62), Expect = 0.20
Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
KV+ +DY+ + QEG +++IKK + W++ + +G P +YVE
Sbjct: 4 KVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVM-NGVTGLFPGNYVE 55
>gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3
domain of the p67phox subunit of NADPH oxidase.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox) which
plays a crucial role in the cellular response to
bacterial infection. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p67phox plays a regulatory role and contains
N-terminal TPR, first SH3 (or N-terminal or central
SH3), PB1, and C-terminal SH3 domains. It binds, via
its C-terminal SH3 domain, to a proline-rich region of
p47phox and upon activation, this complex assembles
with flavocytochrome b558, the Nox2-p22phox
heterodimer. Concurrently, RacGTP translocates to the
membrane and interacts with the TPR domain of p67phox,
which leads to the activation of NADPH oxidase. The PB1
domain of p67phox binds to its partner PB1 domain in
p40phox, and this facilitates the assembly of
p47phox-p67phox at the membrane. The N-terminal SH3
domain increases the affinity of p67phox for the
oxidase complex. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 27.9 bits (62), Expect = 0.21
Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 3/53 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+VLY+F TK+ +++ G +F++KK +W V+ +GK VP +++E
Sbjct: 3 RVLYEFVPETKE--ELQVLPGNIVFVLKKGTDNWATVV-FNGKKGLVPCNFLE 52
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3
domain of the p67phox subunit of NADPH oxidase.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox) which
plays a crucial role in the cellular response to
bacterial infection. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p67phox plays a regulatory role and contains
N-terminal TPR, first SH3 (or N-terminal or central
SH3), PB1, and C-terminal SH3 domains. It binds, via
its C-terminal SH3 domain, to a proline-rich region of
p47phox and upon activation, this complex assembles
with flavocytochrome b558, the Nox2-p22phox
heterodimer. Concurrently, RacGTP translocates to the
membrane and interacts with the TPR domain of p67phox,
which leads to the activation of NADPH oxidase. The PB1
domain of p67phox binds to its partner PB1 domain in
p40phox, and this facilitates the assembly of
p47phox-p67phox at the membrane. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 27.8 bits (62), Expect = 0.21
Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+V+ F Y + + Q+G+ + ++ K N+DW + + GK P+++VE
Sbjct: 1 QVVALFSYEASQPEDLEFQKGDVILVLSKVNEDWLEG-QCKGKIGIFPSAFVE 52
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1.
Abi1, also called e3B1, is a central regulator of actin
cytoskeletal reorganization through interactions with
many protein complexes. It is part of WAVE, a
nucleation-promoting factor complex, that links Rac 1
activation to actin polymerization causing lamellipodia
protrusion at the plasma membrane. Abi1 interact with
formins to promote protrusions at the leading edge of
motile cells. It also is a target of alpha4 integrin,
regulating membrane protrusions at sites of integrin
engagement. Abi proteins are adaptor proteins serving
as binding partners and substrates of Abl tyrosine
kinases. They are involved in regulating actin
cytoskeletal reorganization and play important roles in
membrane-ruffling, endocytosis, cell motility, and cell
migration. Abi proteins contain a homeobox homology
domain, a proline-rich region, and a SH3 domain. The
SH3 domain of Abi binds to a PxxP motif in Abl. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 59
Score = 28.1 bits (62), Expect = 0.22
Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
KV+ +DYS + EG +++IKK + W++ + +G P +YVE
Sbjct: 1 KVVAIYDYSKDKDDELSFMEGAIIYVIKKNDDGWYEGV-CNGVTGLFPGNYVE 52
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor
protein. Nck2 (also called Nckbeta or Growth factor
receptor-bound protein 4, Grb4) plays a crucial role in
connecting signaling pathways of tyrosine kinase
receptors and important effectors in actin dynamics and
cytoskeletal remodeling. It binds neuronal signaling
proteins such as ephrinB and Disabled-1 (Dab-1)
exclusively. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2, which show partly
overlapping functions but also bind distinct targets.
The third SH3 domain of Nck appears to prefer ligands
with a PxAPxR motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially a PxxP motif. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 59
Score = 28.1 bits (62), Expect = 0.25
Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
++ LY F T++ + ++GE + +I+K D WW+ S G+ VP +YV V
Sbjct: 3 VQTLYPFSSVTEE--ELNFEKGETMEVIEKPENDPEWWKCKNSRGQVGLVPKNYVVV 57
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain. SH3 (Src homology 3)
domains are often indicative of a protein involved in
signal transduction related to cytoskeletal
organisation. First described in the Src cytoplasmic
tyrosine kinase. The structure is a partly opened beta
barrel.
Length = 53
Score = 27.8 bits (63), Expect = 0.27
Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
FDY D + +++G+ + ++ K + WW+ R G+ VP+SYVE
Sbjct: 6 FDYVATDPNELSLKKGDVVKVLDKDDNGWWEGER-GGRRGLVPSSYVEE 53
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I
fungal Myosins. Type I myosins (myosin-I) are
actin-dependent motors in endocytic actin structures
and actin patches. They play roles in membrane traffic
in endocytic and secretory pathways, cell motility, and
mechanosensing. Saccharomyces cerevisiae has two
myosins-I, Myo3 and Myo5, which are involved in
endocytosis and the polarization of the actin
cytoskeleton. Myosin-I contains an N-terminal
actin-activated ATPase, a phospholipid-binding TH1
(tail homology 1) domain, and a C-terminal extension
which includes an F-actin-binding TH2 domain, an SH3
domain, and an acidic peptide that participates in
activating the Arp2/3complex. The SH3 domain of
myosin-I is required for myosin-I-induced actin
polymerization. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 27.7 bits (62), Expect = 0.29
Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSG-KPFYVPASYVE 61
T K LYDF S + + +++ + +++++K + WW + K +VPA+Y+E
Sbjct: 1 TYKALYDFAGSVANE--LSLKKDDIVYIVQKEDNGWWLAKKLDESKEGWVPAAYLE 54
>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor
protein. Nck1 (also called Nckalpha) plays a crucial
role in connecting signaling pathways of tyrosine
kinase receptors and important effectors in actin
dynamics and cytoskeletal remodeling. It binds and
activates RasGAP, resulting in the downregulation of
Ras. It is also involved in the signaling of
endothilin-mediated inhibition of cell migration. Nck
adaptor proteins regulate actin cytoskeleton dynamics
by linking proline-rich effector molecules to protein
tyrosine kinases and phosphorylated signaling
intermediates. They contain three SH3 domains and a
C-terminal SH2 domain. They function downstream of the
PDGFbeta receptor and are involved in Rho GTPase
signaling and actin dynamics. Vertebrates contain two
Nck adaptor proteins: Nck1 (also called Nckalpha) and
Nck2, which show partly overlapping functions but also
bind distinct targets. The third SH3 domain of Nck
appears to prefer ligands with a PxAPxR motif. SH3
domains are protein interaction domains that usually
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially a PxxP motif. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 27.7 bits (61), Expect = 0.31
Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 4/58 (6%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
++ LY F S+ + + + ++GE + +I+K D WW+ +++G+ VP +YV V
Sbjct: 2 VVQALYPF--SSSNDEELNFEKGEVMDVIEKPENDPEWWKCRKANGQVGLVPKNYVTV 57
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain
of NADPH oxidase (Nox) Organizing protein 1. Nox
Organizing protein 1 (NoxO1) is a critical regulator of
enzyme kinetics of the nonphagocytic NADPH oxidase
Nox1, which catalyzes the transfer of electrons from
NADPH to molecular oxygen to form superoxide. Nox1 is
expressed in colon, stomach, uterus, prostate, and
vascular smooth muscle cells. NoxO1 is involved in
targeting activator subunits (such as NoxA1) to Nox1.
It is co-localized with Nox1 in the membranes of
resting cells and directs the subcellular localization
of Nox1. NoxO1 contains an N-terminal Phox homology
(PX) domain, tandem SH3 domains (N-SH3 and C-SH3), and
a C-terminal proline-rich region (PRR). This model
characterizes the second SH3 domain (or C-SH3) of
NoxO1. The tandem SH3 domains of NoxO1 interact with
the PRR of p22phox, which also complexes with Nox1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 27.3 bits (61), Expect = 0.35
Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Query: 16 YSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
Y + + + G + +++K++ WW +IR +G+ YVP+ Y
Sbjct: 8 YEAQKEDELSVPAGVVVEVLQKSDNGWW-LIRYNGRAGYVPSMY 50
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating
of p53 proteins (ASPP). The ASPP family of proteins
bind to important regulators of apoptosis (p53, Bcl-2,
and RelA) and cell growth (APCL, PP1). They share
similarity at their C-termini, where they harbor a
proline-rich region, four ankyrin (ANK) repeats, and an
SH3 domain. Vertebrates contain three members of the
family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2
activate the apoptotic function of the p53 family of
tumor suppressors (p53, p63, and p73), while iASPP is
an oncoprotein that specifically inhibits p53-induced
apoptosis. The expression of ASPP proteins is altered
in tumors; ASPP1 and ASPP2 are downregulated whereas
iASPP is upregulated is some cancer types. ASPP
proteins also bind and regulate protein phosphatase 1
(PP1), and this binding is competitive with p53
binding. The SH3 domain and the ANK repeats of ASPP
contribute to the p53 binding site; they bind to the
DNA binding domain of p53. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 27.3 bits (61), Expect = 0.36
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTN---KDWWQVIRSSGKPFYVPASY 59
FDY ++G + +EG++L +++K + +WW R + K YVP +
Sbjct: 7 FDYEAENGDELSFREGDELTVLRKGDDDETEWWWA-RLNDKEGYVPRNL 54
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin,
also called Sorbin and SH3 domain containing 3
(Sorbs3). Vinexin is also called Sorbs3, SH3P3, and
SH3-containing adapter molecule 1 (SCAM-1). It is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. Vinexin was first identified as
a vinculin binding protein; it is co-localized with
vinculin at cell-ECM and cell-cell adhesion sites.
There are several splice variants of vinexin: alpha,
which contains the SoHo and three SH3 domains and
displays tissue-specific expression; and beta, which
contains only the three SH3 domains and is widely
expressed. Vinexin alpha stimulates the accumulation of
F-actin at focal contact sites. Vinexin also promotes
keratinocyte migration and wound healing. The SH3
domains of vinexin have been reported to bind a number
of ligands including vinculin, WAVE2, DLG5, Abl, and
Cbl. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 27.2 bits (60), Expect = 0.39
Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
FD+ + K + +Q+G+ +++ K+ +K+W + G+ PA+YVEV
Sbjct: 7 FDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG-EHHGRVGIFPANYVEV 54
>gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3
domain of the p47phox subunit of NADPH oxidase, also
called Neutrophil Cytosolic Factor 1. p47phox, or
NCF1, is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox), which
plays a key role in the ability of phagocytes to defend
against bacterial infections. NADPH oxidase catalyzes
the transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p47phox is required for activation of NADH
oxidase and plays a role in translocation. It contains
an N-terminal Phox homology (PX) domain, tandem SH3
domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
region, and a C-terminal proline-rich region (PRR).
This model characterizes the second SH3 domain (or
C-SH3) of p47phox. In its inactive state, the tandem
SH3 domains interact intramolecularly with the
autoinhibitory region; upon activation, the tandem SH3
domains are exposed through a conformational change,
resulting in their binding to the PRR of p22phox and
the activation of NADPH oxidase. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 27.1 bits (60), Expect = 0.39
Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
Y+ + + + EGE + +I K WW V+R Y P+ Y++
Sbjct: 7 AYTAVEEDELTLLEGEAIEVIHKLLDGWW-VVRKGEVTGYFPSMYLQ 52
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox
subunit of NADPH oxidase. p40phox, also called
Neutrophil cytosol factor 4 (NCF-4), is a cytosolic
subunit of the phagocytic NADPH oxidase complex (also
called Nox2 or gp91phox) which plays a crucial role in
the cellular response to bacterial infection. NADPH
oxidase catalyzes the transfer of electrons from NADPH
to oxygen during phagocytosis forming superoxide and
reactive oxygen species. p40phox positively regulates
NADPH oxidase in both phosphatidylinositol-3-phosphate
(PI3P)-dependent and PI3P-independent manner. It
contains an N-terminal PX domain, a central SH3 domain,
and a C-terminal PB1 domain that interacts with
p67phox. The SH3 domain of p40phox binds to canonical
polyproline and noncanonical motifs at the C-terminus
of p47phox. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 27.1 bits (60), Expect = 0.42
Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
FD++ + + G+ +FL+ + NKDW + +R + F P S+V++
Sbjct: 6 FDFTGNSKLELNFKAGDVIFLLSRVNKDWLEGTVRGATGIF--PLSFVKI 53
>gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the first
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 27.4 bits (60), Expect = 0.44
Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+Y ++ + +Q GE + +I+K WW + ++ + +VPA+Y+E
Sbjct: 7 NYEKQENSEISLQAGEVVDVIEKNESGWW-FVSTAEEQGWVPATYLE 52
>gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the second
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 26.9 bits (59), Expect = 0.48
Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
Query: 16 YSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
Y+++ + ++G + +I+K + WW IR GK + PASY++
Sbjct: 9 YTSQGKDEIGFEKGVTVEVIQKNLEGWW-YIRYLGKEGWAPASYLK 53
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 27.0 bits (60), Expect = 0.49
Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
K LYD+D T++ + EG+ L + ++ DW V + + +VPA+Y+
Sbjct: 1 QAKALYDYDKQTEE--ELSFNEGDTLDVYDDSDSDWILVGFNGTQFGFVPANYI 52
>gnl|CDD|212956 cd12023, SH3_NoxO1_1, First or N-terminal Src homology 3 domain
of Nox Organizing protein 1. Nox Organizing protein 1
(NoxO1) is a critical regulator of enzyme kinetics of
the nonphagocytic NADPH oxidase Nox1, which catalyzes
the transfer of electrons from NADPH to molecular
oxygen to form superoxide. Nox1 is expressed in colon,
stomach, uterus, prostate, and vascular smooth muscle
cells. NoxO1 is involved in targeting activator
subunits (such as NoxA1) to Nox1. It is co-localized
with Nox1 in the membranes of resting cells and directs
the subcellular localization of Nox1. NoxO1 contains an
N-terminal Phox homology (PX) domain, tandem SH3
domains (N-SH3 and C-SH3), and a C-terminal
proline-rich region (PRR). This model characterizes the
first SH3 domain (or N-SH3) of NoxO1. The tandem SH3
domains of NoxO1 interact with the PRR of p22phox,
which also complexes with Nox1. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 56
Score = 27.1 bits (60), Expect = 0.51
Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
Query: 15 DYSTKD--GKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ TKD K + E L ++ K WW V + + PA Y+E
Sbjct: 7 PFETKDTKNKPFKAAAQESLDVLLKDPTGWWLVENEDRQIAWFPAPYLE 55
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding
protein Eve-1. Eve-1, also called SH3
domain-containing protein 19 (SH3D19) or EEN-binding
protein (EBP), exists in multiple alternatively spliced
isoforms. The longest isoform contains five SH3 domain
in the C-terminal region and seven proline-rich motifs
in the N-terminal region. It is abundantly expressed in
skeletal muscle and heart, and may be involved in
regulating the activity of ADAMs (A disintegrin and
metalloproteases). Eve-1 interacts with EEN, an
endophilin involved in endocytosis and may be the
target of the MLL-EEN fusion protein that is implicated
in leukemogenesis. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 50
Score = 26.7 bits (59), Expect = 0.58
Identities = 11/49 (22%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
LYDF T++ + Q G+++ + + + +W + R +G+ P ++
Sbjct: 5 LYDFTGETEED--LSFQRGDRILVTEHLDAEWSRG-RLNGREGIFPRAF 50
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine
nucleotide exchange factor ARHGEF9. ARHGEF9, also
called PEM2 or collybistin, selectively activates Cdc42
by exchanging bound GDP for free GTP. It is highly
expressed in the brain and it interacts with gephyrin,
a postsynaptic protein associated with GABA and glycine
receptors. Mutations in the ARHGEF9 gene cause X-linked
mental retardation with associated features like
seizures, hyper-anxiety, aggressive behavior, and
sensory hyperarousal. ARHGEF9 contains a SH3 domain
followed by RhoGEF (also called Dbl-homologous or DH)
and Pleckstrin Homology (PH) domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 62
Score = 27.0 bits (59), Expect = 0.59
Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWW--QVIRSSGKPFYVPASYVEVY 63
+D+ T + + + G+ + ++ +NKDWW Q+ G + PAS+V ++
Sbjct: 11 WDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEG---WFPASFVRLW 59
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain
of VAV3 protein. VAV3 is ubiquitously expressed and
functions as a phosphorylation-dependent guanine
nucleotide exchange factor (GEF) for RhoA, RhoG, and
Rac1. It has been implicated to function in the
hematopoietic, bone, cerebellar, and cardiovascular
systems. VAV3 is essential in axon guidance in neurons
that control blood pressure and respiration. It is
overexpressed in prostate cancer cells and it plays a
role in regulating androgen receptor transcriptional
activity. VAV proteins contain several domains that
enable their function: N-terminal calponin homology
(CH), acidic, RhoGEF (also called Dbl-homologous or
DH), Pleckstrin Homology (PH), C1 (zinc finger), SH2,
and two SH3 domains. The SH3 domain of VAV is involved
in the localization of proteins to specific sites
within the cell, by interacting with proline-rich
sequences within target proteins. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 26.9 bits (59), Expect = 0.60
Identities = 10/48 (20%), Positives = 27/48 (56%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+D+ +D + + + +G+ + + K + + W +G+ + P++YVE
Sbjct: 7 YDFCARDMRELSLLKGDVVKIYTKMSTNGWWRGEVNGRVGWFPSTYVE 54
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
of VAV1 protein. VAV1 is expressed predominantly in
the hematopoietic system and it plays an important role
in the development and activation of B and T cells. It
is activated by tyrosine phosphorylation to function as
a guanine nucleotide exchange factor (GEF) for Rho
GTPases following cell surface receptor activation,
triggering various effects such as cytoskeletal
reorganization, transcription regulation, cell cycle
progression, and calcium mobilization. It also serves
as a scaffold protein and has been shown to interact
with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
gene, ZAP-70, SLP76, and Syk, among others. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The C-terminal SH3 domain of Vav1 interacts
with a wide variety of proteins including cytoskeletal
regulators (zyxin), RNA-binding proteins (Sam68),
transcriptional regulators, viral proteins, and dynamin
2. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 26.8 bits (59), Expect = 0.60
Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
Query: 14 FDYSTKDGKYVRIQEGEKL-FLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+D+ +D + ++EG+ + L KK + WW+ G+ + PA+YVE
Sbjct: 6 YDFCARDRSELSLKEGDIIKILNKKGQQGWWRG-EIYGRVGWFPANYVE 53
>gnl|CDD|219191 pfam06822, DUF1235, Protein of unknown function (DUF1235). This
family contains a number of viral proteins of unknown
function.
Length = 265
Score = 28.1 bits (63), Expect = 0.67
Identities = 8/19 (42%), Positives = 12/19 (63%)
Query: 39 NKDWWQVIRSSGKPFYVPA 57
N +W+ VI S G Y+P+
Sbjct: 190 NGEWYTVITSGGNKLYIPS 208
>gnl|CDD|217151 pfam02624, YcaO, YcaO-like family.
Length = 332
Score = 28.1 bits (63), Expect = 0.71
Identities = 9/24 (37%), Positives = 12/24 (50%), Gaps = 1/24 (4%)
Query: 41 DWWQVIR-SSGKPFYVPASYVEVY 63
+W SG+ YVPA+ V V
Sbjct: 75 EWVPGWDLLSGEEVYVPANLVYVS 98
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and
cysteine-rich domain-containing protein 2 (Stac2).
Stac proteins are putative adaptor proteins that
contain a cysteine-rich C1 domain and one or two SH3
domains at the C-terminus. There are three mammalian
members (Stac1, Stac2, and Stac3) of this family. Stac2
contains a single SH3 domain at the C-terminus unlike
Stac1 and Stac3, which contain two C-terminal SH3
domains. Stac1 and Stac2 have been found to be
expressed differently in mature dorsal root ganglia
(DRG) neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 26.4 bits (58), Expect = 0.73
Identities = 10/36 (27%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
Query: 26 IQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+Q G+++ ++ +N+DWW+ +S + + PA++V+
Sbjct: 18 LQPGDRVMVVDDSNEDWWKG-KSGDRVGFFPANFVQ 52
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of
SH3 and cysteine-rich domain-containing (Stac)
proteins. Stac proteins are putative adaptor proteins
that contain a cysteine-rich C1 domain and one or two
SH3 domains at the C-terminus. There are three
mammalian members (Stac1, Stac2, and Stac3) of this
family. Stac1 and Stac3 contain two SH3 domains while
Stac2 contains a single SH3 domain at the C-terminus.
This model represents the first C-terminal SH3 domain
of Stac1 and Stac3, and the single C-terminal SH3
domain of Stac2. Stac1 and Stac2 have been found to be
expressed differently in mature dorsal root ganglia
(DRG) neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 26.3 bits (58), Expect = 0.83
Identities = 10/34 (29%), Positives = 22/34 (64%), Gaps = 2/34 (5%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
LY F ++ + + ++ G+K+ L+ +N+DWW+
Sbjct: 5 LYKF--KPQENEDLEMRPGDKITLLDDSNEDWWK 36
>gnl|CDD|213011 cd12078, SH3_Tks4_3, Third Src homology 3 domain of Tyrosine
kinase substrate with four SH3 domains. Tks4, also
called SH3 and PX domain-containing protein 2B
(SH3PXD2B) or HOFI, is a Src substrate and scaffolding
protein that plays an important role in the formation
of podosomes and invadopodia, the dynamic actin-rich
structures that are related to cell migration and
cancer cell invasion. It is required in the formation
of functional podosomes, EGF-induced membrane ruffling,
and lamellipodia generation. It plays an important role
in cellular attachment and cell spreading. Tks4 is
essential for the localization of MT1-MMP
(membrane-type 1 matrix metalloproteinase) to
invadopodia. It contains an N-terminal Phox homology
(PX) domain and four SH3 domains. This model
characterizes the third SH3 domain of Tks4. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 26.2 bits (57), Expect = 0.98
Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
DF + DG + Q G K+ +I+K WW I+ K + PA++++
Sbjct: 7 DFQTTIPDG--ISFQAGLKVEVIEKNLSGWW-YIQIEDKEGWAPATFID 52
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein,
Palmitoylated 6 (or MAGUK p55 subfamily member 6).
MPP6, also called Veli-associated MAGUK 1 (VAM-1) or
PALS2, is a scaffolding protein that binds to Veli-1, a
homolog of Caenorhabditis Lin-7. It is one of seven
vertebrate homologs of the Drosophila Stardust protein,
which is required in establishing cell polarity, and it
contains two L27 domains followed by the core of three
domains characteristic of MAGUK (membrane-associated
guanylate kinase) proteins: PDZ, SH3, and guanylate
kinase (GuK). In addition, it also contains the Hook
(Protein 4.1 Binding) motif in between the SH3 and GuK
domains. The GuK domain in MAGUK proteins is
enzymatically inactive; instead, the domain mediates
protein-protein interactions and associates
intramolecularly with the SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 61
Score = 26.2 bits (57), Expect = 1.1
Identities = 8/39 (20%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
Query: 24 VRIQEGEKLFLIKKTNKDWWQV--IRSSGKPFYVPASYV 60
++ +GE L ++ + + +WWQ ++ G +P+ ++
Sbjct: 23 LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFL 61
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie,
If, and similar proteins. Myosins Ie (MyoIe) and If
(MyoIf) are nonmuscle, unconventional, long tailed,
class I myosins containing an N-terminal motor domain
and a myosin tail with TH1, TH2, and SH3 domains. MyoIe
interacts with the endocytic proteins, dynamin and
synaptojanin-1, through its SH3 domain; it may play a
role in clathrin-dependent endocytosis. In the kidney,
MyoIe is critical for podocyte function and normal
glomerular filtration. Mutations in MyoIe is associated
with focal segmental glomerulosclerosis, a disease
characterized by massive proteinuria and progression to
end-stage kidney disease. MyoIf is predominantly
expressed in the immune system; it plays a role in
immune cell motility and innate immunity. Mutations in
MyoIf may be associated with the loss of hearing. The
MyoIf gene has also been found to be fused to the MLL
(Mixed lineage leukemia) gene in infant acute myeloid
leukemias (AML). SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 26.2 bits (58), Expect = 1.1
Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
K LY +D +D + EG+ + ++K+ WW R GK P +YVE
Sbjct: 3 KALYAYD--AQDTDELSFNEGDIIEILKEDPSGWWTG-RLRGKEGLFPGNYVE 52
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and
SH3 domain containing (Sorbs) proteins and similar
domains. This family, also called the vinexin family,
is composed predominantly of adaptor proteins
containing one sorbin homology (SoHo) and three SH3
domains. Members include the second SH3 domains of
Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or
Sorbs3), and similar domains. They are involved in the
regulation of cytoskeletal organization, cell adhesion,
and growth factor signaling. Members of this family
bind multiple partners including signaling molecules
like c-Abl, c-Arg, Sos, and c-Cbl, as well as
cytoskeletal molecules such as vinculin and afadin.
They may have overlapping functions. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 26.2 bits (58), Expect = 1.2
Identities = 11/49 (22%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
++++ G + ++G+ + L ++ +++W++ R G+ P SYV+V
Sbjct: 6 YNFNADTGVELSFRKGDVITLTRRVDENWYEG-RIGGRQGIFPVSYVQV 53
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and
SH3 domain containing 2 (Sorbs2), also called
Arg-binding protein 2 (ArgBP2). Sorbs2 or ArgBP2 is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. It regulates actin-dependent
processes including cell adhesion, morphology, and
migration. It is expressed in many tissues and is
abundant in the heart. Like vinexin, it is found in
focal adhesion where it interacts with vinculin and
afadin. It also localizes in epithelial cell stress
fibers and in cardiac muscle cell Z-discs. Sorbs2 has
been implicated to play roles in the signaling of
c-Arg, Akt, and Pyk2. Other interaction partners of
Sorbs2 include c-Abl, flotillin, spectrin, dynamin 1/2,
synaptojanin, PTP-PEST, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 57
Score = 26.0 bits (57), Expect = 1.3
Identities = 11/50 (22%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
++++ + +++G+++ L+K+ +++W++ I + + P SYVEV
Sbjct: 7 YNFNADTNVELSLRKGDRVVLLKQVDQNWYEGKIPGTNRQGIFPVSYVEV 56
>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called
Resting lymphocyte kinase (Rlk). TXK is a cytoplasmic
(or nonreceptor) tyr kinase containing Src homology
protein interaction domains (SH3, SH2) N-terminal to
the catalytic tyr kinase domain. It also contains an
N-terminal cysteine-rich region. Rlk is expressed in
T-cells and mast cell lines, and is a key component of
T-cell receptor (TCR) signaling. It is important in
TCR-stimulated proliferation, IL-2 production and
phospholipase C-gamma1 activation. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 26.1 bits (57), Expect = 1.3
Identities = 12/55 (21%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
Query: 6 VTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
+ +K LYDF ++ + ++ E+ ++++ + WW+ G +P++YV
Sbjct: 1 IQVKALYDF--LPREPSNLALKRAEEYLILEQYDPHWWKARDRYGNEGLIPSNYV 53
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain
of the Nebulin family of proteins. Nebulin family
proteins contain multiple nebulin repeats, and may
contain an N-terminal LIM domain and/or a C-terminal
SH3 domain. They have molecular weights ranging from 34
to 900 kD, depending on the number of nebulin repeats,
and they all bind actin. They are involved in the
regulation of actin filament architecture and function
as stabilizers and scaffolds for cytoskeletal
structures with which they associate, such as long
actin filaments or focal adhesions. Nebulin family
proteins that contain a C-terminal SH3 domain include
the giant filamentous protein nebulin, nebulette,
Lasp1, and Lasp2. Lasp2, also called LIM-nebulette, is
an alternatively spliced variant of nebulette. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 25.7 bits (57), Expect = 1.3
Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVE 61
+DY+ D V QEG+ + ++ + W + ++ +G+ +PA+YVE
Sbjct: 6 YDYAAADDDEVSFQEGDVIINVEIIDDGWMEGTVQRTGQSGMLPANYVE 54
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of
SH3 and cysteine-rich domain-containing protein 3
(Stac3). Stac proteins are putative adaptor proteins
that contain a cysteine-rich C1 domain and one or two
SH3 domains at the C-terminus. There are three
mammalian members (Stac1, Stac2, and Stac3) of this
family. Stac1 and Stac3 contain two SH3 domains while
Stac2 contains a single SH3 domain at the C-terminus.
Stac1 and Stac2 have been found to be expressed
differently in mature dorsal root ganglia (DRG)
neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 26.0 bits (57), Expect = 1.3
Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
LY F KD + GE++ +I +N++WW+ + K Y P +++
Sbjct: 5 LYRFKALEKDD--LDFHPGERITVIDDSNEEWWRG-KIGEKTGYFPMNFI 51
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and
SH3 domain containing 2 (Sorbs2), also called
Arg-binding protein 2 (ArgBP2). Sorbs2 or ArgBP2 is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. It regulates actin-dependent
processes including cell adhesion, morphology, and
migration. It is expressed in many tissues and is
abundant in the heart. Like vinexin, it is found in
focal adhesion where it interacts with vinculin and
afadin. It also localizes in epithelial cell stress
fibers and in cardiac muscle cell Z-discs. Sorbs2 has
been implicated to play roles in the signaling of
c-Arg, Akt, and Pyk2. Other interaction partners of
Sorbs2 include c-Abl, flotillin, spectrin, dynamin 1/2,
synaptojanin, PTP-PEST, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 25.7 bits (56), Expect = 1.5
Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+ +YDF T K + ++G+ +++++K +++W++ G+ P SYVE
Sbjct: 4 RAVYDFKAQT--SKELSFKKGDTVYILRKIDQNWYEG-EHHGRVGIFPISYVE 53
>gnl|CDD|223368 COG0291, RpmI, Ribosomal protein L35 [Translation, ribosomal
structure and biogenesis].
Length = 65
Score = 25.7 bits (57), Expect = 1.7
Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 4/49 (8%)
Query: 18 TKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVYKKL 66
T GK R G++ L KK+ K R K V + ++ K+L
Sbjct: 17 TGTGKIKRKHAGKRHILTKKSTKR----KRHLRKTAVVSKADLKRVKRL 61
>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain
of the p47phox subunit of NADPH oxidase, also called
Neutrophil Cytosolic Factor 1. p47phox, or NCF1, is a
cytosolic subunit of the phagocytic NADPH oxidase
complex (also called Nox2 or gp91phox), which plays a
key role in the ability of phagocytes to defend against
bacterial infections. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p47phox is required for activation of NADH
oxidase and plays a role in translocation. It contains
an N-terminal Phox homology (PX) domain, tandem SH3
domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
region, and a C-terminal proline-rich region (PRR).
This model characterizes the first SH3 domain (or
N-SH3) of p47phox. In its inactive state, the tandem
SH3 domains interact intramolecularly with the
autoinhibitory region; upon activation, the tandem SH3
domains are exposed through a conformational change,
resulting in their binding to the PRR of p22phox and
the activation of NADPH oxidase. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 25.7 bits (56), Expect = 1.7
Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
DY + ++ G+ + +++K+ WW + K +VPASY+E
Sbjct: 7 DYEKSSKSEMALKTGDVVEVVEKSENGWW-FCQLKAKRGWVPASYLE 52
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3
domain of Fungal Actin-binding protein 1. Abp1 is an
adaptor protein that functions in receptor-mediated
endocytosis and vesicle trafficking. It contains an
N-terminal actin-binding module, the
actin-depolymerizing factor (ADF) homology domain, a
central proline-rich region, and a C-terminal SH3
domain (many yeast Abp1 proteins contain two C-terminal
SH3 domains). Yeast Abp1 also contains two acidic
domains that bind directly to the Arp2/3 complex, which
is required to initiate actin polymerization. The SH3
domain of yeast Abp1 binds and localizes the kinases,
Ark1p and Prk1p, which facilitate actin patch
disassembly following vesicle internalization. It also
mediates the localization to the actin patch of the
synaptojanin-like protein, Sjl2p, which plays a key
role in endocytosis. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 25.6 bits (56), Expect = 1.8
Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 3/55 (5%)
Query: 7 TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
K LYD Y + + E +K+ I+ + DWW + G P++YVE
Sbjct: 1 WAKALYD--YDAAEDNELSFFENDKIINIEFVDDDWW-LGECHGSRGLFPSNYVE 52
>gnl|CDD|212825 cd11892, SH3_MIA2, Src Homology 3 domain of Melanoma Inhibitory
Activity 2 protein. MIA2 is expressed specifically in
hepatocytes and its expression is controlled by
hepatocyte nuclear factor 1 binding sites in the MIA2
promoter. It inhibits the growth and invasion of
hepatocellular carcinomas (HCC) and may act as a tumor
suppressor. A mutation in MIA2 in mice resulted in
reduced cholesterol and triglycerides. Since MIA2
localizes to ER exit sites, it may function as an
ER-to-Golgi trafficking protein that regulates lipid
metabolism. MIA2 contains an N-terminal SH3-like
domain, similar to MIA. It is a member of the recently
identified family that also includes MIA, MIAL, and
MIA3 (also called TANGO). MIA is a single domain
protein that adopts a SH3 domain-like fold; it contains
an additional antiparallel beta sheet and two disulfide
bonds compared to classical SH3 domains. Unlike
classical SH3 domains, MIA does not bind proline-rich
ligands.
Length = 73
Score = 26.0 bits (57), Expect = 1.8
Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 6/52 (11%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKK---TNKDWWQVIRSSGKPF-YVPASYVEV 62
DY D +Y+ ++G+++ + K +D W S+GK F Y P V+V
Sbjct: 19 DYRGPDCRYLSFKKGDEIIVYYKLSGKREDLWA--GSTGKEFGYFPKDAVKV 68
>gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba, and similar
domains. DNMBP or Tuba is a cdc42-specific guanine
nucleotide exchange factor (GEF) that contains four
N-terminal SH3 domains, a central RhoGEF [or Dbl
homology (DH)] domain followed by a Bin/Amphiphysin/Rvs
(BAR) domain, and two C-terminal SH3 domains. It
provides a functional link between dynamin, Rho GTPase
signaling, and actin dynamics. It plays an important
role in regulating cell junction configuration. The
C-terminal SH3 domains of DNMBP bind to N-WASP and
Ena/VASP proteins, which are key regulatory proteins of
the actin cytoskeleton. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 25.5 bits (56), Expect = 2.0
Identities = 9/22 (40%), Positives = 17/22 (77%), Gaps = 1/22 (4%)
Query: 39 NKDWWQVIRSSGKPFYVPASYV 60
NK+WW + ++G+ YVP++Y+
Sbjct: 35 NKEWW-LAEANGQKGYVPSNYI 55
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine
nucleotide exchange factors. This subfamily is
composed of the Saccharomyces cerevisiae guanine
nucleotide exchange factors (GEFs) Sdc25 and Cdc25, and
similar proteins. These GEFs regulate Ras by
stimulating the GDP/GTP exchange on Ras. Cdc25 is
involved in the Ras/PKA pathway that plays an important
role in the regulation of metabolism, stress responses,
and proliferation, depending on available nutrients and
conditions. Proteins in this subfamily contain an
N-terminal SH3 domain as well as REM (Ras exchanger
motif) and RasGEF domains at the C-terminus. SH3
domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 55
Score = 25.3 bits (56), Expect = 2.1
Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 4/44 (9%)
Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ--VIRSSGK 51
LYDF K + + G+ ++++ K WW +I SSGK
Sbjct: 4 ALYDFT--PKSKNQLSFKAGDIIYVLNKDPSGWWDGVIISSSGK 45
>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and
SH3 domain containing 1 (Sorbs1), also called ponsin.
Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
associated protein). It is an adaptor protein
containing one sorbin homology (SoHo) and three SH3
domains. It binds Cbl and plays a major role in
regulating the insulin signaling pathway by enhancing
insulin-induced phosphorylation of Cbl. Sorbs1, like
vinexin, localizes at cell-ECM and cell-cell adhesion
sites where it binds vinculin, paxillin, and afadin. It
may function in the control of cell motility. Other
interaction partners of Sorbs1 include c-Abl, Sos,
flotillin, Grb4, ataxin-7, filamin C, among others. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 25.3 bits (55), Expect = 2.3
Identities = 11/52 (21%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEVYK 64
F+++ + ++GE++ L+++ +++W++ I + + P +YV+V K
Sbjct: 7 FNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIK 58
>gnl|CDD|203750 pfam07738, Sad1_UNC, Sad1 / UNC-like C-terminal. The C. elegans
UNC-84 protein is a nuclear envelope protein that is
involved in nuclear anchoring and migration during
development. The S. pombe Sad1 protein localises at the
spindle pole body. UNC-84 and and Sad1 share a common
C-terminal region, that is often termed the SUN (Sad1
and UNC) domain. In mammals, the SUN domain is present
in two proteins, Sun1 and Sun2. The SUN domain of Sun2
has been demonstrated to be in the periplasm.
Length = 135
Score = 26.1 bits (58), Expect = 3.0
Identities = 5/36 (13%), Positives = 11/36 (30%), Gaps = 5/36 (13%)
Query: 33 FLIKKTNKDWWQVIRSS-----GKPFYVPASYVEVY 63
F ++ W + ++ G Y V+
Sbjct: 97 FQLENPPDIWVKYVKLRILSNYGNEHYTCLYRFRVH 132
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or
SH3E) of Intersectin-2. Intersectin-2 (ITSN2) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN2 also functions as a
specific GEF for Cdc42 activation in epithelial
morphogenesis, and is required in mitotic spindle
orientation. It exists in alternatively spliced short
and long isoforms. The short isoform contains two Eps15
homology domains (EH1 and EH2), a coiled-coil region
and five SH3 domains (SH3A-E), while the long isoform,
in addition, contains RhoGEF (also called
Dbl-homologous or DH), Pleckstrin homology (PH) and C2
domains. The fifth SH3 domain (or SH3E) of ITSN2 is
expected to bind protein partners, similar to ITSN1
which has been shown to bind many protein partners
including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
N-WASP, and synaptojanin-1, among others. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 24.9 bits (54), Expect = 3.1
Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+V+ +DY+ + + +G+ + ++ K + DWWQ +G P++YV++
Sbjct: 2 QVIAMYDYTANNEDELSFSKGQLINVLNKDDPDWWQG-EINGVTGLFPSNYVKM 54
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
Adaptor Molecule 2. STAM2, also called EAST (Epidermal
growth factor receptor-associated protein with SH3 and
TAM domain) or Hbp (Hrs binding protein), is part of
the endosomal sorting complex required for transport
(ESCRT-0). It plays a role in sorting mono-ubiquinated
endosomal cargo for trafficking to the lysosome for
degradation. It is also involved in the regulation of
exocytosis. STAMs were discovered as proteins that are
highly phosphorylated following cytokine and growth
factor stimulation. They function in cytokine signaling
and surface receptor degradation, as well as regulate
Golgi morphology. They associate with many proteins
including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH,
and UBPY. STAM adaptor proteins contain VHS (Vps27,
Hrs, STAM homology), ubiquitin interacting (UIM), and
SH3 domains. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 25.0 bits (54), Expect = 3.2
Identities = 9/37 (24%), Positives = 24/37 (64%), Gaps = 2/37 (5%)
Query: 8 LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
++ LYDF+ + +D + + + GE + ++ ++ +WW+
Sbjct: 4 VRALYDFE-AVEDNE-LTFKHGEIIIVLDDSDANWWK 38
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of
CD2-associated protein and similar proteins. This
subfamily is composed of the third SH3 domain (SH3C) of
CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
similar domains. CD2AP and CIN85 are adaptor proteins
that bind to protein partners and assemble complexes
that have been implicated in T cell activation, kidney
function, and apoptosis of neuronal cells. They also
associate with endocytic proteins, actin cytoskeleton
components, and other adaptor proteins involved in
receptor tyrosine kinase (RTK) signaling. CD2AP and the
main isoform of CIN85 contain three SH3 domains, a
proline-rich region, and a C-terminal coiled-coil
domain. All of these domains enable CD2AP and CIN85 to
bind various protein partners and assemble complexes
that have been implicated in many different functions.
SH3C of both proteins have been shown to bind to
ubiquitin. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 24.6 bits (54), Expect = 3.4
Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 4/38 (10%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQ 44
+VL FDY ++ + ++EG+ + ++ K +D WW+
Sbjct: 3 RVL--FDYEAENEDELTLREGDIVTILSKDCEDKGWWK 38
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or
SH3E) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
fifth SH3 domain (or SH3E) of ITSN1 has been shown to
bind many protein partners including SGIP1, Sos1,
dynamin1/2, CIN85, c-Cbl, SHIP2, N-WASP, and
synaptojanin-1, among others. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 24.5 bits (53), Expect = 4.2
Identities = 12/54 (22%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+V+ +DY+ ++ + +G+ + ++ K + DWW+ +G+ P++YV++
Sbjct: 2 QVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKG-ELNGQVGLFPSNYVKL 54
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane
Protein, Palmitoylated 1 (or MAGUK p55 subfamily member
1)-like proteins. This subfamily includes MPP1, CASK
(Calcium/calmodulin-dependent Serine protein Kinase),
Caenorhabditis elegans lin-2, and similar proteins.
MPP1 and CASK are scaffolding proteins from the MAGUK
(membrane-associated guanylate kinase) protein family,
which is characterized by the presence of a core of
three domains: PDZ, SH3, and guanylate kinase (GuK). In
addition, they also have the Hook (Protein 4.1 Binding)
motif in between the SH3 and GuK domains. The GuK
domain in MAGUK proteins is enzymatically inactive;
instead, the domain mediates protein-protein
interactions and associates intramolecularly with the
SH3 domain. CASK and lin-2 also contain an N-terminal
calmodulin-dependent kinase (CaMK)-like domain and two
L27 domains. MPP1 is ubiquitously-expressed and plays
roles in regulating neutrophil polarity, cell shape,
hair cell development, and neural development and
patterning of the retina. CASK is highly expressed in
the mammalian nervous system and plays roles in
synaptic protein targeting, neural development, and
gene expression regulation. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 62
Score = 24.7 bits (54), Expect = 4.6
Identities = 11/39 (28%), Positives = 17/39 (43%), Gaps = 7/39 (17%)
Query: 14 FDYSTKDGKYVRIQE-------GEKLFLIKKTNKDWWQV 45
FDY + Q+ G+ L +I K + +WWQ
Sbjct: 6 FDYDPSKDDLIPCQQAGIAFKTGDILQIISKDDHNWWQA 44
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain
containing ring finger proteins. This model represents
the second SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
POSHER), SH3RF3 (POSH2), and similar domains. Members
of this family are scaffold proteins that function as
E3 ubiquitin-protein ligases. They all contain an
N-terminal RING finger domain and multiple SH3 domains;
SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
has three. SH3RF1 plays a role in calcium homeostasis
through the control of the ubiquitin domain protein
Herp. It may also have a role in regulating death
receptor mediated and JNK mediated apoptosis. SH3RF3
interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3RF2 acts
as an anti-apoptotic regulator of the JNK pathway by
binding to and promoting the degradation of SH3RF1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 24.2 bits (53), Expect = 5.0
Identities = 10/35 (28%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 9 KVLYDFDYSTKDGK-YVRIQEGEKLFLIKKTNKDW 42
K LYDF+ +D K + ++G+ + +I++ +++W
Sbjct: 3 KALYDFEMKDEDEKDCLTFKKGDVITVIRRVDENW 37
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein,
Palmitoylated (or MAGUK p55 subfamily member) proteins.
The MPP/p55 subfamily of MAGUK (membrane-associated
guanylate kinase) proteins includes at least eight
vertebrate members (MPP1-7 and CASK), four Drosophila
proteins (Stardust, Varicose, CASK and Skiff), and
other similar proteins; they all contain one each of
the core of three domains characteristic of MAGUK
proteins: PDZ, SH3, and guanylate kinase (GuK). In
addition, most members except for MPP1 contain
N-terminal L27 domains and some also contain a Hook
(Protein 4.1 Binding) motif in between the SH3 and GuK
domains. CASK has an additional calmodulin-dependent
kinase (CaMK)-like domain at the N-terminus. Members of
this subfamily are scaffolding proteins that play
important roles in regulating and establishing cell
polarity, cell adhesion, and synaptic targeting and
transmission, among others. The GuK domain in MAGUK
proteins is enzymatically inactive; instead, the domain
mediates protein-protein interactions and associates
intramolecularly with the SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 61
Score = 24.5 bits (54), Expect = 5.5
Identities = 9/41 (21%), Positives = 20/41 (48%), Gaps = 7/41 (17%)
Query: 14 FDYSTKDGKYVRIQE-------GEKLFLIKKTNKDWWQVIR 47
FDY ++ + +E G+ L ++ + + +WWQ +
Sbjct: 6 FDYDPEEDPLIPCKEAGLSFKKGDILQIVNQDDPNWWQARK 46
>gnl|CDD|225789 COG3250, LacZ, Beta-galactosidase/beta-glucuronidase
[Carbohydrate transport and metabolism].
Length = 808
Score = 25.5 bits (56), Expect = 5.9
Identities = 7/50 (14%), Positives = 16/50 (32%), Gaps = 2/50 (4%)
Query: 38 TNKDWWQVIRSSGKPFYVPASYVE--VYKKLSNGNRNNVENINPTMEKTR 85
+ W + + S + VP ++ + Y + N + P
Sbjct: 30 VPQRWPESLLSESRAIAVPGNWQDQGEYDRPIYTNVWYPREVFPPKVPAG 79
>gnl|CDD|213008 cd12075, SH3_Tks4_1, First Src homology 3 domain of Tyrosine
kinase substrate with four SH3 domains. Tks4, also
called SH3 and PX domain-containing protein 2B
(SH3PXD2B) or HOFI, is a Src substrate and scaffolding
protein that plays an important role in the formation
of podosomes and invadopodia, the dynamic actin-rich
structures that are related to cell migration and
cancer cell invasion. It is required in the formation
of functional podosomes, EGF-induced membrane ruffling,
and lamellipodia generation. It plays an important role
in cellular attachment and cell spreading. Tks4 is
essential for the localization of MT1-MMP
(membrane-type 1 matrix metalloproteinase) to
invadopodia. It contains an N-terminal Phox homology
(PX) domain and four SH3 domains. This model
characterizes the first SH3 domain of Tks4. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 24.3 bits (52), Expect = 6.5
Identities = 10/47 (21%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+Y ++ + + G+ + +I+K WW + ++ + +VPA+ +E
Sbjct: 8 NYQKQESSEISLYVGQVVDIIEKNESGWW-FVSTADEQGWVPATCLE 53
>gnl|CDD|234204 TIGR03423, pbp2_mrdA, penicillin-binding protein 2. Members of
this protein family are penicillin-binding protein 2
(PBP-2), a protein whose gene (designated pbpA or mrdA)
generally is found next to the gene for RodA, a protein
required for rod (bacillus) shape in many bacteria.
PBP-2 acts as a transpeptidase for cell elongation
(hence, rod-shape) [Cell envelope, Biosynthesis and
degradation of murein sacculus and peptidoglycan].
Length = 592
Score = 25.2 bits (56), Expect = 7.8
Identities = 8/20 (40%), Positives = 9/20 (45%)
Query: 61 EVYKKLSNGNRNNVENINPT 80
E Y LS NR + I P
Sbjct: 30 EEYATLSEDNRIRLVPIPPP 49
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The fifth SH3 domain (or SH3E) of
ITSN1 has been shown to bind many protein partners
including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
N-WASP, and synaptojanin-1, among others. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 23.9 bits (52), Expect = 8.0
Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
Query: 9 KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
+V+ F Y+ ++ + Q+G+ + ++ K + DWW+ +G+ P++YVE
Sbjct: 1 QVIALFPYTAQNEDELSFQKGDIINVLSKDDPDWWRG-ELNGQTGLFPSNYVEP 53
>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog
4. DLG4, also called postsynaptic density-95 (PSD95)
or synapse-associated protein 90 (SAP90), is a
scaffolding protein that clusters at synapses and plays
an important role in synaptic development and
plasticity. It is responsible for the membrane
clustering and retention of many transporters and
receptors such as potassium channels and PMCA4b, a
P-type ion transport ATPase, among others. DLG4 is a
member of the MAGUK (membrane-associated guanylate
kinase) protein family, which is characterized by the
presence of a core of three domains: PDZ, SH3, and
guanylate kinase (GuK). The GuK domain in MAGUK
proteins is enzymatically inactive; instead, the domain
mediates protein-protein interactions and associates
intramolecularly with the SH3 domain. DLG4 contains
three PDZ domains. The SH3 domain of DLG4 binds and
clusters the kainate subgroup of glutamate receptors
via two proline-rich sequences in their C-terminal
tail. It also binds AKAP79/150 (A-kinase anchoring
protein). SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 66
Score = 24.1 bits (52), Expect = 9.0
Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 5/44 (11%)
Query: 8 LKVLYDFDYSTKD----GKYVRIQEGEKLFLIKKTNKDWWQVIR 47
++ L+D+D TKD + + + G+ L +I +++WWQ R
Sbjct: 4 IRALFDYD-KTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARR 46
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain
of VAV proteins. VAV proteins function both as
cytoplasmic guanine nucleotide exchange factors (GEFs)
for Rho GTPases and scaffold proteins and they play
important roles in cell signaling by coupling cell
surface receptors to various effector functions. They
play key roles in processes that require cytoskeletal
reorganization including immune synapse formation,
phagocytosis, cell spreading, and platelet aggregation,
among others. Vertebrates have three VAV proteins
(VAV1, VAV2, and VAV3). VAV proteins contain several
domains that enable their function: N-terminal calponin
homology (CH), acidic, RhoGEF (also called
Dbl-homologous or DH), Pleckstrin Homology (PH), C1
(zinc finger), SH2, and two SH3 domains. The SH3 domain
of VAV is involved in the localization of proteins to
specific sites within the cell, by interacting with
proline-rich sequences within target proteins. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 23.7 bits (51), Expect = 9.9
Identities = 13/49 (26%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
Query: 14 FDYSTKDGKYVRIQEGEKL-FLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
+D+ +D + + ++EG+ + KK + WW+ +G+ + P++YVE
Sbjct: 6 YDFCARDMRELSLKEGDVVKIYNKKGQQGWWRG-EINGRIGWFPSTYVE 53
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.313 0.132 0.384
Gapped
Lambda K H
0.267 0.0813 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,012,612
Number of extensions: 413859
Number of successful extensions: 487
Number of sequences better than 10.0: 1
Number of HSP's gapped: 468
Number of HSP's successfully gapped: 147
Length of query: 101
Length of database: 10,937,602
Length adjustment: 67
Effective length of query: 34
Effective length of database: 7,965,884
Effective search space: 270840056
Effective search space used: 270840056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (24.0 bits)