RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy6758
         (101 letters)



>gnl|CDD|212821 cd11888, SH3_ARHGAP9_like, Src Homology 3 domain of Rho
          GTPase-activating protein 9 and similar proteins.  This
          subfamily is composed of Rho GTPase-activating proteins
          including mammalian ARHGAP9, and vertebrate ARHGAPs 12
          and 27. RhoGAPs (or ARHGAPs) bind to Rho proteins and
          enhance the hydrolysis rates of bound GTP. ARHGAP9
          functions as a GAP for Rac and Cdc42, but not for RhoA.
          It negatively regulates cell migration and adhesion. It
          also acts as a docking protein for the MAP kinases Erk2
          and p38alpha, and may facilitate cross-talk between the
          Rho GTPase and MAPK pathways to control actin
          remodeling. ARHGAP27, also called CAMGAP1, shows GAP
          activity towards Rac1 and Cdc42. It binds the adaptor
          protein CIN85 and may play a role in clathrin-mediated
          endocytosis. ARHGAP12 has been shown to display GAP
          activity towards Rac1. It plays a role in regulating
          HFG-driven cell growth and invasiveness. ARHGAPs in
          this subfamily contain SH3, WW, Pleckstin homology
          (PH), and RhoGAP domains. SH3 domains bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs; they play a
          role in the regulation of enzymes by intramolecular
          interactions, changing the subcellular localization of
          signal pathway components and mediate multiprotein
          complex assemblies.
          Length = 54

 Score = 75.5 bits (186), Expect = 7e-20
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (1%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSS-GKPFYVPASY 59
           + VLY F+Y+ KDG+ V I+EGE+  L+KK+N DWWQV R    KPFYVPA Y
Sbjct: 1  YVVVLYPFEYTGKDGRKVSIKEGERFLLLKKSNDDWWQVRRPGDSKPFYVPAQY 54


>gnl|CDD|213019 cd12143, SH3_ARHGAP9, Src Homology 3 domain of Rho
          GTPase-activating protein 9 and similar proteins.  Rho
          GTPase-activating proteins (RhoGAPs or ARHGAPs) bind to
          Rho proteins and enhance the hydrolysis rates of bound
          GTP. ARHGAP9 functions as a GAP for Rac and Cdc42, but
          not for RhoA. It negatively regulates cell migration
          and adhesion. It also acts as a docking protein for the
          MAP kinases Erk2 and p38alpha, and may facilitate
          cross-talk between the Rho GTPase and MAPK pathways to
          control actin remodeling. It contains SH3, WW,
          Pleckstin homology (PH), and RhoGAP domains. SH3
          domains bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs; they play a role in the regulation of enzymes
          by intramolecular interactions, changing the
          subcellular localization of signal pathway components
          and mediate multiprotein complex assemblies.
          Length = 57

 Score = 66.5 bits (162), Expect = 2e-16
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 4/56 (7%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR----SSGKPFYVPASY 59
          L  LY + Y+  DG+ V I EGE+  L++KTN DWWQV R    S+ +P +VPA+Y
Sbjct: 2  LCALYAYQYTGADGRQVSIAEGERFLLLRKTNSDWWQVRRLEAPSTSRPLFVPATY 57


>gnl|CDD|213002 cd12069, SH3_ARHGAP27, Src Homology 3 domain of Rho
          GTPase-activating protein 27.  Rho GTPase-activating
          proteins (RhoGAPs or ARHGAPs) bind to Rho proteins and
          enhance the hydrolysis rates of bound GTP. ARHGAP27,
          also called CAMGAP1, shows GAP activity towards Rac1
          and Cdc42. It binds the adaptor protein CIN85 and may
          play a role in clathrin-mediated endocytosis. It
          contains SH3, WW, Pleckstin homology (PH), and RhoGAP
          domains. SH3 domains bind to proline-rich ligands with
          moderate affinity and selectivity, preferentially to
          PxxP motifs; they play a role in the regulation of
          enzymes by intramolecular interactions, changing the
          subcellular localization of signal pathway components
          and mediate multiprotein complex assemblies.
          Length = 57

 Score = 61.8 bits (150), Expect = 2e-14
 Identities = 23/54 (42%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRS-SGKPFYVPASYVEV 62
          V + F+Y+ KDG+ V I+  E+  L+++TN+ WW V R    +PFY+PA YV+ 
Sbjct: 4  VEHAFEYTGKDGRLVSIKPNERYILLRRTNEHWWHVRRDKGTRPFYIPAKYVKE 57


>gnl|CDD|213003 cd12070, SH3_ARHGAP12, Src Homology 3 domain of Rho
          GTPase-activating protein 12.  Rho GTPase-activating
          proteins (RhoGAPs or ARHGAPs) bind to Rho proteins and
          enhance the hydrolysis rates of bound GTP. ARHGAP12 has
          been shown to display GAP activity towards Rac1. It
          plays a role in regulating hepatocyte growth factor
          (HGF)-driven cell growth and invasiveness. It contains
          SH3, WW, Pleckstin homology (PH), and RhoGAP domains.
          SH3 domains bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs; they play a role in the regulation of enzymes
          by intramolecular interactions, changing the
          subcellular localization of signal pathway components
          and mediate multiprotein complex assemblies.
          Length = 60

 Score = 54.6 bits (131), Expect = 1e-11
 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 2/55 (3%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVE 61
          ++V YD+DY  KD K V I++GE+  L+KKTN DWWQV +  + KPFYVPA YV+
Sbjct: 3  IEVEYDYDYEAKDRKIV-IKQGERYILVKKTNDDWWQVKKDENSKPFYVPAQYVK 56


>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein
          interacting with Nck, 90 kDa (SPIN90).  SPIN90 is also
          called NCK interacting protein with SH3 domain
          (NCKIPSD), Dia-interacting protein (DIP), 54 kDa
          vimentin-interacting protein (VIP54), or
          WASP-interacting SH3-domain protein (WISH). It is an
          F-actin binding protein that regulates actin
          polymerization and endocytosis. It associates with the
          Arp2/3 complex near actin filaments and determines
          filament localization at the leading edge of
          lamellipodia. SPIN90 is expressed in the early stages
          of neuronal differentiation and plays a role in
          regulating growth cone dynamics and neurite outgrowth.
          It also interacts with IRSp53 and regulates cell
          motility by playing a role in the formation of membrane
          protrusions. SPIN90 contains an N-terminal SH3 domain,
          a proline-rich domain, and a C-terminal VCA
          (verprolin-homology and cofilin-like acidic) domain.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 52.7 bits (127), Expect = 6e-11
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           + LYDF   + +   +   EGE   L++++N  WW V   SG+  YVPA+YV+
Sbjct: 2  YRALYDF--KSAEPNTLSFSEGETFLLLERSNAHWWLVTNHSGETGYVPANYVK 53


>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains.  Src homology 3 (SH3)
          domains bind to target proteins through sequences
          containing proline and hydrophobic amino acids.
          Pro-containing polypeptides may bind to SH3 domains in
          2 different binding orientations.
          Length = 56

 Score = 47.5 bits (114), Expect = 6e-09
 Identities = 14/56 (25%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 6  VTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
            ++ LYD+     D   +  ++G+ + +++K++  WW+     GK    P++YVE
Sbjct: 3  PQVRALYDYTAQDPDE--LSFKKGDIITVLEKSDDGWWKGRLGRGKEGLFPSNYVE 56


>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of
          Cdc42-Interacting Protein 4.  This subfamily is
          composed of Cdc42-Interacting Protein 4 (CIP4), Formin
          Binding Protein 17 (FBP17), FormiN Binding Protein
          1-Like (FNBP1L), and similar proteins. CIP4 and FNBP1L
          are Cdc42 effectors that bind Wiskott-Aldrich syndrome
          protein (WASP) and function in endocytosis. CIP4 and
          FBP17 bind to the Fas ligand and may be implicated in
          the inflammatory response. CIP4 may also play a role in
          phagocytosis. It functions downstream of Cdc42 in
          PDGF-dependent actin reorganization and cell migration,
          and also regulates the activity of PDGFRbeta. It uses
          Src as a substrate in regulating the invasiveness of
          breast tumor cells. CIP4 may also play a role in the
          pathogenesis of Huntington's disease. Members of this
          subfamily typically contain an N-terminal F-BAR
          (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain, a
          central Cdc42-binding HR1 domain, and a C-terminal SH3
          domain. The SH3 domain of CIP4 associates with Gapex-5,
          a Rab31 GEF. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 43.4 bits (103), Expect = 3e-07
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
            LYDFD  T +G  + ++EGE L ++++   D W +V +++G   YVP SY+EV
Sbjct: 3  TALYDFD-GTSEGT-LSMEEGEILLVLEEDGGDGWTRVRKNNGDEGYVPTSYIEV 55


>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily.  Src Homology 3
          (SH3) domains are protein interaction domains that bind
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. Thus, they
          are referred to as proline-recognition domains (PRDs).
          SH3 domains are less selective and show more diverse
          specificity compared to other PRDs. They have been
          shown to bind peptide sequences that lack the PxxP
          motif; examples include the PxxDY motif of Eps8 and the
          RKxxYxxY sequence in SKAP55. SH3 domain containing
          proteins play versatile and diverse roles in the cell,
          including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies, among others. Many members of this
          superfamily are adaptor proteins that associate with a
          number of protein partners, facilitating complex
          formation and signal transduction.
          Length = 51

 Score = 42.8 bits (102), Expect = 3e-07
 Identities = 12/51 (23%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
          + LYD++    D   +  ++G+ + +++K +  WW+   + G+    PA+Y
Sbjct: 3  RALYDYEAQDDDE--LSFKKGDIITVLEKDDDGWWEGELNGGREGLFPANY 51


>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal
          endocytic adaptor protein Sla1p.  Sla1p facilitates
          endocytosis by playing a role as an adaptor protein in
          coupling components of the actin cytoskeleton to the
          endocytic machinery. It interacts with Abp1p, Las17p
          and Pan1p, which are activator proteins of
          actin-related protein 2/3 (Arp2/3). Sla1p contains
          multiple domains including three SH3 domains, a SAM
          (sterile alpha motif) domain, and a Sla1 homology
          domain 1 (SHD1), which binds to the NPFXD motif that is
          found in many integral membrane proteins such as the
          Golgi-localized Arf-binding protein Lsb5p and the
          P4-ATPases, Drs2p and Dnf1p. The third SH3 domain of
          Sla1p can bind ubiquitin while retaining the ability to
          bind proline-rich ligands; monoubiquitination of target
          proteins signals internalization and sorting through
          the endocytic pathway. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 42.7 bits (101), Expect = 5e-07
 Identities = 25/56 (44%), Positives = 38/56 (67%), Gaps = 4/56 (7%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLI-KKTNKDWWQVIR-SSGKPFYVPASYVEV 62
          KVLYDFD  + D   + ++EG+ ++++  K +KDWW V   S+GK   VPASY+E+
Sbjct: 4  KVLYDFDAQSDD--ELTVKEGDVVYILDDKKSKDWWMVENVSTGKEGVVPASYIEI 57


>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain.  SH3 (Src homology 3) domains are
          often indicative of a protein involved in signal
          transduction related to cytoskeletal organisation.
          First described in the Src cytoplasmic tyrosine kinase.
          The structure is a partly opened beta barrel.
          Length = 47

 Score = 40.2 bits (95), Expect = 4e-06
 Identities = 11/49 (22%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPA 57
            LYD+     D   +  ++G+ + +++K++  WW+     GK   +P+
Sbjct: 1  VALYDYTAREPD--ELSFKKGDIIIVLEKSDDGWWKGRLKGGKEGLIPS 47


>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha
          Spectrin.  Spectrin is a major structural component of
          the red blood cell membrane skeleton and is important
          in erythropoiesis and membrane biogenesis. It is a
          flexible, rope-like molecule composed of two subunits,
          alpha and beta, which consist of many spectrin-type
          repeats. Alpha and beta spectrin associate to form
          heterodimers and tetramers; spectrin tetramer formation
          is critical for red cell shape and deformability.
          Defects in alpha spectrin have been associated with
          inherited hemolytic anemias including hereditary
          spherocytosis (HSp), hereditary elliptocytosis (HE),
          and hereditary pyropoikilocytosis (HPP). Alpha spectrin
          contains a middle SH3 domain and a C-terminal EF-hand
          binding motif in addition to multiple spectrin repeats.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 39.8 bits (93), Expect = 6e-06
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           V+  +DY  K  + V +++G+ L L+  +NKDWW+V   + +  +VPA+YV+
Sbjct: 1  CVVALYDYQEKSPREVSMKKGDILTLLNSSNKDWWKV-EVNDRQGFVPAAYVK 52


>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
          Tyrosine Kinases.  The Tec (Tyrosine kinase expressed
          in hepatocellular carcinoma) subfamily is composed of
          Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and
          similar proteins. They are cytoplasmic (or nonreceptor)
          tyr kinases containing Src homology protein interaction
          domains (SH3, SH2) N-terminal to the catalytic tyr
          kinase domain. Most Tec subfamily members (except Rlk)
          also contain an N-terminal pleckstrin homology (PH)
          domain, which binds the products of PI3K and allows
          membrane recruitment and activation. In addition, some
          members contain the Tec homology (TH) domain, which
          contains proline-rich and zinc-binding regions. Tec
          kinases are expressed mainly by haematopoietic cells,
          although Tec and Bmx are also found in endothelial
          cells. B-cells express Btk and Tec, while T-cells
          express Itk, Txk, and Tec. Collectively, Tec kinases
          are expressed in a variety of myeloid cells such as
          mast cells, platelets, macrophages, and dendritic
          cells. Each Tec kinase shows a distinct cell-type
          pattern of expression. The function of Tec kinases in
          lymphoid cells have been studied extensively. They play
          important roles in the development, differentiation,
          maturation, regulation, survival, and function of
          B-cells and T-cells. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 38.4 bits (90), Expect = 2e-05
 Identities = 11/48 (22%), Positives = 28/48 (58%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +D+   +   + +++GE+  ++  +N+ WW+    +G   Y+P++YV 
Sbjct: 6  YDFQPIEPGDLPLEKGEEYVVLDDSNEHWWRARDKNGNEGYIPSNYVT 53


>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
          and similar proteins.  Sorting nexins (SNXs) are Phox
          homology (PX) domain containing proteins that are
          involved in regulating membrane traffic and protein
          sorting in the endosomal system. SNXs differ from each
          other in their lipid-binding specificity, subcellular
          localization and specific function in the endocytic
          pathway. This subfamily consists of SH3 domain
          containing SNXs including SNX9, SNX18, SNX33, and
          similar proteins. SNX9 is localized to plasma membrane
          endocytic sites and acts primarily in clathrin-mediated
          endocytosis, while SNX18 is localized to peripheral
          endosomal structures, and acts in a trafficking pathway
          that is clathrin-independent but relies on AP-1 and
          PACS1. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 38.5 bits (90), Expect = 2e-05
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
          + LYDFD        + ++ GE L + ++   D W +   S G+    P+SYVE+
Sbjct: 3  RALYDFDSQPSGE--LSLRAGEVLTITRQDVGDGWLEGRNSRGEVGLFPSSYVEI 55


>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor
          proteins.  Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2 (also called Nckbeta or
          Growth factor receptor-bound protein 4, Grb4), which
          show partly overlapping functions but also bind
          distinct targets. Their SH3 domains are involved in
          recruiting downstream effector molecules, such as the
          N-WASP/Arp2/3 complex, which when activated induces
          actin polymerization that results in the production of
          pedestals, or protrusions of the plasma membrane. The
          first SH3 domain of Nck proteins preferentially binds
          the PxxDY sequence, which is present in the CD3e
          cytoplasmic tail. This binding inhibits phosphorylation
          by Src kinases, resulting in the downregulation of TCR
          surface expression. SH3 domains are protein interaction
          domains that usually bind to proline-rich ligands with
          moderate affinity and selectivity, preferentially a
          PxxP motif. They play versatile and diverse roles in
          the cell including the regulation of enzymes, changing
          the subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 51

 Score = 37.8 bits (88), Expect = 4e-05
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          V+  +DY+ +  + + I++ EKL L+  + K WW+V  SS +  YVP++YV
Sbjct: 2  VVAKYDYTAQGDQELSIKKNEKLTLLDDS-KHWWKVQNSSNQTGYVPSNYV 51


>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine
          N-methyltransferase 2.  PRMT2, also called HRMT1L1,
          belongs to the arginine methyltransferase protein
          family. It functions as a coactivator to both estrogen
          receptor alpha (ER-alpha) and androgen receptor (AR),
          presumably through arginine methylation. The ER-alpha
          transcription factor is involved in cell proliferation,
          differentiation, morphogenesis, and apoptosis, and is
          also implicated in the development and progression of
          breast cancer. PRMT2 and its variants are upregulated
          in breast cancer cells and may be involved in
          modulating the ER-alpha signaling pathway during
          formation of breast cancer. PRMT2 also plays a role in
          regulating the function of E2F transcription factors,
          which are critical cell cycle regulators, by binding to
          the retinoblastoma gene product (RB). It contains an
          N-terminal SH3 domain and an AdoMet binding domain. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 37.4 bits (87), Expect = 5e-05
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          D+   D   +  + G+KL +++K + DWW     +G   Y+PAS++
Sbjct: 7  DFVATDDSQLSFESGDKLLVLRKPSVDWWWA-EHNGCCGYIPASHL 51


>gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding
          Protein 17.  Formin Binding Protein 17 (FBP17), also
          called FormiN Binding Protein 1 (FNBP1), is involved in
          dynamin-mediated endocytosis. It is recruited to
          clathrin-coated pits late in the endocytosis process
          and may play a role in the invagination and scission
          steps. FBP17 binds in vivo to tankyrase, a protein
          involved in telomere maintenance and mitogen activated
          protein kinase (MAPK) signaling. It contains an
          N-terminal F-BAR (FES-CIP4 Homology and
          Bin/Amphiphysin/Rvs) domain, a Cdc42-binding HR1
          domain, and a C-terminal SH3 domain. The SH3 domain of
          the related protein, CIP4, associates with Gapex-5, a
          Rab31 GEF. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 57

 Score = 36.5 bits (84), Expect = 1e-04
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEVY 63
          T K LY F+   ++   + + EGE L++I++   D W ++ R+  +  YVP SY+EVY
Sbjct: 2  TCKALYPFE--GQNEGTISVAEGEMLYVIEEDKGDGWTRIRRNEDEEGYVPTSYIEVY 57


>gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding
          Protein 1-Like.  FormiN Binding Protein 1-Like
          (FNBP1L), also known as Toca-1 (Transducer of
          Cdc42-dependent actin assembly), forms a complex with
          neural Wiskott-Aldrich syndrome protein (N-WASP). The
          FNBP1L/N-WASP complex induces the formation of
          filopodia and endocytic vesicles. FNBP1L is required
          for Cdc42-induced actin assembly and is essential for
          autophagy of intracellular pathogens. It contains an
          N-terminal F-BAR domain, a central Cdc42-binding HR1
          domain, and a C-terminal SH3 domain. The SH3 domain of
          the related protein, CIP4, associates with Gapex-5, a
          Rab31 GEF. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 57

 Score = 36.5 bits (84), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
          K LY FD  + +G    ++EGE L++I++   D W +  + +G+  YVP SY+E+
Sbjct: 4  KALYPFD-GSNEGTLA-MKEGEVLYIIEEDKGDGWTRARKQNGEEGYVPTSYIEI 56


>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity
          signaling protein Sho1p.  Sho1p (or Sho1), also called
          SSU81 (Suppressor of SUA8-1 mutation), is a yeast
          membrane protein that regulates adaptation to high salt
          conditions by activating the HOG (high-osmolarity
          glycerol) pathway. High salt concentrations lead to the
          localization to the membrane of the MAPKK Pbs2, which
          is then activated by the MAPKK Ste11 and in turn,
          activates the MAPK Hog1. Pbs2 is localized to the
          membrane though the interaction of its PxxP motif with
          the SH3 domain of Sho1p. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 36.2 bits (84), Expect = 2e-04
 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
            + LY +D S  D   +  ++GE +  +  T+  WWQ  +S+G+    P++Y+++
Sbjct: 1  RARALYPYDASPDDPNELSFEKGE-ILEVSDTSGKWWQARKSNGETGICPSNYLQL 55


>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like
          Protein Tyrosine Kinases.  Src subfamily members
          include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes,
          and Brk. Src (or c-Src) proteins are cytoplasmic (or
          non-receptor) PTKs which are anchored to the plasma
          membrane. They contain an N-terminal SH4 domain with a
          myristoylation site, followed by SH3 and SH2 domains, a
          tyr kinase domain, and a regulatory C-terminal region
          containing a conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). However,
          Brk lacks the N-terminal myristoylation sites. Src
          proteins are involved in signaling pathways that
          regulate cytokine and growth factor responses,
          cytoskeleton dynamics, cell proliferation, survival,
          and differentiation. They were identified as the first
          proto-oncogene products, and they regulate cell
          adhesion, invasion, and motility in cancer cells, and
          tumor vasculature, contributing to cancer progression
          and metastasis. Src kinases are overexpressed in a
          variety of human cancers, making them attractive
          targets for therapy. They are also implicated in acute
          inflammatory responses and osteoclast function. Src,
          Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
          Hck, Fgr, Lyn, and Brk show a limited expression
          pattern. This subfamily also includes Drosophila
          Src42A, Src oncogene at 42A (also known as Dsrc41)
          which accumulates at sites of cell-cell or cell-matrix
          adhesion, and participates in Drosphila development and
          wound healing. It has been shown to promote tube
          elongation in the tracheal system, is essential for
          proper cell-cell matching during dorsal closure, and
          regulates cell-cell contacts in developing Drosophila
          eyes. The SH3 domain of Src kinases contributes to
          substrate recruitment by binding adaptor
          proteins/substrates, and regulation of kinase activity
          through an intramolecular interaction. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 36.0 bits (84), Expect = 2e-04
 Identities = 16/50 (32%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASY 59
          LYD++  T D   +  ++G++L ++  ++ DWW     S+GK  Y+P++Y
Sbjct: 5  LYDYEARTDDD--LSFKKGDRLQILDDSDGDWWLARHLSTGKEGYIPSNY 52


>gnl|CDD|212812 cd11879, SH3_Bem1p_2, Second Src Homology 3 domain of Bud
          emergence protein 1 and similar domains.  Members of
          this subfamily bear similarity to Saccharomyces
          cerevisiae Bem1p, containing two Src Homology 3 (SH3)
          domains at the N-terminus, a central PX domain, and a
          C-terminal PB1 domain. Bem1p is a scaffolding protein
          that is critical for proper Cdc42p activation during
          bud formation in yeast. During budding and mating,
          Bem1p migrates to the plasma membrane where it can
          serve as an adaptor for Cdc42p and some other proteins.
          Bem1p also functions as an effector of the G1 cyclin
          Cln3p and the cyclin-dependent kinase Cdc28p in
          promoting vacuolar fusion. SH3 domains bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs; they play a
          role in the regulation of enzymes by intramolecular
          interactions, changing the subcellular localization of
          signal pathway components and mediate multiprotein
          complex assemblies.
          Length = 56

 Score = 36.2 bits (84), Expect = 2e-04
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQV--IRSSGKPFYVPASYVEV 62
          VLYDF     D   +  + G+ + +   +N +W+    I   G P  +P S+VE+
Sbjct: 4  VLYDFKAERPD--ELDAKAGDAIIICAHSNYEWFVAKPIGRLGGPGLIPVSFVEI 56


>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox
          subunit of NADPH oxidase and similar domains.  This
          family is composed of the tandem SH3 domains of p47phox
          subunit of NADPH oxidase and Nox Organizing protein 1
          (NoxO1), the four SH3 domains of Tks4 (Tyr kinase
          substrate with four SH3 domains), the five SH3 domains
          of Tks5, the SH3 domain of obscurin, Myosin-I,  and
          similar domains. Most members of this group also
          contain Phox homology (PX) domains, except for obscurin
          and Myosin-I. p47phox and NoxO1 are regulators of the
          phagocytic NADPH oxidase complex (also called Nox2 or
          gp91phox) and nonphagocytic NADPH oxidase Nox1,
          respectively. They play roles in the activation of
          their respective NADPH oxidase, which catalyzes the
          transfer of electrons from NADPH to molecular oxygen to
          form superoxide. Tks proteins are Src substrates and
          scaffolding proteins that play important roles in the
          formation of podosomes and invadopodia, the dynamic
          actin-rich structures that are related to cell
          migration and cancer cell invasion. Obscurin is a giant
          muscle protein that plays important roles in the
          organization and assembly of the myofibril and the
          sarcoplasmic reticulum. Type I myosins (Myosin-I) are
          actin-dependent motors in endocytic actin structures
          and actin patches. They play roles in membrane traffic
          in endocytic and secretory pathways, cell motility, and
          mechanosensing. Myosin-I contains an N-terminal
          actin-activated ATPase, a phospholipid-binding TH1
          (tail homology 1) domain, and a C-terminal extension
          which includes an F-actin-binding TH2 domain, an SH3
          domain, and an acidic peptide that participates in
          activating the Arp2/3complex. The SH3 domain of
          myosin-I is required for myosin-I-induced actin
          polymerization. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 36.1 bits (84), Expect = 2e-04
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           + D++    D   + +QEGE + +++K +  WW V R   K  +VPASY+E
Sbjct: 4  AIADYEAQGDDE--ISLQEGEVVEVLEKNDSGWWYV-RKGDKEGWVPASYLE 52


>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10
          Regulator of Kinase adaptor proteins.  CRK adaptor
          proteins consists of SH2 and SH3 domains, which bind
          tyrosine-phosphorylated peptides and proline-rich
          motifs, respectively. They function downstream of
          protein tyrosine kinases in many signaling pathways
          started by various extracellular signals, including
          growth and differentiation factors. Cellular CRK
          (c-CRK) contains a single SH2 domain, followed by
          N-terminal and C-terminal SH3 domains. It is involved
          in the regulation of many cellular processes including
          cell growth, motility, adhesion, and apoptosis. CRK has
          been implicated in the malignancy of various human
          cancers. The N-terminal SH3 domain of CRK binds a
          number of target proteins including DOCK180, C3G, SOS,
          and cABL. The CRK family includes two alternatively
          spliced protein forms, CRKI and CRKII, that are
          expressed by the CRK gene, and the CRK-like (CRKL)
          protein, which is expressed by a distinct gene (CRKL).
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           ++ L+DF  +  D + +  ++GE L +I+K  + WW    S GK   +P  YVE
Sbjct: 2  YVRALFDFPGN--DDEDLPFKKGEILTVIRKPEEQWWNARNSEGKTGMIPVPYVE 54


>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast
          stimulating factor 1.  OSTF1, also named OSF or SH3P2,
          is a signaling protein containing SH3 and
          ankyrin-repeat domains. It acts through a Src-related
          pathway to enhance the formation of osteoclasts and
          bone resorption. It also acts as a negative regulator
          of cell motility. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 35.4 bits (82), Expect = 3e-04
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          + LYD++    D      +EG+ L++  K++ +WW+     GK   +P++YVE
Sbjct: 3  RALYDYEAQHPDELS--FEEGDLLYISDKSDPNWWKA-TCGGKTGLIPSNYVE 52


>gnl|CDD|212841 cd11908, SH3_ITK, Src Homology 3 domain of
          Interleukin-2-inducible T-cell Kinase.  ITK (also known
          as Tsk or Emt) is a cytoplasmic (or nonreceptor) tyr
          kinase containing Src homology protein interaction
          domains (SH3, SH2) N-terminal to the catalytic tyr
          kinase domain. It also contains an N-terminal
          pleckstrin homology (PH) domain, which binds the
          products of PI3K and allows membrane recruitment and
          activation, and the Tec homology (TH) domain, which
          contains proline-rich and zinc-binding regions. ITK is
          expressed in T-cells and mast cells, and is important
          in their development and differentiation. Of the three
          Tec kinases expressed in T-cells, ITK plays the
          predominant role in T-cell receptor (TCR) signaling. It
          is activated by phosphorylation upon TCR crosslinking
          and is involved in the pathway resulting in
          phospholipase C-gamma1 activation and actin
          polymerization. It also plays a role in the downstream
          signaling of the T-cell costimulatory receptor CD28,
          the T-cell surface receptor CD2, and the chemokine
          receptor CXCR4. In addition, ITK is crucial for the
          development of T-helper(Th)2 effector responses. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 56

 Score = 35.4 bits (81), Expect = 4e-04
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          V+  +DY T D + + ++  E+  L+  +   WW+V   +G   YVP+SY+
Sbjct: 3  VIALYDYQTNDPQELALRYNEEYHLLDSSEIHWWRVQDKNGHEGYVPSSYL 53


>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
          and related proteins.  This subfamily includes
          cortactin, Abp1 (actin-binding protein 1),
          hematopoietic lineage cell-specific protein 1 (HS1),
          and similar proteins. These proteins are involved in
          regulating actin dynamics through direct or indirect
          interaction with the Arp2/3 complex, which is required
          to initiate actin polymerization. They all contain at
          least one C-terminal SH3 domain. Cortactin and HS1 bind
          Arp2/3 and actin through an N-terminal region that
          contains an acidic domain and several copies of a
          repeat domain found in cortactin and HS1. Abp1 binds
          actin via an N-terminal actin-depolymerizing factor
          (ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
          through two acidic domains. Mammalian Abp1 does not
          directly interact with Arp2/3; instead, it regulates
          actin dynamics indirectly by interacting with dynamin
          and WASP family proteins. The C-terminal region of
          these proteins acts as an adaptor or scaffold that can
          connect membrane trafficking and signaling proteins
          that bind the SH3 domain within the actin network. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 35.0 bits (81), Expect = 5e-04
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          K LYD  Y   +   +   EG+ +  I++ ++ WW  + + G+    PA+YVE
Sbjct: 3  KALYD--YQAAEDNEISFVEGDIITQIEQIDEGWWLGVNAKGQKGLFPANYVE 53


>gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of
          Cdc42-Interacting Protein 4, Bzz1 and similar domains. 
          This subfamily is composed of Cdc42-Interacting Protein
          4 (CIP4) and similar proteins such as Formin Binding
          Protein 17 (FBP17) and FormiN Binding Protein 1-Like
          (FNBP1L), as well as yeast Bzz1 (or Bzz1p). CIP4 and
          FNBP1L are Cdc42 effectors that bind Wiskott-Aldrich
          syndrome protein (WASP) and function in endocytosis.
          CIP4 and FBP17 bind to the Fas ligand and may be
          implicated in the inflammatory response. CIP4 may also
          play a role in phagocytosis. Bzz1 is also a
          WASP/Las17-interacting protein involved in endocytosis
          and trafficking to the vacuole. It physically interacts
          with type I myosins and functions in the early steps of
          endocytosis. Members of this subfamily contain an
          N-terminal F-BAR (FES-CIP4 Homology and
          Bin/Amphiphysin/Rvs) domain as well as at least one
          C-terminal SH3 domain. Bzz1 contains a second SH3
          domain at the C-terminus. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 34.9 bits (80), Expect = 6e-04
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
          K LY F  S++    + + EGEKL L+++   D W +V R +G+  YVP SY+ +
Sbjct: 3  KALYAFVGSSEG--TISMTEGEKLSLVEEDKGDGWTRVRRDTGEEGYVPTSYIRI 55


>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk
          Protein Tyrosine Kinases.  Fyn and Yrk (Yes-related
          kinase) are members of the Src subfamily of proteins,
          which are cytoplasmic (or non-receptor) PTKs. Fyn,
          together with Lck, plays a critical role in T-cell
          signal transduction by phosphorylating ITAM
          (immunoreceptor tyr activation motif) sequences on
          T-cell receptors, ultimately leading to the
          proliferation and differentiation of T-cells. In
          addition, Fyn is involved in the myelination of
          neurons, and is implicated in Alzheimer's and
          Parkinson's diseases. Yrk has been detected only in
          chickens. It is primarily found in neuronal and
          epithelial cells and in macrophages. It may play a role
          in inflammation and in response to injury. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 34.6 bits (79), Expect = 6e-04
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
          LYD++  T+D   +   +GEK  ++  +  DWW+    ++G+  Y+P++YV
Sbjct: 6  LYDYEARTEDD--LSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYV 54


>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine
          Kinase.  Yes (or c-Yes) is a member of the Src
          subfamily of proteins, which are cytoplasmic (or
          non-receptor) PTKs. c-Yes kinase is the cellular
          homolog of the oncogenic protein (v-Yes) encoded by the
          Yamaguchi 73 and Esh sarcoma viruses. It displays
          functional overlap with other Src subfamily members,
          particularly Src. It also shows some unique functions
          such as binding to occludins, transmembrane proteins
          that regulate extracellular interactions in tight
          junctions. Yes also associates with a number of
          proteins in different cell types that Src does not
          interact with, like JAK2 and gp130 in pre-adipocytes,
          and Pyk2 in treated pulmonary vein endothelial cells.
          Although the biological function of Yes remains
          unclear, it appears to have a role in regulating
          cell-cell interactions and vesicle trafficking in
          polarized cells. Src kinases contain an N-terminal SH4
          domain with a myristoylation site, followed by SH3 and
          SH2 domains, a tyr kinase domain, and a regulatory
          C-terminal region containing a conserved tyr. They are
          activated by autophosphorylation at the tyr kinase
          domain, but are negatively regulated by phosphorylation
          at the C-terminal tyr by Csk (C-terminal Src Kinase).
          The SH3 domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 58

 Score = 34.6 bits (79), Expect = 6e-04
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
          LYD++  T +   +  ++GE+  +I  T  DWW+    ++GK  Y+P++YV
Sbjct: 6  LYDYEARTTED--LSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYV 54


>gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor
          protein.  Nck2 (also called Nckbeta or Growth factor
          receptor-bound protein 4, Grb4) plays a crucial role in
          connecting signaling pathways of tyrosine kinase
          receptors and important effectors in actin dynamics and
          cytoskeletal remodeling. It binds neuronal signaling
          proteins such as ephrinB and Disabled-1 (Dab-1)
          exclusively. Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2, which show partly
          overlapping functions but also bind distinct targets.
          The first SH3 domain of Nck2 binds the PxxDY sequence
          in the CD3e cytoplasmic tail; this binding inhibits
          phosphorylation by Src kinases, resulting in the
          downregulation of TCR surface expression. SH3 domains
          are protein interaction domains that usually bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially a PxxP motif. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 58

 Score = 34.7 bits (79), Expect = 6e-04
 Identities = 17/52 (32%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          V+  +DY+ +  + + I++ E+L+L+  + K WW+V  ++ +  YVP++YVE
Sbjct: 6  VIAKWDYTAQQDQELDIKKNERLWLLDDS-KTWWRVRNAANRTGYVPSNYVE 56


>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine
          Kinase.  Src (or c-Src) is a cytoplasmic (or
          non-receptor) PTK and is the vertebrate homolog of the
          oncogenic protein (v-Src) from Rous sarcoma virus.
          Together with other Src subfamily proteins, it is
          involved in signaling pathways that regulate cytokine
          and growth factor responses, cytoskeleton dynamics,
          cell proliferation, survival, and differentiation. Src
          also play a role in regulating cell adhesion, invasion,
          and motility in cancer cells, and tumor vasculature,
          contributing to cancer progression and metastasis.
          Elevated levels of Src kinase activity have been
          reported in a variety of human cancers. Several
          inhibitors of Src have been developed as anti-cancer
          drugs. Src is also implicated in acute inflammatory
          responses and osteoclast function. Src kinases contain
          an N-terminal SH4 domain with a myristoylation site,
          followed by SH3 and SH2 domains, a tyr kinase domain,
          and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 56

 Score = 34.3 bits (78), Expect = 8e-04
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
          +DY ++    +  ++GE+L ++  T  DWW     ++G+  Y+P++YV
Sbjct: 6  YDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYV 53


>gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor
          protein.  Nck1 (also called Nckalpha) plays a crucial
          role in connecting signaling pathways of tyrosine
          kinase receptors and important effectors in actin
          dynamics and cytoskeletal remodeling. It binds and
          activates RasGAP, resulting in the downregulation of
          Ras. It is also involved in the signaling of
          endothilin-mediated inhibition of cell migration. Nck
          adaptor proteins regulate actin cytoskeleton dynamics
          by linking proline-rich effector molecules to protein
          tyrosine kinases and phosphorylated signaling
          intermediates. They contain three SH3 domains and a
          C-terminal SH2 domain. They function downstream of the
          PDGFbeta receptor and are involved in Rho GTPase
          signaling and actin dynamics. Vertebrates contain two
          Nck adaptor proteins: Nck1 (also called Nckalpha) and
          Nck2, which show partly overlapping functions but also
          bind distinct targets. The first SH3 domain of Nck1
          binds the PxxDY sequence in the CD3e cytoplasmic tail;
          this binding inhibits phosphorylation by Src kinases,
          resulting in the downregulation of TCR surface
          expression. SH3 domains are protein interaction domains
          that usually bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially a PxxP motif.
          They play versatile and diverse roles in the cell
          including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 59

 Score = 34.3 bits (78), Expect = 8e-04
 Identities = 18/52 (34%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          V+  FDY  +  + + I++ E+L+L+  + K WW+V  +  K  +VP++YVE
Sbjct: 5  VVAKFDYVAQQDQELDIKKNERLWLLDDS-KSWWRVRNAMNKTGFVPSNYVE 55


>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and
          similar domains.  Bzz1 (or Bzz1p) is a
          WASP/Las17-interacting protein involved in endocytosis
          and trafficking to the vacuole. It physically interacts
          with type I myosins and functions in the early steps of
          endocytosis. Together with other proteins, it induces
          membrane scission in yeast. Bzz1 contains an N-terminal
          F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
          central coiled-coil, and two C-terminal SH3 domains.
          This model represents the first C-terminal SH3 domain.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 34.1 bits (79), Expect = 9e-04
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVEV 62
          KVLYD+  S  D   V I EGE++ +++  +   W  +R  SG+   VP SY+E+
Sbjct: 3  KVLYDYTASGDD--EVSISEGEEVTVLEPDDGSGWTKVRNGSGEEGLVPTSYIEI 55


>gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33.
          SNX33 interacts with Wiskott-Aldrich syndrome protein
          (WASP) and plays a role in the maintenance of cell
          shape and cell cycle progression. It modulates the
          shedding and endocytosis of cellular prion protein
          (PrP(c)) and amyloid precursor protein (APP). SNXs are
          Phox homology (PX) domain containing proteins that are
          involved in regulating membrane traffic and protein
          sorting in the endosomal system. SNX33 also contains
          BAR and SH3 domains. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 33.4 bits (76), Expect = 0.002
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
          + LY F    K+   + IQE E+L +  + + D W Q   S G+    PASYVE+
Sbjct: 3  RALYSFQSENKE--EINIQENEELVIFSENSLDGWLQGQNSRGETGLFPASYVEI 55


>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
          expressed in hepatocellular carcinoma).  Tec is a
          cytoplasmic (or nonreceptor) tyr kinase containing Src
          homology protein interaction domains (SH3, SH2)
          N-terminal to the catalytic tyr kinase domain. It also
          contains an N-terminal pleckstrin homology (PH) domain,
          which binds the products of PI3K and allows membrane
          recruitment and activation, and the Tec homology (TH)
          domain, which contains proline-rich and zinc-binding
          regions. It is more widely-expressed than other Tec
          subfamily kinases. Tec is found in endothelial cells,
          both B- and T-cells, and a variety of myeloid cells
          including mast cells, erythroid cells, platelets,
          macrophages and neutrophils. Tec is a key component of
          T-cell receptor (TCR) signaling, and is important in
          TCR-stimulated proliferation, IL-2 production and
          phospholipase C-gamma1 activation. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 33.6 bits (77), Expect = 0.002
 Identities = 13/47 (27%), Positives = 28/47 (59%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          +D+   +   +R++ GE+  +++K +  WW+     GK  Y+P++YV
Sbjct: 7  YDFQPTEPHDLRLETGEEYVILEKNDVHWWKARDKYGKEGYIPSNYV 53


>gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor
          Proteins.  SLAPs are adaptor proteins with limited
          similarity to Src family tyrosine kinases. They contain
          an N-terminal SH3 domain followed by an SH2 domain, and
          a unique C-terminal sequence. They function in
          regulating the signaling, ubiquitination, and
          trafficking of T-cell receptor (TCR) and B-cell
          receptor (BCR) components. Vertebrates contain two
          SLAPs, named SLAP (or SLA1) and SLAP2 (or SLA2). SLAP
          has been shown to interact with the EphA receptor,
          EpoR, Lck, PDGFR, Syk, CD79a, among others, while SLAP2
          interacts with CSF1R. Both SLAPs interact with c-Cbl,
          LAT, CD247, and Zap70. SLAP modulates TCR surface
          expression levels as well as surface and total BCR
          levels. As an adaptor to c-Cbl, SLAP increases the
          ubiquitination, intracellular retention, and targeted
          degradation of the BCR complex components. SLAP2 plays
          a role in c-Cbl-dependent regulation of CSF1R, a
          tyrosine kinase important for myeloid cell growth and
          differentiation. The SH3 domain of SLAP forms a complex
          with v-Abl. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 32.9 bits (75), Expect = 0.003
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
          TL  L D  Y +     + ++ GE L ++     DWW+V+   +G+  Y+P+ +V
Sbjct: 1  TLVALGD--YPSGGPAELSLRLGEPLTIVSD-EGDWWKVLSEVTGRESYIPSVHV 52


>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal
          peroxisomal membrane protein Pex13p.  Pex13p, located
          in the peroxisomal membrane, contains two transmembrane
          regions and a C-terminal SH3 domain. It binds to the
          peroxisomal targeting type I (PTS1) receptor Pex5p and
          the docking factor Pex14p through its SH3 domain. It is
          essential for both PTS1 and PTS2 protein import
          pathways into the peroxisomal matrix. Pex13p binds
          Pex14p, which contains a PxxP motif, in a classical
          fashion to the proline-rich ligand binding site of its
          SH3 domain. It binds the WxxxF/Y motif of Pex5p in a
          novel site that does not compete with Pex14p binding.
          SH3 domains are protein interaction domains that bind
          to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 60

 Score = 33.0 bits (76), Expect = 0.003
 Identities = 15/59 (25%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNK-----DWWQVIRSSGKPFYVPASYVEV 62
          + LYDF         + +++G+ + ++ KT+      +WW+     G+  + P++YVEV
Sbjct: 3  RALYDF-TPENPEMELSLKKGDIVAVLSKTDPLGRDSEWWKGRTRDGRIGWFPSNYVEV 60


>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase
          Activating Proteins 1, 2, and 3.  srGAP1, also called
          Rho GTPase-Activating Protein 13 (ARHGAP13), is a
          Cdc42- and RhoA-specific GAP and is expressed later in
          the development of central nervous system tissues.
          srGAP2 is expressed in zones of neuronal
          differentiation. It plays a role in the regeneration of
          neurons and axons. srGAP3, also called MEGAP (MEntal
          disorder associated GTPase-Activating Protein), is a
          Rho GAP with activity towards Rac1 and Cdc42. It
          impacts cell migration by regulating actin and
          microtubule cytoskeletal dynamics. The association
          between srGAP3 haploinsufficiency and mental
          retardation is under debate. srGAPs are Rho GAPs that
          interact with Robo1, the transmembrane receptor of Slit
          proteins. Slit proteins are secreted proteins that
          control axon guidance and the migration of neurons and
          leukocytes. srGAPs contain an N-terminal F-BAR domain,
          a Rho GAP domain, and a C-terminal SH3 domain. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 32.6 bits (74), Expect = 0.003
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          FDY  +  + +  ++G  L L  + + DWW+  R +G    VP  Y+ V
Sbjct: 6  FDYVGRSARELSFKKGASLLLYHRASDDWWEG-RHNGIDGLVPHQYIVV 53


>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3
          domain of Fungal Actin-binding protein 1.  Abp1 is an
          adaptor protein that functions in receptor-mediated
          endocytosis and vesicle trafficking. It contains an
          N-terminal actin-binding module, the
          actin-depolymerizing factor (ADF) homology domain, a
          central proline-rich region, and a C-terminal SH3
          domain (many yeast Abp1 proteins contain two C-terminal
          SH3 domains). Yeast Abp1 also contains two acidic
          domains that bind directly to the Arp2/3 complex, which
          is required to initiate actin polymerization. The SH3
          domain of yeast Abp1 binds and localizes the kinases,
          Ark1p and Prk1p, which facilitate actin patch
          disassembly following vesicle internalization. It also
          mediates the localization to the actin patch of the
          synaptojanin-like protein, Sjl2p, which plays a key
          role in endocytosis. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 32.8 bits (75), Expect = 0.003
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +DY   +   + + EGE +  I+  ++DWW    S G+    P++YVE+
Sbjct: 6  YDYEKDEDNEIELVEGEIVTNIEMVDEDWWMGTNSKGESGLFPSNYVEL 54


>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine
          kinase.  BTK is a cytoplasmic (or nonreceptor) tyr
          kinase containing Src homology protein interaction
          domains (SH3, SH2) N-terminal to the catalytic tyr
          kinase domain. It also contains an N-terminal
          pleckstrin homology (PH) domain, which binds the
          products of PI3K and allows membrane recruitment and
          activation, and the Tec homology (TH) domain with
          proline-rich and zinc-binding regions. Btk is expressed
          in B-cells, and a variety of myeloid cells including
          mast cells, platelets, neutrophils, and dendrictic
          cells. It interacts with a variety of partners, from
          cytosolic proteins to nuclear transcription factors,
          suggesting a diversity of functions. Stimulation of a
          diverse array of cell surface receptors, including
          antigen engagement of the B-cell receptor (BCR), leads
          to PH-mediated membrane translocation of Btk and
          subsequent phosphorylation by Src kinase and
          activation. Btk plays an important role in the life
          cycle of B-cells including their development,
          differentiation, proliferation, survival, and
          apoptosis. Mutations in Btk cause the primary
          immunodeficiency disease, X-linked agammaglobulinaemia
          (XLA) in humans. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 32.5 bits (74), Expect = 0.005
 Identities = 14/52 (26%), Positives = 36/52 (69%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          KV+  +DY+  + + +++++GE+  +++++N  WW+    +G+  Y+P++YV
Sbjct: 2  KVVALYDYTPMNAQDLQLRKGEEYVILEESNLPWWRARDKNGREGYIPSNYV 53


>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal
          endocytic adaptor protein Sla1p.  Sla1p facilitates
          endocytosis by playing a role as an adaptor protein in
          coupling components of the actin cytoskeleton to the
          endocytic machinery. It interacts with Abp1p, Las17p
          and Pan1p, which are activator proteins of
          actin-related protein 2/3 (Arp2/3). Sla1p contains
          multiple domains including three SH3 domains, a SAM
          (sterile alpha motif) domain, and a Sla1 homology
          domain 1 (SHD1), which binds to the NPFXD motif that is
          found in many integral membrane proteins such as the
          Golgi-localized Arf-binding protein Lsb5p and the
          P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 32.0 bits (73), Expect = 0.008
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR------SSGKPFYVPASY 59
           K LYD  Y  +    + IQE + L+L++K++ DWW+V               VPA+Y
Sbjct: 2  YKALYD--YEPQTEDELTIQEDDILYLLEKSDDDWWKVKLKVNSSDDDEPVGLVPATY 57


>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated
          guanine nucleotide Exchange Factor 2.  ASEF2, also
          called Spermatogenesis-associated protein 13 (SPATA13),
          is a GEF that localizes with actin at the leading edge
          of cells and is important in cell migration and
          adhesion dynamics. GEFs activate small GTPases by
          exchanging bound GDP for free GTP. ASEF2 can activate
          both Rac 1 and Cdc42, but only Rac1 activation is
          necessary for increased cell migration and adhesion
          turnover. Together with APC (adenomatous polyposis
          coli) and Neurabin2, a scaffold protein that binds
          F-actin, it is involved in regulating HGF-induced cell
          migration. ASEF2 contains a SH3 domain followed by
          RhoGEF (also called Dbl-homologous or DH) and
          Pleckstrin Homology (PH) domains. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 54

 Score = 31.6 bits (71), Expect = 0.008
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +D+ T D + +  + G+ + +++ +NKDWW   R+  +  + PAS+V +
Sbjct: 7  WDHVTMDDQELAFKAGDVIRVLEASNKDWWWG-RNEDREAWFPASFVRL 54


>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine
          kinase substrate (Tks) proteins.  Tks proteins are Src
          substrates and scaffolding proteins that play important
          roles in the formation of podosomes and invadopodia,
          the dynamic actin-rich structures that are related to
          cell migration and cancer cell invasion. Vertebrates
          contain two Tks proteins, Tks4 (Tyr kinase substrate
          with four SH3 domains) and Tks5 (Tyr kinase substrate
          with five SH3 domains), which display partially
          overlapping but non-redundant functions. Both associate
          with the ADAMs family of transmembrane
          metalloproteases, which function as sheddases and
          mediators of cell and matrix interactions. Tks5
          interacts with N-WASP and Nck, while Tks4 is essential
          for the localization of MT1-MMP (membrane-type 1 matrix
          metalloproteinase) to invadopodia. Tks proteins contain
          an N-terminal Phox homology (PX) domain and four or
          five SH3 domains. This model characterizes the third
          SH3 domain of Tks proteins. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 30.9 bits (70), Expect = 0.014
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +F  + +DG  +  Q+G+K+ +I K    WW V +  GK  + P+SY+E
Sbjct: 7  EFQATIQDG--ISFQKGQKVEVIDKNPSGWWYV-KIDGKEGWAPSSYIE 52


>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin,
          also called Sorbin and SH3 domain containing 3
          (Sorbs3).  Vinexin is also called Sorbs3, SH3P3, and
          SH3-containing adapter molecule 1 (SCAM-1). It is an
          adaptor protein containing one sorbin homology (SoHo)
          and three SH3 domains. Vinexin was first identified as
          a vinculin binding protein; it is co-localized with
          vinculin at cell-ECM and cell-cell adhesion sites.
          There are several splice variants of vinexin: alpha,
          which contains the SoHo and three SH3 domains and
          displays tissue-specific expression; and beta, which
          contains only the three SH3 domains and is widely
          expressed. Vinexin alpha stimulates the accumulation of
          F-actin at focal contact sites. Vinexin also promotes
          keratinocyte migration and wound healing. The SH3
          domains of vinexin have been reported to bind a number
          of ligands including vinculin, WAVE2, DLG5, Abl, and
          Cbl. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 56

 Score = 31.1 bits (70), Expect = 0.016
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 16 YSTKDGKYVRI--QEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
          Y+ K    V +  ++GE + LI+K N++W++  I  +G+    PASYV+V
Sbjct: 7  YTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQV 56


>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide
          Synthase TRaffic INducer.  Nostrin is expressed in
          endothelial and epithelial cells and is involved in the
          regulation, trafficking and targeting of endothelial
          NOS (eNOS). It facilitates the endocytosis of eNOS by
          coordinating the functions of dynamin and the
          Wiskott-Aldrich syndrome protein (WASP). Increased
          expression of Nostrin may be correlated to
          preeclampsia. Nostrin contains an N-terminal F-BAR
          domain and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 30.8 bits (70), Expect = 0.020
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
           + Y+      + +Q G+ + + +K +  WW     +GK    PA+YVE 
Sbjct: 5  LYSYTANREDELSLQPGDIIEVHEKQDDGWWLG-ELNGKKGIFPATYVEE 53


>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin
          (or Nephrocystin-1).  Nephrocystin contains an SH3
          domain involved in signaling pathways that regulate
          cell adhesion and cytoskeletal organization. It is a
          protein that in humans is associated with juvenile
          nephronophthisis, an inherited kidney disease
          characterized by renal fibrosis that lead to chronic
          renal failure in children. It is localized in cell-cell
          junctions in renal duct cells, and is known to interact
          with Ack1, an activated Cdc42-associated kinase. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 30.7 bits (70), Expect = 0.021
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
           L DF    +       ++GE L +I K    WW    S G    VP +Y++V
Sbjct: 4  ALSDFQAEQEGDLSF--KKGEVLRIISKRADGWWLAENSKGNRGLVPKTYLKV 54


>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
          Kinase.  Blk is a member of the Src subfamily of
          proteins, which are cytoplasmic (or non-receptor) PTKs.
          It is expressed specifically in B-cells and is involved
          in pre-BCR (B-cell receptor) signaling. Src kinases
          contain an N-terminal SH4 domain with a myristoylation
          site, followed by SH3 and SH2 domains, a tyr kinase
          domain, and a regulatory C-terminal region containing a
          conserved tyr. They are activated by
          autophosphorylation at the tyr kinase domain, but are
          negatively regulated by phosphorylation at the
          C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
          domain of Src kinases contributes to substrate
          recruitment by binding adaptor proteins/substrates, and
          regulation of kinase activity through an intramolecular
          interaction. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 30.6 bits (69), Expect = 0.021
 Identities = 15/49 (30%), Positives = 34/49 (69%), Gaps = 4/49 (8%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRS--SGKPFYVPASYV 60
          +D+   + + +++++GEKL ++K  + +WW + +S  +GK  Y+P++YV
Sbjct: 6  YDFVPSNERDLQLKKGEKLQVLKS-DGEWW-LAKSLTTGKEGYIPSNYV 52


>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase.
           CSK is a cytoplasmic (or nonreceptor) tyr kinase
          containing the Src homology domains, SH3 and SH2,
          N-terminal to the catalytic tyr kinase domain. They
          negatively regulate the activity of Src kinases that
          are anchored to the plasma membrane. To inhibit Src
          kinases, CSK is translocated to the membrane via
          binding to specific transmembrane proteins, G-proteins,
          or adaptor proteins near the membrane. CSK catalyzes
          the tyr phosphorylation of the regulatory C-terminal
          tail of Src kinases, resulting in their inactivation.
          It is expressed in a wide variety of tissues and plays
          a role, as a regulator of Src, in cell proliferation,
          survival, and differentiation, and consequently, in
          cancer development and progression. In addition, CSK
          also shows Src-independent functions. It is a critical
          component in G-protein signaling, and plays a role in
          cytoskeletal reorganization and cell migration. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 30.3 bits (69), Expect = 0.025
 Identities = 11/51 (21%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
          ++++    + +  ++G+ L ++  T KD  W++     G+   +PA+YV+ 
Sbjct: 8  YNFNGASEEDLPFKKGDILTIVAVT-KDPNWYKAKNKDGREGMIPANYVQK 57


>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor
          proteins.  This group contains the third SH3 domain of
          Nck, the first SH3 domain of Caenorhabditis elegans
          Ced-2 (Cell death abnormality protein 2), and similar
          domains. Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2 (also called Nckbeta or
          Growth factor receptor-bound protein 4, Grb4), which
          show partly overlapping functions but also bind
          distinct targets. Their SH3 domains are involved in
          recruiting downstream effector molecules, such as the
          N-WASP/Arp2/3 complex, which when activated induces
          actin polymerization that results in the production of
          pedestals, or protrusions of the plasma membrane. The
          third SH3 domain of Nck appears to prefer ligands with
          a PxAPxR motif. SH3 domains are protein interaction
          domains that usually bind to proline-rich ligands with
          moderate affinity and selectivity, preferentially a
          PxxP motif. Ced-2 is a cell corpse engulfment protein
          that interacts with Ced-5 in a pathway that regulates
          the activation of Ced-10, a Rac small GTPase.
          Length = 56

 Score = 30.4 bits (69), Expect = 0.026
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKT--NKDWWQVIRSSGKPFYVPASYVEV 62
          LY F     +   +  ++GE+L +I+K   + DWW+   + G    VP +YVEV
Sbjct: 5  LYPFTGENDEE--LSFEKGERLEIIEKPEDDPDWWKARNALGTTGLVPRNYVEV 56


>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated
          guanine nucleotide Exchange Factor.  ASEF, also called
          ARHGEF4, exists in an autoinhibited form and is
          activated upon binding of the tumor suppressor APC
          (adenomatous polyposis coli). GEFs activate small
          GTPases by exchanging bound GDP for free GTP. ASEF can
          activate Rac1 or Cdc42. Truncated ASEF, which is found
          in colorectal cancers, is constitutively active and has
          been shown to promote angiogenesis and cancer cell
          migration. ASEF contains a SH3 domain followed by
          RhoGEF (also called Dbl-homologous or DH) and
          Pleckstrin Homology (PH) domains. In its autoinhibited
          form, the SH3 domain of ASEF forms an extensive
          interface with the DH and PH domains, blocking the Rac
          binding site. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 73

 Score = 30.8 bits (69), Expect = 0.027
 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWW--QVIRSSGKPFYVPASYVEV 62
          +D+ T D + +  + G+ + ++  TNK+WW  +V+ S G   + PAS+V +
Sbjct: 24 WDHVTMDDQELGFKAGDVIEVMDATNKEWWWGRVLDSEG---WFPASFVRL 71


>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of
          the p67phox subunit of NADPH oxidase and similar
          proteins.  This subfamily is composed of p67phox, NADPH
          oxidase activator 1 (Noxa1), and similar proteins.
          p67phox, also called Neutrophil cytosol factor 2
          (NCF-2), and Noxa1 are homologs and are the cytosolic
          subunits of the phagocytic (Nox2) and nonphagocytic
          (Nox1) NADPH oxidase complexes, respectively. NADPH
          oxidase catalyzes the transfer of electrons from NADPH
          to oxygen during phagocytosis forming superoxide and
          reactive oxygen species. p67phox and Noxa1 play
          regulatory roles. p67phox contains N-terminal TPR,
          first SH3 (or N-terminal or central SH3), PB1, and
          C-terminal SH3 domains. Noxa1 has a similar domain
          architecture except it is lacking the N-terminal SH3
          domain. The TPR domain of both binds activated
          GTP-bound Rac, while the C-terminal SH3 domain of
          p67phox and Noxa1 binds the polyproline motif found at
          the C-terminus of p47phox and Noxo1, respectively. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 29.8 bits (67), Expect = 0.039
 Identities = 10/53 (18%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +V+    Y  +  + +  +EG+ + ++ + N+ W +   S G+    P  +V 
Sbjct: 1  QVVALHRYEAQGPEDLGFREGDTIDVLSEVNEAWLEG-HSDGRVGIFPKCFVV 52


>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine
          kinase substrate with four SH3 domains.  Tks4, also
          called SH3 and PX domain-containing protein 2B
          (SH3PXD2B) or HOFI, is a Src substrate and scaffolding
          protein that plays an important role in the formation
          of podosomes and invadopodia, the dynamic actin-rich
          structures that are related to cell migration and
          cancer cell invasion. It is required in the formation
          of functional podosomes, EGF-induced membrane ruffling,
          and lamellipodia generation. It plays an important role
          in cellular attachment and cell spreading. Tks4 is
          essential for the localization of MT1-MMP
          (membrane-type 1 matrix metalloproteinase) to
          invadopodia. It contains an N-terminal Phox homology
          (PX) domain and four SH3 domains. This model
          characterizes the second SH3 domain of Tks4. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 30.0 bits (67), Expect = 0.043
 Identities = 15/48 (31%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          + Y+ +D   + +++G  + +I+K  + WW+ IR  GK  + PASY++
Sbjct: 7  YPYTARDQDEINLEKGAVVEVIQKNLEGWWK-IRYQGKEGWAPASYLK 53


>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and
          SH3 domain containing 1 (Sorbs1), also called ponsin.
          Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
          associated protein). It is an adaptor protein
          containing one sorbin homology (SoHo) and three SH3
          domains. It binds Cbl and plays a major role in
          regulating the insulin signaling pathway by enhancing
          insulin-induced phosphorylation of Cbl. Sorbs1, like
          vinexin, localizes at cell-ECM and cell-cell adhesion
          sites where it binds vinculin, paxillin, and afadin. It
          may function in the control of cell motility. Other
          interaction partners of Sorbs1 include c-Abl, Sos,
          flotillin, Grb4, ataxin-7, filamin C, among others. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 29.5 bits (66), Expect = 0.051
 Identities = 12/49 (24%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          FD+  +  K + +Q+G+ +++ K+ +++W++     G+    P SY+E+
Sbjct: 7  FDFKAQTLKELPLQKGDIVYIYKQIDQNWYEG-EHHGRVGIFPRSYIEL 54


>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor
          proteins.  Abl interactor (Abi) proteins are adaptor
          proteins serving as binding partners and substrates of
          Abl tyrosine kinases. They are involved in regulating
          actin cytoskeletal reorganization and play important
          roles in membrane-ruffling, endocytosis, cell motility,
          and cell migration. They localize to sites of actin
          polymerization in epithelial adherens junction and
          immune synapses, as well as to the leading edge of
          lamellipodia. Vertebrates contain two Abi proteins,
          Abi1 and Abi2. Abi1 displays a wide expression pattern
          while Abi2 is highly expressed in the eye and brain.
          Abi proteins contain a homeobox homology domain, a
          proline-rich region, and a SH3 domain. The SH3 domain
          of Abi binds to a PxxP motif in Abl. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 29.6 bits (67), Expect = 0.052
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          KV+  +DY+      +  QEG+ +++ KK +  W++ +  +G     P +YVE
Sbjct: 1  KVVALYDYTADKDDELSFQEGDIIYVTKKNDDGWYEGV-LNGVTGLFPGNYVE 52


>gnl|CDD|227013 COG4667, COG4667, Predicted esterase of the alpha-beta hydrolase
           superfamily [General function prediction only].
          Length = 292

 Score = 31.2 bits (71), Expect = 0.061
 Identities = 18/72 (25%), Positives = 28/72 (38%), Gaps = 8/72 (11%)

Query: 24  VRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYVEVYKKLSNGNRNNVENINPTME 82
              Q+GE ++       +W  VIR SS  PFY     +     L  G       I+ ++ 
Sbjct: 124 TCRQDGEAVYYFLPDVFNWLDVIRASSAIPFYSEGVEINGKNYLDGG-------ISDSIP 176

Query: 83  KTRSYSEGNDKV 94
              +   G DK+
Sbjct: 177 VKEAIRLGADKI 188


>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan
          Actin-binding protein 1.  Abp1, also called
          drebrin-like protein, is an adaptor protein that
          functions in receptor-mediated endocytosis and vesicle
          trafficking. It contains an N-terminal actin-binding
          module, the actin-depolymerizing factor (ADF) homology
          domain, a helical domain, and a C-terminal SH3 domain.
          Mammalian Abp1, unlike yeast Abp1, does not contain an
          acidic domain that interacts with the Arp2/3 complex.
          It regulates actin dynamics indirectly by interacting
          with dynamin and WASP family proteins. Abp1 deficiency
          causes abnormal organ structure and function of the
          spleen, heart, and lung of mice. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 54

 Score = 29.3 bits (66), Expect = 0.064
 Identities = 13/48 (27%), Positives = 23/48 (47%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +DY   D   +    G+ +  I++ ++ WW+     G     PA+YVE
Sbjct: 6  YDYQAADDTEISFDPGDIITDIEQIDEGWWRGTGPDGTYGLFPANYVE 53


>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of
          Proline-Serine-Threonine Phosphatase-Interacting
          Protein 1.  PSTPIP1, also called CD2 Binding Protein 1
          (CD2BP1), is mainly expressed in hematopoietic cells.
          It is a binding partner of the cell surface receptor
          CD2 and PTP-PEST, a tyrosine phosphatase which
          functions in cell motility and Rac1 regulation. It also
          plays a role in the activation of the Wiskott-Aldrich
          syndrome protein (WASP), which couples actin
          rearrangement and T cell activation. Mutations in the
          gene encoding PSTPIP1 cause the autoinflammatory
          disorder known as PAPA (pyogenic sterile arthritis,
          pyoderma gangrenosum, and acne) syndrome. PSTPIP1
          contains an N-terminal F-BAR domain, PEST motifs, and a
          C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 29.3 bits (66), Expect = 0.073
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +DY+ ++   + I +G+ + +I+K    WW V R+  K   VP +Y+E
Sbjct: 6  YDYTAQEDDELSISKGDVVAVIEKGEDGWWTVERNGQKGL-VPGTYLE 52


>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
          GRB2-related adaptor protein.  GRAP is a GRB-2 like
          adaptor protein that is highly expressed in lymphoid
          tissues. It acts as a negative regulator of T cell
          receptor (TCR)-induced lymphocyte proliferation by
          downregulating the signaling to the Ras/ERK pathway. It
          has been identified as a regulator of TGFbeta signaling
          in diabetic kidney tubules and may have a role in the
          pathogenesis of the disease. GRAP contains an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. The C-terminal SH3 domains
          (SH3c) of the related proteins, GRB2 and GRAP2, have
          been shown to bind to classical PxxP motif ligands, as
          well as to non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 29.0 bits (65), Expect = 0.075
 Identities = 12/47 (25%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          +D+S +D   +  + G+ + ++   + +WW+  R SG+  + P +YV
Sbjct: 6  YDFSAEDPSQLSFRRGDIIEVLDCPDPNWWRG-RISGRVGFFPRNYV 51


>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein,
          Palmitoylated 5 (or MAGUK p55 subfamily member 5).
          MPP5, also called PALS1 (Protein associated with Lin7)
          or Nagie oko protein in zebrafish or Stardust in
          Drosophila, is a scaffolding protein which associates
          with Crumbs homolog 1 (CRB1), CRB2, or CRB3 through its
          PDZ domain and with PALS1-associated tight junction
          protein (PATJ) or multi-PDZ domain protein 1 (MUPP1)
          through its L27 domain. The resulting tri-protein
          complexes are core proteins of the Crumb complex, which
          localizes at tight junctions or subapical regions, and
          is involved in the maintenance of apical-basal polarity
          in epithelial cells and the morphogenesis and function
          of photoreceptor cells. MPP5 is critical for the proper
          stratification of the retina and is also expressed in T
          lymphocytes where it is important for TCR-mediated
          activation of NFkB. Drosophila Stardust exists in
          several isoforms, some of which show opposing functions
          in photoreceptor cells, which suggests that the
          relative ratio of different Crumbs complexes regulates
          photoreceptor homeostasis. MPP5 contains two L27
          domains followed by the core of three domains
          characteristic of MAGUK (membrane-associated guanylate
          kinase) proteins: PDZ, SH3, and guanylate kinase (GuK).
          In addition, it also contains the Hook (Protein 4.1
          Binding) motif in between the SH3 and GuK domains. The
          GuK domain in MAGUK proteins is enzymatically inactive;
          instead, the domain mediates protein-protein
          interactions and associates intramolecularly with the
          SH3 domain. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 63

 Score = 29.3 bits (66), Expect = 0.083
 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 7/42 (16%)

Query: 14 FDYSTKDGKYV-------RIQEGEKLFLIKKTNKDWWQVIRS 48
          FDY  +D  Y+         Q+G+ L +I + + +WWQ  R 
Sbjct: 6  FDYDPEDDPYIPCRELGLSFQKGDILHVISQEDPNWWQAYRE 47


>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper
          integration site-1 (AHI-1).  AHI-1, also called
          Jouberin, is expressed in high levels in the brain,
          gonad tissues, and skeletal muscle. It is an adaptor
          protein that interacts with the small GTPase Rab8a and
          regulates it distribution and function, affecting
          cilium formation and vesicle transport. Mutations in
          the AHI-1 gene can cause Joubert syndrome, a disorder
          characterized by brainstem malformations, cerebellar
          aplasia/hypoplasia, and retinal dystrophy. AHI-1
          variation is also associated with susceptibility to
          schizophrenia and type 2 diabetes mellitus progression.
          AHI-1 contains WD40 and SH3 domains. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 52

 Score = 29.0 bits (65), Expect = 0.086
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          +DY+      + I  G+ + ++ K N +WW     +G+  Y PA+YV
Sbjct: 6  YDYTANRSDELTIHRGDIIRVLYKDNDNWWFGSLVNGQQGYFPANYV 52


>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
          Growth factor receptor-bound protein 2 (GRB2) and
          related proteins.  This family includes the adaptor
          protein GRB2 and related proteins including Drosophila
          melanogaster Downstream of receptor kinase (DRK),
          Caenorhabditis elegans Sex muscle abnormal protein 5
          (Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
          and similar proteins. Family members contain an
          N-terminal SH3 domain, a central SH2 domain, and a
          C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
          signaling molecule that regulates the Ras pathway by
          linking tyrosine kinases to the Ras guanine nucleotide
          releasing protein Sos (son of sevenless), which
          converts Ras to the active GTP-bound state. GRAP2 plays
          an important role in T cell receptor (TCR) signaling by
          promoting the formation of the SLP-76:LAT complex,
          which couples the TCR to the Ras pathway. GRAP acts as
          a negative regulator of T cell receptor (TCR)-induced
          lymphocyte proliferation by downregulating the
          signaling to the Ras/ERK pathway. The C-terminal SH3
          domains (SH3c) of GRB2 and GRAP2 have been shown to
          bind to classical PxxP motif ligands, as well as to
          non-classical motifs. GRB2 SH3c binds Gab2
          (Grb2-associated binder 2) through epitopes containing
          RxxK motifs, while the SH3c of GRAP2 binds to the
          phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
          domains are protein interaction domains that typically
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 28.7 bits (65), Expect = 0.088
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          LYDF+   + G+ +  + G+ + ++  ++ DWW+     G+    PA+YV+ 
Sbjct: 5  LYDFN-PQEPGE-LEFRRGDIITVLDSSDPDWWKG-ELRGRVGIFPANYVQP 53


>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like
          Rho guanine nucleotide exchange factors.  Members of
          this family contain a SH3 domain followed by RhoGEF
          (also called Dbl-homologous or DH) and Pleckstrin
          Homology (PH) domains. They include the Rho guanine
          nucleotide exchange factors ARHGEF9, ASEF (also called
          ARHGEF4), ASEF2, and similar proteins. GEFs activate
          small GTPases by exchanging bound GDP for free GTP.
          ARHGEF9 specifically activates Cdc42, while both ASEF
          and ASEF2 can activate Rac1 and Cdc42. ARHGEF9 is
          highly expressed in the brain and it interacts with
          gephyrin, a postsynaptic protein associated with GABA
          and glycine receptors. ASEF plays a role in
          angiogenesis and cell migration. ASEF2 is important in
          cell migration and adhesion dynamics. ASEF exists in an
          autoinhibited form and is activated upon binding of the
          tumor suppressor APC (adenomatous polyposis coli),
          leading to the activation of Rac1 or Cdc42. In its
          autoinhibited form, the SH3 domain of ASEF forms an
          extensive interface with the DH and PH domains,
          blocking the Rac binding site. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 28.9 bits (65), Expect = 0.11
 Identities = 12/49 (24%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +D+ T D + +  + G+ + ++  ++KDWW       +  + PAS+V +
Sbjct: 6  WDHVTMDPEELGFKAGDVIEVLDMSDKDWWWG-SIRDEEGWFPASFVRL 53


>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and
          SH3 domain protein 1.  Lasp1 is a cytoplasmic protein
          that binds focal adhesion proteins and is involved in
          cell signaling, migration, and proliferation. It is
          overexpressed in several cancer cells including breast,
          ovarian, bladder, and liver. In cancer cells, it can be
          found in the nucleus; its degree of nuclear
          localization correlates with tumor size and poor
          prognosis. Lasp1 is a 36kD protein containing an
          N-terminal LIM domain, two nebulin repeats, and a
          C-terminal SH3 domain. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 59

 Score = 28.8 bits (64), Expect = 0.12
 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDW-WQVIRSSGKPFYVPASYVE 61
          +DY+  D   V  Q+G+ +  +++ +  W +  +  +G    +PA+YVE
Sbjct: 9  YDYNAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVE 57


>gnl|CDD|212943 cd12010, SH3_SLAP, Src homology 3 domain of Src-Like Adaptor
          Protein.  SLAP (or SLA1) modulates TCR surface
          expression levels as well as surface and total BCR
          levels. As an adaptor to c-Cbl, SLAP increases the
          ubiquitination, intracellular retention, and targeted
          degradation of the BCR complex components. SLAP has
          been shown to interact with the EphA receptor, EpoR,
          Lck, PDGFR, Syk, CD79a, c-Cbl, LAT, CD247, and Zap70,
          among others. SLAPs are adaptor proteins with limited
          similarity to Src family tyrosine kinases. They contain
          an N-terminal SH3 domain followed by an SH2 domain, and
          a unique C-terminal sequence. The SH3 domain of SLAP
          forms a complex with v-Abl. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 28.6 bits (64), Expect = 0.13
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIR-SSGKPFYVPASYV 60
           L VL D  Y + D        GEKL ++      WW+V    +G+  Y+P   V
Sbjct: 1  FLAVLAD--YPSPDISEPIFHMGEKLRVLSD-EGGWWKVRSLQTGRENYIPGKCV 52


>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase
          Activating Protein 4.  srGAP4, also called ARHGAP4, is
          highly expressed in hematopoietic cells and may play a
          role in lymphocyte differentiation. It is able to
          stimulate the GTPase activity of Rac1, Cdc42, and RhoA.
          In the nervous system, srGAP4 has been detected in
          differentiating neurites and may be involved in axon
          and dendritic growth. srGAPs are Rho GAPs that interact
          with Robo1, the transmembrane receptor of Slit
          proteins. Slit proteins are secreted proteins that
          control axon guidance and the migration of neurons and
          leukocytes. srGAPs contain an N-terminal F-BAR domain,
          a Rho GAP domain, and a C-terminal SH3 domain. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 28.7 bits (64), Expect = 0.14
 Identities = 10/31 (32%), Positives = 18/31 (58%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
          FDY+ +  + +  + G+ L L  K + DWW+
Sbjct: 8  FDYTGRTAQELSFKRGDVLLLHSKASSDWWR 38


>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth
          factor receptor kinase substrate 8 and similar
          proteins.  This group is composed of Eps8 and Eps8-like
          proteins including Eps8-like 1-3, among others. These
          proteins contain N-terminal Phosphotyrosine-binding
          (PTB), central SH3, and C-terminal effector domains.
          Eps8 binds either Abi1 (also called E3b1) or Rab5
          GTPase activating protein RN-tre through its SH3
          domain. With Abi1 and Sos1, it becomes part of a
          trimeric complex that is required to activate Rac.
          Together with RN-tre, it inhibits the internalization
          of EGFR. The SH3 domains of Eps8 and similar proteins
          recognize peptides containing a PxxDY motif, instead of
          the classical PxxP motif. SH3 domains are protein
          interaction domains that usually bind to proline-rich
          ligands with moderate affinity and selectivity. They
          play versatile and diverse roles in the cell including
          the regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 28.4 bits (64), Expect = 0.14
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVY 63
          +VLYDF  + ++ K + + +GE L ++  + + WW+V  S G+  YVP + +E Y
Sbjct: 3  RVLYDF--TARNSKELSVLKGEYLEVLDDS-RQWWKVRNSRGQVGYVPHNILEPY 54


>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18.
          SNX18 is localized to peripheral endosomal structures,
          and acts in a trafficking pathway that is
          clathrin-independent but relies on AP-1 and PACS1. It
          binds FIP5 and is required for apical lumen formation.
          It may also play a role in axonal elongation. SNXs are
          Phox homology (PX) domain containing proteins that are
          involved in regulating membrane traffic and protein
          sorting in the endosomal system. SNX18 also contains
          BAR and SH3 domains. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 28.4 bits (63), Expect = 0.15
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD-WWQVIRSSGKPFYVPASYVEV 62
          + LYDF  S   G+ + ++E E L L  + + + W + + S G     PASYVEV
Sbjct: 3  RALYDFR-SENPGE-ISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVEV 55


>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase
          Activating Proteins.  Slit-Robo GTPase Activating
          Proteins (srGAPs) are Rho GAPs that interact with
          Robo1, the transmembrane receptor of Slit proteins.
          Slit proteins are secreted proteins that control axon
          guidance and the migration of neurons and leukocytes.
          Vertebrates contain three isoforms of srGAPs
          (srGAP1-3), all of which are expressed during embryonic
          and early development in the nervous system but with
          different localization and timing. A fourth member has
          also been reported (srGAP4, also called ARHGAP4).
          srGAPs contain an N-terminal F-BAR domain, a Rho GAP
          domain, and a C-terminal SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 28.5 bits (64), Expect = 0.15
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          FDY+ +  + +  ++G+ L L ++ + DWW+  + +G+   VP  Y+
Sbjct: 6  FDYTGRSERELSFKKGDSLTLYRQVSDDWWRG-QLNGQDGLVPHKYI 51


>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain
          containing ring finger proteins.  This model represents
          the first SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
          POSHER), SH3RF3 (POSH2), and similar domains. Members
          of this family are scaffold proteins that function as
          E3 ubiquitin-protein ligases. They all contain an
          N-terminal RING finger domain and multiple SH3 domains;
          SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
          has three. SH3RF1 plays a role in calcium homeostasis
          through the control of the ubiquitin domain protein
          Herp. It may also have a role in regulating death
          receptor mediated and JNK mediated apoptosis. SH3RF3
          interacts with p21-activated kinase 2 (PAK2) and
          GTP-loaded Rac1. It may play a role in regulating JNK
          mediated apoptosis in certain conditions. SH3RF2 acts
          as an anti-apoptotic regulator of the JNK pathway by
          binding to and promoting the degradation of SH3RF1. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 28.5 bits (64), Expect = 0.15
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          K LY+  Y  K+   +  ++G+ + L K+ +++W+     +GK  + PASYV+V
Sbjct: 3  KALYN--YEGKEPGDLSFKKGDIILLRKRIDENWYHG-ECNGKQGFFPASYVQV 53


>gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor
          Protein 2.  SLAP2 plays a role in c-Cbl-dependent
          regulation of CSF1R, a tyrosine kinase important for
          myeloid cell growth and differentiation. It has been
          shown to interact with CSF1R, c-Cbl, LAT, CD247, and
          Zap70. SLAPs are adaptor proteins with limited
          similarity to Src family tyrosine kinases. They contain
          an N-terminal SH3 domain followed by an SH2 domain, and
          a unique C-terminal sequence. They function in
          regulating the signaling, ubiquitination, and
          trafficking of T-cell receptor (TCR) and B-cell
          receptor (BCR) components. The SH3 domain of SLAP forms
          a complex with v-Abl. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 55

 Score = 28.6 bits (64), Expect = 0.15
 Identities = 13/36 (36%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 26 IQEGEKLFLIKKTNKDWWQVIRS-SGKPFYVPASYV 60
          I+ GE+L ++ + + DWW+V  + +G+  Y+P++YV
Sbjct: 18 IRMGEQLTILSE-DGDWWKVSSAVTGRECYIPSNYV 52


>gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding
          protein 4.  SH3 domain-binding protein 4 (SH3BP4) is
          also called transferrin receptor trafficking protein
          (TTP). SH3BP4 is an endocytic accessory protein that
          interacts with endocytic proteins including clathrin
          and dynamin, and regulates the internalization of the
          transferrin receptor (TfR). SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 52

 Score = 28.1 bits (62), Expect = 0.17
 Identities = 11/47 (23%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          DY   +   ++  +G+ L+++  +  +WW    ++ +  Y+P+SYV+
Sbjct: 7  DYCPTNFTTLKFSKGDHLYVLDTSGGEWWYA-HNTTEMGYIPSSYVQ 52


>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2.
          Abi2 is highly expressed in the brain and eye. It
          regulates actin cytoskeletal reorganization at adherens
          junctions and dendritic spines, which is important in
          cell morphogenesis, migration, and cognitive function.
          Mice deficient with Abi2 show defects in orientation
          and migration of lens fibers, neuronal migration,
          dendritic spine morphology, as well as deficits in
          learning and memory. Abi proteins are adaptor proteins
          serving as binding partners and substrates of Abl
          tyrosine kinases. They are involved in regulating actin
          cytoskeletal reorganization and play important roles in
          membrane-ruffling, endocytosis, cell motility, and cell
          migration. Abi proteins contain a homeobox homology
          domain, a proline-rich region, and a SH3 domain. The
          SH3 domain of Abi binds to a PxxP motif in Abl. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 61

 Score = 28.1 bits (62), Expect = 0.20
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          KV+  +DY+      +  QEG  +++IKK +  W++ +  +G     P +YVE
Sbjct: 4  KVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVM-NGVTGLFPGNYVE 55


>gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3
          domain of the p67phox subunit of NADPH oxidase.
          p67phox, also called Neutrophil cytosol factor 2
          (NCF-2), is a cytosolic subunit of the phagocytic NADPH
          oxidase complex (also called Nox2 or gp91phox) which
          plays a crucial role in the cellular response to
          bacterial infection. NADPH oxidase catalyzes the
          transfer of electrons from NADPH to oxygen during
          phagocytosis forming superoxide and reactive oxygen
          species. p67phox plays a regulatory role and contains
          N-terminal TPR, first SH3 (or N-terminal or central
          SH3), PB1, and C-terminal SH3 domains. It binds, via
          its C-terminal SH3 domain, to a proline-rich region of
          p47phox and upon activation, this complex assembles
          with flavocytochrome b558, the Nox2-p22phox
          heterodimer. Concurrently, RacGTP translocates to the
          membrane and interacts with the TPR domain of p67phox,
          which leads to the activation of NADPH oxidase. The PB1
          domain of p67phox binds to its partner PB1 domain in
          p40phox, and this facilitates the assembly of
          p47phox-p67phox at the membrane. The N-terminal SH3
          domain increases the affinity of p67phox for the
          oxidase complex. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 27.9 bits (62), Expect = 0.21
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +VLY+F   TK+   +++  G  +F++KK   +W  V+  +GK   VP +++E
Sbjct: 3  RVLYEFVPETKE--ELQVLPGNIVFVLKKGTDNWATVV-FNGKKGLVPCNFLE 52


>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3
          domain of the p67phox subunit of NADPH oxidase.
          p67phox, also called Neutrophil cytosol factor 2
          (NCF-2), is a cytosolic subunit of the phagocytic NADPH
          oxidase complex (also called Nox2 or gp91phox) which
          plays a crucial role in the cellular response to
          bacterial infection. NADPH oxidase catalyzes the
          transfer of electrons from NADPH to oxygen during
          phagocytosis forming superoxide and reactive oxygen
          species. p67phox plays a regulatory role and contains
          N-terminal TPR, first SH3 (or N-terminal or central
          SH3), PB1, and C-terminal SH3 domains. It binds, via
          its C-terminal SH3 domain, to a proline-rich region of
          p47phox and upon activation, this complex assembles
          with flavocytochrome b558, the Nox2-p22phox
          heterodimer. Concurrently, RacGTP translocates to the
          membrane and interacts with the TPR domain of p67phox,
          which leads to the activation of NADPH oxidase. The PB1
          domain of p67phox binds to its partner PB1 domain in
          p40phox, and this facilitates the assembly of
          p47phox-p67phox at the membrane. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 27.8 bits (62), Expect = 0.21
 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +V+  F Y     + +  Q+G+ + ++ K N+DW +  +  GK    P+++VE
Sbjct: 1  QVVALFSYEASQPEDLEFQKGDVILVLSKVNEDWLEG-QCKGKIGIFPSAFVE 52


>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1.
          Abi1, also called e3B1, is a central regulator of actin
          cytoskeletal reorganization through interactions with
          many protein complexes. It is part of WAVE, a
          nucleation-promoting factor complex, that links Rac 1
          activation to actin polymerization causing lamellipodia
          protrusion at the plasma membrane. Abi1 interact with
          formins to promote protrusions at the leading edge of
          motile cells. It also is a target of alpha4 integrin,
          regulating membrane protrusions at sites of integrin
          engagement. Abi proteins are adaptor proteins serving
          as binding partners and substrates of Abl tyrosine
          kinases. They are involved in regulating actin
          cytoskeletal reorganization and play important roles in
          membrane-ruffling, endocytosis, cell motility, and cell
          migration. Abi proteins contain a homeobox homology
          domain, a proline-rich region, and a SH3 domain. The
          SH3 domain of Abi binds to a PxxP motif in Abl. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 59

 Score = 28.1 bits (62), Expect = 0.22
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          KV+  +DYS      +   EG  +++IKK +  W++ +  +G     P +YVE
Sbjct: 1  KVVAIYDYSKDKDDELSFMEGAIIYVIKKNDDGWYEGV-CNGVTGLFPGNYVE 52


>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor
          protein.  Nck2 (also called Nckbeta or Growth factor
          receptor-bound protein 4, Grb4) plays a crucial role in
          connecting signaling pathways of tyrosine kinase
          receptors and important effectors in actin dynamics and
          cytoskeletal remodeling. It binds neuronal signaling
          proteins such as ephrinB and Disabled-1 (Dab-1)
          exclusively. Nck adaptor proteins regulate actin
          cytoskeleton dynamics by linking proline-rich effector
          molecules to protein tyrosine kinases and
          phosphorylated signaling intermediates. They contain
          three SH3 domains and a C-terminal SH2 domain. They
          function downstream of the PDGFbeta receptor and are
          involved in Rho GTPase signaling and actin dynamics.
          Vertebrates contain two Nck adaptor proteins: Nck1
          (also called Nckalpha) and Nck2, which show partly
          overlapping functions but also bind distinct targets.
          The third SH3 domain of Nck appears to prefer ligands
          with a PxAPxR motif. SH3 domains are protein
          interaction domains that usually bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially a PxxP motif. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 59

 Score = 28.1 bits (62), Expect = 0.25
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
          ++ LY F   T++   +  ++GE + +I+K   D  WW+   S G+   VP +YV V
Sbjct: 3  VQTLYPFSSVTEE--ELNFEKGETMEVIEKPENDPEWWKCKNSRGQVGLVPKNYVVV 57


>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain.  SH3 (Src homology 3)
          domains are often indicative of a protein involved in
          signal transduction related to cytoskeletal
          organisation. First described in the Src cytoplasmic
          tyrosine kinase. The structure is a partly opened beta
          barrel.
          Length = 53

 Score = 27.8 bits (63), Expect = 0.27
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          FDY   D   + +++G+ + ++ K +  WW+  R  G+   VP+SYVE 
Sbjct: 6  FDYVATDPNELSLKKGDVVKVLDKDDNGWWEGER-GGRRGLVPSSYVEE 53


>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I
          fungal Myosins.  Type I myosins (myosin-I) are
          actin-dependent motors in endocytic actin structures
          and actin patches. They play roles in membrane traffic
          in endocytic and secretory pathways, cell motility, and
          mechanosensing. Saccharomyces cerevisiae has two
          myosins-I, Myo3 and Myo5, which are involved in
          endocytosis and the polarization of the actin
          cytoskeleton. Myosin-I contains an N-terminal
          actin-activated ATPase, a phospholipid-binding TH1
          (tail homology 1) domain, and a C-terminal extension
          which includes an F-actin-binding TH2 domain, an SH3
          domain, and an acidic peptide that participates in
          activating the Arp2/3complex. The SH3 domain of
          myosin-I is required for myosin-I-induced actin
          polymerization. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 27.7 bits (62), Expect = 0.29
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSG-KPFYVPASYVE 61
          T K LYDF  S  +   + +++ + +++++K +  WW   +    K  +VPA+Y+E
Sbjct: 1  TYKALYDFAGSVANE--LSLKKDDIVYIVQKEDNGWWLAKKLDESKEGWVPAAYLE 54


>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor
          protein.  Nck1 (also called Nckalpha) plays a crucial
          role in connecting signaling pathways of tyrosine
          kinase receptors and important effectors in actin
          dynamics and cytoskeletal remodeling. It binds and
          activates RasGAP, resulting in the downregulation of
          Ras. It is also involved in the signaling of
          endothilin-mediated inhibition of cell migration. Nck
          adaptor proteins regulate actin cytoskeleton dynamics
          by linking proline-rich effector molecules to protein
          tyrosine kinases and phosphorylated signaling
          intermediates. They contain three SH3 domains and a
          C-terminal SH2 domain. They function downstream of the
          PDGFbeta receptor and are involved in Rho GTPase
          signaling and actin dynamics. Vertebrates contain two
          Nck adaptor proteins: Nck1 (also called Nckalpha) and
          Nck2, which show partly overlapping functions but also
          bind distinct targets. The third SH3 domain of Nck
          appears to prefer ligands with a PxAPxR motif. SH3
          domains are protein interaction domains that usually
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially a PxxP motif. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 57

 Score = 27.7 bits (61), Expect = 0.31
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQVIRSSGKPFYVPASYVEV 62
           ++ LY F  S+ + + +  ++GE + +I+K   D  WW+  +++G+   VP +YV V
Sbjct: 2  VVQALYPF--SSSNDEELNFEKGEVMDVIEKPENDPEWWKCRKANGQVGLVPKNYVTV 57


>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain
          of NADPH oxidase (Nox) Organizing protein 1.  Nox
          Organizing protein 1 (NoxO1) is a critical regulator of
          enzyme kinetics of the nonphagocytic NADPH oxidase
          Nox1, which catalyzes the transfer of electrons from
          NADPH to molecular oxygen to form superoxide. Nox1 is
          expressed in colon, stomach, uterus, prostate, and
          vascular smooth muscle cells. NoxO1 is involved in
          targeting activator subunits (such as NoxA1) to Nox1.
          It is co-localized with Nox1 in the membranes of
          resting cells and directs the subcellular localization
          of Nox1. NoxO1 contains an N-terminal Phox homology
          (PX) domain, tandem SH3 domains (N-SH3 and C-SH3), and
          a C-terminal proline-rich region (PRR). This model
          characterizes the second SH3 domain (or C-SH3) of
          NoxO1. The tandem SH3 domains of NoxO1 interact with
          the PRR of p22phox, which also complexes with Nox1. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 27.3 bits (61), Expect = 0.35
 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 16 YSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
          Y  +    + +  G  + +++K++  WW +IR +G+  YVP+ Y
Sbjct: 8  YEAQKEDELSVPAGVVVEVLQKSDNGWW-LIRYNGRAGYVPSMY 50


>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating
          of p53 proteins (ASPP).  The ASPP family of proteins
          bind to important regulators of apoptosis (p53, Bcl-2,
          and RelA) and cell growth (APCL, PP1). They share
          similarity at their C-termini, where they harbor a
          proline-rich region, four ankyrin (ANK) repeats, and an
          SH3 domain. Vertebrates contain three members of the
          family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2
          activate the apoptotic function of the p53 family of
          tumor suppressors (p53, p63, and p73), while iASPP is
          an oncoprotein that specifically inhibits p53-induced
          apoptosis. The expression of ASPP proteins is altered
          in tumors; ASPP1 and ASPP2 are downregulated whereas
          iASPP is upregulated is some cancer types. ASPP
          proteins also bind and regulate protein phosphatase 1
          (PP1), and this binding is competitive with p53
          binding. The SH3 domain and the ANK repeats of ASPP
          contribute to the p53 binding site; they bind to the
          DNA binding domain of p53. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 27.3 bits (61), Expect = 0.36
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTN---KDWWQVIRSSGKPFYVPASY 59
          FDY  ++G  +  +EG++L +++K +    +WW   R + K  YVP + 
Sbjct: 7  FDYEAENGDELSFREGDELTVLRKGDDDETEWWWA-RLNDKEGYVPRNL 54


>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin,
          also called Sorbin and SH3 domain containing 3
          (Sorbs3).  Vinexin is also called Sorbs3, SH3P3, and
          SH3-containing adapter molecule 1 (SCAM-1). It is an
          adaptor protein containing one sorbin homology (SoHo)
          and three SH3 domains. Vinexin was first identified as
          a vinculin binding protein; it is co-localized with
          vinculin at cell-ECM and cell-cell adhesion sites.
          There are several splice variants of vinexin: alpha,
          which contains the SoHo and three SH3 domains and
          displays tissue-specific expression; and beta, which
          contains only the three SH3 domains and is widely
          expressed. Vinexin alpha stimulates the accumulation of
          F-actin at focal contact sites. Vinexin also promotes
          keratinocyte migration and wound healing. The SH3
          domains of vinexin have been reported to bind a number
          of ligands including vinculin, WAVE2, DLG5, Abl, and
          Cbl. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 27.2 bits (60), Expect = 0.39
 Identities = 15/49 (30%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          FD+  +  K + +Q+G+ +++ K+ +K+W +     G+    PA+YVEV
Sbjct: 7  FDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG-EHHGRVGIFPANYVEV 54


>gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3
          domain of the p47phox subunit of NADPH oxidase, also
          called Neutrophil Cytosolic Factor 1.  p47phox, or
          NCF1, is a cytosolic subunit of the phagocytic NADPH
          oxidase complex (also called Nox2 or gp91phox), which
          plays a key role in the ability of phagocytes to defend
          against bacterial infections. NADPH oxidase catalyzes
          the transfer of electrons from NADPH to oxygen during
          phagocytosis forming superoxide and reactive oxygen
          species. p47phox is required for activation of NADH
          oxidase and plays a role in translocation. It contains
          an N-terminal Phox homology (PX) domain, tandem SH3
          domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
          region, and a C-terminal proline-rich region (PRR).
          This model characterizes the second SH3 domain (or
          C-SH3) of p47phox. In its inactive state, the tandem
          SH3 domains interact intramolecularly with the
          autoinhibitory region; upon activation, the tandem SH3
          domains are exposed through a conformational change,
          resulting in their binding to the PRR of p22phox and
          the activation of NADPH oxidase. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 27.1 bits (60), Expect = 0.39
 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           Y+  +   + + EGE + +I K    WW V+R      Y P+ Y++
Sbjct: 7  AYTAVEEDELTLLEGEAIEVIHKLLDGWW-VVRKGEVTGYFPSMYLQ 52


>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox
          subunit of NADPH oxidase.  p40phox, also called
          Neutrophil cytosol factor 4 (NCF-4), is a cytosolic
          subunit of the phagocytic NADPH oxidase complex (also
          called Nox2 or gp91phox) which plays a crucial role in
          the cellular response to bacterial infection. NADPH
          oxidase catalyzes the transfer of electrons from NADPH
          to oxygen during phagocytosis forming superoxide and
          reactive oxygen species. p40phox positively regulates
          NADPH oxidase in both phosphatidylinositol-3-phosphate
          (PI3P)-dependent and PI3P-independent manner. It
          contains an N-terminal PX domain, a central SH3 domain,
          and a C-terminal PB1 domain that interacts with
          p67phox. The SH3 domain of p40phox binds to canonical
          polyproline and noncanonical motifs at the C-terminus
          of p47phox. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 27.1 bits (60), Expect = 0.42
 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
          FD++      +  + G+ +FL+ + NKDW +  +R +   F  P S+V++
Sbjct: 6  FDFTGNSKLELNFKAGDVIFLLSRVNKDWLEGTVRGATGIF--PLSFVKI 53


>gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine
          kinase substrate with five SH3 domains.  Tks5, also
          called SH3 and PX domain-containing protein 2A
          (SH3PXD2A) or Five SH (FISH), is a scaffolding protein
          and Src substrate that is localized in podosomes, which
          are electron-dense structures found in Src-transformed
          fibroblasts, osteoclasts, macrophages, and some
          invasive cancer cells. It binds and regulates some
          members of the ADAMs family of transmembrane
          metalloproteases, which function as sheddases and
          mediators of cell and matrix interactions. It is
          required for podosome formation, degradation of the
          extracellular matrix, and cancer cell invasion. Tks5
          contains an N-terminal Phox homology (PX) domain and
          five SH3 domains. This model characterizes the first
          SH3 domain of Tks5. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 27.4 bits (60), Expect = 0.44
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +Y  ++   + +Q GE + +I+K    WW  + ++ +  +VPA+Y+E
Sbjct: 7  NYEKQENSEISLQAGEVVDVIEKNESGWW-FVSTAEEQGWVPATYLE 52


>gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine
          kinase substrate with five SH3 domains.  Tks5, also
          called SH3 and PX domain-containing protein 2A
          (SH3PXD2A) or Five SH (FISH), is a scaffolding protein
          and Src substrate that is localized in podosomes, which
          are electron-dense structures found in Src-transformed
          fibroblasts, osteoclasts, macrophages, and some
          invasive cancer cells. It binds and regulates some
          members of the ADAMs family of transmembrane
          metalloproteases, which function as sheddases and
          mediators of cell and matrix interactions. It is
          required for podosome formation, degradation of the
          extracellular matrix, and cancer cell invasion. Tks5
          contains an N-terminal Phox homology (PX) domain and
          five SH3 domains. This model characterizes the second
          SH3 domain of Tks5. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 54

 Score = 26.9 bits (59), Expect = 0.48
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 16 YSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          Y+++    +  ++G  + +I+K  + WW  IR  GK  + PASY++
Sbjct: 9  YTSQGKDEIGFEKGVTVEVIQKNLEGWW-YIRYLGKEGWAPASYLK 53


>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal
          endocytic adaptor protein Sla1p.  Sla1p facilitates
          endocytosis by playing a role as an adaptor protein in
          coupling components of the actin cytoskeleton to the
          endocytic machinery. It interacts with Abp1p, Las17p
          and Pan1p, which are activator proteins of
          actin-related protein 2/3 (Arp2/3). Sla1p contains
          multiple domains including three SH3 domains, a SAM
          (sterile alpha motif) domain, and a Sla1 homology
          domain 1 (SHD1), which binds to the NPFXD motif that is
          found in many integral membrane proteins such as the
          Golgi-localized Arf-binding protein Lsb5p and the
          P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 52

 Score = 27.0 bits (60), Expect = 0.49
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
            K LYD+D  T++   +   EG+ L +   ++ DW  V  +  +  +VPA+Y+
Sbjct: 1  QAKALYDYDKQTEE--ELSFNEGDTLDVYDDSDSDWILVGFNGTQFGFVPANYI 52


>gnl|CDD|212956 cd12023, SH3_NoxO1_1, First or N-terminal Src homology 3 domain
          of Nox Organizing protein 1.  Nox Organizing protein 1
          (NoxO1) is a critical regulator of enzyme kinetics of
          the nonphagocytic NADPH oxidase Nox1, which catalyzes
          the transfer of electrons from NADPH to molecular
          oxygen to form superoxide. Nox1 is expressed in colon,
          stomach, uterus, prostate, and vascular smooth muscle
          cells. NoxO1 is involved in targeting activator
          subunits (such as NoxA1) to Nox1. It is co-localized
          with Nox1 in the membranes of resting cells and directs
          the subcellular localization of Nox1. NoxO1 contains an
          N-terminal Phox homology (PX) domain, tandem SH3
          domains (N-SH3 and C-SH3), and a C-terminal
          proline-rich region (PRR). This model characterizes the
          first SH3 domain (or N-SH3) of NoxO1. The tandem SH3
          domains of NoxO1 interact with the PRR of p22phox,
          which also complexes with Nox1. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 56

 Score = 27.1 bits (60), Expect = 0.51
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 2/49 (4%)

Query: 15 DYSTKD--GKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
           + TKD   K  +    E L ++ K    WW V     +  + PA Y+E
Sbjct: 7  PFETKDTKNKPFKAAAQESLDVLLKDPTGWWLVENEDRQIAWFPAPYLE 55


>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding
          protein Eve-1.  Eve-1, also called SH3
          domain-containing protein 19 (SH3D19) or EEN-binding
          protein (EBP), exists in multiple alternatively spliced
          isoforms. The longest isoform contains five SH3 domain
          in the C-terminal region and seven proline-rich motifs
          in the N-terminal region. It is abundantly expressed in
          skeletal muscle and heart, and may be involved in
          regulating the activity of ADAMs (A disintegrin and
          metalloproteases). Eve-1 interacts with EEN, an
          endophilin involved in endocytosis and may be the
          target of the MLL-EEN fusion protein that is implicated
          in leukemogenesis. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 50

 Score = 26.7 bits (59), Expect = 0.58
 Identities = 11/49 (22%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASY 59
          LYDF   T++   +  Q G+++ + +  + +W +  R +G+    P ++
Sbjct: 5  LYDFTGETEED--LSFQRGDRILVTEHLDAEWSRG-RLNGREGIFPRAF 50


>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine
          nucleotide exchange factor ARHGEF9.  ARHGEF9, also
          called PEM2 or collybistin, selectively activates Cdc42
          by exchanging bound GDP for free GTP. It is highly
          expressed in the brain and it interacts with gephyrin,
          a postsynaptic protein associated with GABA and glycine
          receptors. Mutations in the ARHGEF9 gene cause X-linked
          mental retardation with associated features like
          seizures, hyper-anxiety, aggressive behavior, and
          sensory hyperarousal. ARHGEF9 contains a SH3 domain
          followed by RhoGEF (also called Dbl-homologous or DH)
          and Pleckstrin Homology (PH) domains. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 62

 Score = 27.0 bits (59), Expect = 0.59
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWW--QVIRSSGKPFYVPASYVEVY 63
          +D+ T   + +  + G+ + ++  +NKDWW  Q+    G   + PAS+V ++
Sbjct: 11 WDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEG---WFPASFVRLW 59


>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain
          of VAV3 protein.  VAV3 is ubiquitously expressed and
          functions as a phosphorylation-dependent guanine
          nucleotide exchange factor (GEF) for RhoA, RhoG, and
          Rac1. It has been implicated to function in the
          hematopoietic, bone, cerebellar, and cardiovascular
          systems. VAV3 is essential in axon guidance in neurons
          that control blood pressure and respiration. It is
          overexpressed in prostate cancer cells and it plays a
          role in regulating androgen receptor transcriptional
          activity. VAV proteins contain several domains that
          enable their function: N-terminal calponin homology
          (CH), acidic, RhoGEF (also called Dbl-homologous or
          DH), Pleckstrin Homology (PH), C1 (zinc finger), SH2,
          and two SH3 domains. The SH3 domain of VAV is involved
          in the localization of proteins to specific sites
          within the cell, by interacting with proline-rich
          sequences within target proteins. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 56

 Score = 26.9 bits (59), Expect = 0.60
 Identities = 10/48 (20%), Positives = 27/48 (56%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +D+  +D + + + +G+ + +  K + + W     +G+  + P++YVE
Sbjct: 7  YDFCARDMRELSLLKGDVVKIYTKMSTNGWWRGEVNGRVGWFPSTYVE 54


>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
          of VAV1 protein.  VAV1 is expressed predominantly in
          the hematopoietic system and it plays an important role
          in the development and activation of B and T cells. It
          is activated by tyrosine phosphorylation to function as
          a guanine nucleotide exchange factor (GEF) for Rho
          GTPases following cell surface receptor activation,
          triggering various effects such as cytoskeletal
          reorganization, transcription regulation, cell cycle
          progression, and calcium mobilization. It also serves
          as a scaffold protein and has been shown to interact
          with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
          gene, ZAP-70, SLP76, and Syk, among others. VAV
          proteins contain several domains that enable their
          function: N-terminal calponin homology (CH), acidic,
          RhoGEF (also called Dbl-homologous or DH), Pleckstrin
          Homology (PH), C1 (zinc finger), SH2, and two SH3
          domains. The C-terminal SH3 domain of Vav1 interacts
          with a wide variety of proteins including cytoskeletal
          regulators (zyxin), RNA-binding proteins (Sam68),
          transcriptional regulators, viral proteins, and dynamin
          2. SH3 domains are protein interaction domains that
          bind to proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 26.8 bits (59), Expect = 0.60
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 14 FDYSTKDGKYVRIQEGEKL-FLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +D+  +D   + ++EG+ +  L KK  + WW+     G+  + PA+YVE
Sbjct: 6  YDFCARDRSELSLKEGDIIKILNKKGQQGWWRG-EIYGRVGWFPANYVE 53


>gnl|CDD|219191 pfam06822, DUF1235, Protein of unknown function (DUF1235).  This
           family contains a number of viral proteins of unknown
           function.
          Length = 265

 Score = 28.1 bits (63), Expect = 0.67
 Identities = 8/19 (42%), Positives = 12/19 (63%)

Query: 39  NKDWWQVIRSSGKPFYVPA 57
           N +W+ VI S G   Y+P+
Sbjct: 190 NGEWYTVITSGGNKLYIPS 208


>gnl|CDD|217151 pfam02624, YcaO, YcaO-like family. 
          Length = 332

 Score = 28.1 bits (63), Expect = 0.71
 Identities = 9/24 (37%), Positives = 12/24 (50%), Gaps = 1/24 (4%)

Query: 41 DWWQVIR-SSGKPFYVPASYVEVY 63
          +W       SG+  YVPA+ V V 
Sbjct: 75 EWVPGWDLLSGEEVYVPANLVYVS 98


>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and
          cysteine-rich domain-containing protein 2 (Stac2).
          Stac proteins are putative adaptor proteins that
          contain a cysteine-rich C1 domain and one or two SH3
          domains at the C-terminus. There are three mammalian
          members (Stac1, Stac2, and Stac3) of this family. Stac2
          contains a single SH3 domain at the C-terminus unlike
          Stac1 and Stac3, which contain two C-terminal SH3
          domains. Stac1 and Stac2 have been found to be
          expressed differently in mature dorsal root ganglia
          (DRG) neurons. Stac1 is mainly expressed in peptidergic
          neurons while Stac2 is found in a subset of
          nonpeptidergic and all trkB+ neurons. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 26.4 bits (58), Expect = 0.73
 Identities = 10/36 (27%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 26 IQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +Q G+++ ++  +N+DWW+  +S  +  + PA++V+
Sbjct: 18 LQPGDRVMVVDDSNEDWWKG-KSGDRVGFFPANFVQ 52


>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of
          SH3 and cysteine-rich domain-containing (Stac)
          proteins.  Stac proteins are putative adaptor proteins
          that contain a cysteine-rich C1 domain and one or two
          SH3 domains at the C-terminus. There are three
          mammalian members (Stac1, Stac2, and Stac3) of this
          family. Stac1 and Stac3 contain two SH3 domains while
          Stac2 contains a single SH3 domain at the C-terminus.
          This model represents the first C-terminal SH3 domain
          of Stac1 and Stac3, and the single C-terminal SH3
          domain of Stac2. Stac1 and Stac2 have been found to be
          expressed differently in mature dorsal root ganglia
          (DRG) neurons. Stac1 is mainly expressed in peptidergic
          neurons while Stac2 is found in a subset of
          nonpeptidergic and all trkB+ neurons. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 26.3 bits (58), Expect = 0.83
 Identities = 10/34 (29%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
          LY F    ++ + + ++ G+K+ L+  +N+DWW+
Sbjct: 5  LYKF--KPQENEDLEMRPGDKITLLDDSNEDWWK 36


>gnl|CDD|213011 cd12078, SH3_Tks4_3, Third Src homology 3 domain of Tyrosine
          kinase substrate with four SH3 domains.  Tks4, also
          called SH3 and PX domain-containing protein 2B
          (SH3PXD2B) or HOFI, is a Src substrate and scaffolding
          protein that plays an important role in the formation
          of podosomes and invadopodia, the dynamic actin-rich
          structures that are related to cell migration and
          cancer cell invasion. It is required in the formation
          of functional podosomes, EGF-induced membrane ruffling,
          and lamellipodia generation. It plays an important role
          in cellular attachment and cell spreading. Tks4 is
          essential for the localization of MT1-MMP
          (membrane-type 1 matrix metalloproteinase) to
          invadopodia. It contains an N-terminal Phox homology
          (PX) domain and four SH3 domains. This model
          characterizes the third SH3 domain of Tks4. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 26.2 bits (57), Expect = 0.98
 Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 13 DFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          DF  +  DG  +  Q G K+ +I+K    WW  I+   K  + PA++++
Sbjct: 7  DFQTTIPDG--ISFQAGLKVEVIEKNLSGWW-YIQIEDKEGWAPATFID 52


>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein,
          Palmitoylated 6 (or MAGUK p55 subfamily member 6).
          MPP6, also called Veli-associated MAGUK 1 (VAM-1) or
          PALS2, is a scaffolding protein that binds to Veli-1, a
          homolog of Caenorhabditis Lin-7. It is one of seven
          vertebrate homologs of the Drosophila Stardust protein,
          which is required in establishing cell polarity, and it
          contains two L27 domains followed by the core of three
          domains characteristic of MAGUK (membrane-associated
          guanylate kinase) proteins: PDZ, SH3, and guanylate
          kinase (GuK). In addition, it also contains the Hook
          (Protein 4.1 Binding) motif in between the SH3 and GuK
          domains. The GuK domain in MAGUK proteins is
          enzymatically inactive; instead, the domain mediates
          protein-protein interactions and associates
          intramolecularly with the SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 61

 Score = 26.2 bits (57), Expect = 1.1
 Identities = 8/39 (20%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 24 VRIQEGEKLFLIKKTNKDWWQV--IRSSGKPFYVPASYV 60
          ++  +GE L ++ + + +WWQ   ++  G    +P+ ++
Sbjct: 23 LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFL 61


>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie,
          If, and similar proteins.  Myosins Ie (MyoIe) and If
          (MyoIf) are nonmuscle, unconventional, long tailed,
          class I myosins containing an N-terminal motor domain
          and a myosin tail with TH1, TH2, and SH3 domains. MyoIe
          interacts with the endocytic proteins, dynamin and
          synaptojanin-1, through its SH3 domain; it may play a
          role in clathrin-dependent endocytosis. In the kidney,
          MyoIe is critical for podocyte function and normal
          glomerular filtration. Mutations in MyoIe is associated
          with focal segmental glomerulosclerosis, a disease
          characterized by massive proteinuria and progression to
          end-stage kidney disease. MyoIf is predominantly
          expressed in the immune system; it plays a role in
          immune cell motility and innate immunity. Mutations in
          MyoIf may be associated with the loss of hearing. The
          MyoIf gene has also been found to be fused to the MLL
          (Mixed lineage leukemia) gene in infant acute myeloid
          leukemias (AML). SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 53

 Score = 26.2 bits (58), Expect = 1.1
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          K LY +D   +D   +   EG+ + ++K+    WW   R  GK    P +YVE
Sbjct: 3  KALYAYD--AQDTDELSFNEGDIIEILKEDPSGWWTG-RLRGKEGLFPGNYVE 52


>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and
          SH3 domain containing (Sorbs) proteins and similar
          domains.  This family, also called the vinexin family,
          is composed predominantly of adaptor proteins
          containing one sorbin homology (SoHo) and three SH3
          domains. Members include the second SH3 domains of
          Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or
          Sorbs3), and similar domains. They are involved in the
          regulation of cytoskeletal organization, cell adhesion,
          and growth factor signaling. Members of this family
          bind multiple partners including signaling molecules
          like c-Abl, c-Arg, Sos, and c-Cbl, as well as
          cytoskeletal molecules such as vinculin and afadin.
          They may have overlapping functions. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 26.2 bits (58), Expect = 1.2
 Identities = 11/49 (22%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          ++++   G  +  ++G+ + L ++ +++W++  R  G+    P SYV+V
Sbjct: 6  YNFNADTGVELSFRKGDVITLTRRVDENWYEG-RIGGRQGIFPVSYVQV 53


>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and
          SH3 domain containing 2 (Sorbs2), also called
          Arg-binding protein 2 (ArgBP2).  Sorbs2 or ArgBP2 is an
          adaptor protein containing one sorbin homology (SoHo)
          and three SH3 domains. It regulates actin-dependent
          processes including cell adhesion, morphology, and
          migration. It is expressed in many tissues and is
          abundant in the heart. Like vinexin, it is found in
          focal adhesion where it interacts with vinculin and
          afadin. It also localizes in epithelial cell stress
          fibers and in cardiac muscle cell Z-discs. Sorbs2 has
          been implicated to play roles in the signaling of
          c-Arg, Akt, and Pyk2. Other interaction partners of
          Sorbs2 include c-Abl, flotillin, spectrin, dynamin 1/2,
          synaptojanin, PTP-PEST, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 57

 Score = 26.0 bits (57), Expect = 1.3
 Identities = 11/50 (22%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEV 62
          ++++      + +++G+++ L+K+ +++W++  I  + +    P SYVEV
Sbjct: 7  YNFNADTNVELSLRKGDRVVLLKQVDQNWYEGKIPGTNRQGIFPVSYVEV 56


>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called
          Resting lymphocyte kinase (Rlk).  TXK is a cytoplasmic
          (or nonreceptor) tyr kinase containing Src homology
          protein interaction domains (SH3, SH2) N-terminal to
          the catalytic tyr kinase domain. It also contains an
          N-terminal cysteine-rich region. Rlk is expressed in
          T-cells and mast cell lines, and is a key component of
          T-cell receptor (TCR) signaling. It is important in
          TCR-stimulated proliferation, IL-2 production and
          phospholipase C-gamma1 activation. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 55

 Score = 26.1 bits (57), Expect = 1.3
 Identities = 12/55 (21%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 6  VTLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          + +K LYDF    ++   + ++  E+  ++++ +  WW+     G    +P++YV
Sbjct: 1  IQVKALYDF--LPREPSNLALKRAEEYLILEQYDPHWWKARDRYGNEGLIPSNYV 53


>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain
          of the Nebulin family of proteins.  Nebulin family
          proteins contain multiple nebulin repeats, and may
          contain an N-terminal LIM domain and/or a C-terminal
          SH3 domain. They have molecular weights ranging from 34
          to 900 kD, depending on the number of nebulin repeats,
          and they all bind actin. They are involved in the
          regulation of actin filament architecture and function
          as stabilizers and scaffolds for cytoskeletal
          structures with which they associate, such as long
          actin filaments or focal adhesions. Nebulin family
          proteins that contain a C-terminal SH3 domain include
          the giant filamentous protein nebulin, nebulette,
          Lasp1, and Lasp2. Lasp2, also called LIM-nebulette, is
          an alternatively spliced variant of nebulette. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 25.7 bits (57), Expect = 1.3
 Identities = 14/49 (28%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVE 61
          +DY+  D   V  QEG+ +  ++  +  W +  ++ +G+   +PA+YVE
Sbjct: 6  YDYAAADDDEVSFQEGDVIINVEIIDDGWMEGTVQRTGQSGMLPANYVE 54


>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of
          SH3 and cysteine-rich domain-containing protein 3
          (Stac3).  Stac proteins are putative adaptor proteins
          that contain a cysteine-rich C1 domain and one or two
          SH3 domains at the C-terminus. There are three
          mammalian members (Stac1, Stac2, and Stac3) of this
          family. Stac1 and Stac3 contain two SH3 domains while
          Stac2 contains a single SH3 domain at the C-terminus.
          Stac1 and Stac2 have been found to be expressed
          differently in mature dorsal root ganglia (DRG)
          neurons. Stac1 is mainly expressed in peptidergic
          neurons while Stac2 is found in a subset of
          nonpeptidergic and all trkB+ neurons. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 26.0 bits (57), Expect = 1.3
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 11 LYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYV 60
          LY F    KD   +    GE++ +I  +N++WW+  +   K  Y P +++
Sbjct: 5  LYRFKALEKDD--LDFHPGERITVIDDSNEEWWRG-KIGEKTGYFPMNFI 51


>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and
          SH3 domain containing 2 (Sorbs2), also called
          Arg-binding protein 2 (ArgBP2).  Sorbs2 or ArgBP2 is an
          adaptor protein containing one sorbin homology (SoHo)
          and three SH3 domains. It regulates actin-dependent
          processes including cell adhesion, morphology, and
          migration. It is expressed in many tissues and is
          abundant in the heart. Like vinexin, it is found in
          focal adhesion where it interacts with vinculin and
          afadin. It also localizes in epithelial cell stress
          fibers and in cardiac muscle cell Z-discs. Sorbs2 has
          been implicated to play roles in the signaling of
          c-Arg, Akt, and Pyk2. Other interaction partners of
          Sorbs2 include c-Abl, flotillin, spectrin, dynamin 1/2,
          synaptojanin, PTP-PEST, among others. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 55

 Score = 25.7 bits (56), Expect = 1.5
 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          + +YDF   T   K +  ++G+ +++++K +++W++     G+    P SYVE
Sbjct: 4  RAVYDFKAQT--SKELSFKKGDTVYILRKIDQNWYEG-EHHGRVGIFPISYVE 53


>gnl|CDD|223368 COG0291, RpmI, Ribosomal protein L35 [Translation, ribosomal
          structure and biogenesis].
          Length = 65

 Score = 25.7 bits (57), Expect = 1.7
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 4/49 (8%)

Query: 18 TKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEVYKKL 66
          T  GK  R   G++  L KK+ K      R   K   V  + ++  K+L
Sbjct: 17 TGTGKIKRKHAGKRHILTKKSTKR----KRHLRKTAVVSKADLKRVKRL 61


>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain
          of the p47phox subunit of NADPH oxidase, also called
          Neutrophil Cytosolic Factor 1.  p47phox, or NCF1, is a
          cytosolic subunit of the phagocytic NADPH oxidase
          complex (also called Nox2 or gp91phox), which plays a
          key role in the ability of phagocytes to defend against
          bacterial infections. NADPH oxidase catalyzes the
          transfer of electrons from NADPH to oxygen during
          phagocytosis forming superoxide and reactive oxygen
          species. p47phox is required for activation of NADH
          oxidase and plays a role in translocation. It contains
          an N-terminal Phox homology (PX) domain, tandem SH3
          domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
          region, and a C-terminal proline-rich region (PRR).
          This model characterizes the first SH3 domain (or
          N-SH3) of p47phox. In its inactive state, the tandem
          SH3 domains interact intramolecularly with the
          autoinhibitory region; upon activation, the tandem SH3
          domains are exposed through a conformational change,
          resulting in their binding to the PRR of p22phox and
          the activation of NADPH oxidase. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 53

 Score = 25.7 bits (56), Expect = 1.7
 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          DY       + ++ G+ + +++K+   WW   +   K  +VPASY+E
Sbjct: 7  DYEKSSKSEMALKTGDVVEVVEKSENGWW-FCQLKAKRGWVPASYLE 52


>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3
          domain of Fungal Actin-binding protein 1.  Abp1 is an
          adaptor protein that functions in receptor-mediated
          endocytosis and vesicle trafficking. It contains an
          N-terminal actin-binding module, the
          actin-depolymerizing factor (ADF) homology domain, a
          central proline-rich region, and a C-terminal SH3
          domain (many yeast Abp1 proteins contain two C-terminal
          SH3 domains). Yeast Abp1 also contains two acidic
          domains that bind directly to the Arp2/3 complex, which
          is required to initiate actin polymerization. The SH3
          domain of yeast Abp1 binds and localizes the kinases,
          Ark1p and Prk1p, which facilitate actin patch
          disassembly following vesicle internalization. It also
          mediates the localization to the actin patch of the
          synaptojanin-like protein, Sjl2p, which plays a key
          role in endocytosis. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 53

 Score = 25.6 bits (56), Expect = 1.8
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 7  TLKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
            K LYD  Y   +   +   E +K+  I+  + DWW +    G     P++YVE
Sbjct: 1  WAKALYD--YDAAEDNELSFFENDKIINIEFVDDDWW-LGECHGSRGLFPSNYVE 52


>gnl|CDD|212825 cd11892, SH3_MIA2, Src Homology 3 domain of Melanoma Inhibitory
          Activity 2 protein.  MIA2 is expressed specifically in
          hepatocytes and its expression is controlled by
          hepatocyte nuclear factor 1 binding sites in the MIA2
          promoter. It inhibits the growth and invasion of
          hepatocellular carcinomas (HCC) and may act as a tumor
          suppressor. A mutation in MIA2 in mice resulted in
          reduced cholesterol and triglycerides. Since MIA2
          localizes to ER exit sites, it may function as an
          ER-to-Golgi trafficking protein that regulates lipid
          metabolism. MIA2 contains an N-terminal SH3-like
          domain, similar to MIA. It is a member of the recently
          identified family that also includes MIA, MIAL, and
          MIA3 (also called TANGO). MIA is a single domain
          protein that adopts a SH3 domain-like fold; it contains
          an additional antiparallel beta sheet and two disulfide
          bonds compared to classical SH3 domains. Unlike
          classical SH3 domains, MIA does not bind proline-rich
          ligands.
          Length = 73

 Score = 26.0 bits (57), Expect = 1.8
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKK---TNKDWWQVIRSSGKPF-YVPASYVEV 62
          DY   D +Y+  ++G+++ +  K     +D W    S+GK F Y P   V+V
Sbjct: 19 DYRGPDCRYLSFKKGDEIIVYYKLSGKREDLWA--GSTGKEFGYFPKDAVKV 68


>gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of
          Dynamin Binding Protein, also called Tuba, and similar
          domains.  DNMBP or Tuba is a cdc42-specific guanine
          nucleotide exchange factor (GEF) that contains four
          N-terminal SH3 domains, a central RhoGEF [or Dbl
          homology (DH)] domain followed by a Bin/Amphiphysin/Rvs
          (BAR) domain, and two C-terminal SH3 domains. It
          provides a functional link between dynamin, Rho GTPase
          signaling, and actin dynamics. It plays an important
          role in regulating cell junction configuration. The
          C-terminal SH3 domains of DNMBP bind to N-WASP and
          Ena/VASP proteins, which are key regulatory proteins of
          the actin cytoskeleton. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 57

 Score = 25.5 bits (56), Expect = 2.0
 Identities = 9/22 (40%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 39 NKDWWQVIRSSGKPFYVPASYV 60
          NK+WW +  ++G+  YVP++Y+
Sbjct: 35 NKEWW-LAEANGQKGYVPSNYI 55


>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine
          nucleotide exchange factors.  This subfamily is
          composed of the Saccharomyces cerevisiae guanine
          nucleotide exchange factors (GEFs) Sdc25 and Cdc25, and
          similar proteins. These GEFs regulate Ras by
          stimulating the GDP/GTP exchange on Ras. Cdc25 is
          involved in the Ras/PKA pathway that plays an important
          role in the regulation of metabolism, stress responses,
          and proliferation, depending on available nutrients and
          conditions. Proteins in this subfamily contain an
          N-terminal SH3 domain as well as REM (Ras exchanger
          motif) and RasGEF domains at the C-terminus. SH3
          domains bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs; they play a role in the regulation of enzymes
          by intramolecular interactions, changing the
          subcellular localization of signal pathway components
          and mediate multiprotein complex assemblies.
          Length = 55

 Score = 25.3 bits (56), Expect = 2.1
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 10 VLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ--VIRSSGK 51
           LYDF    K    +  + G+ ++++ K    WW   +I SSGK
Sbjct: 4  ALYDFT--PKSKNQLSFKAGDIIYVLNKDPSGWWDGVIISSSGK 45


>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and
          SH3 domain containing 1 (Sorbs1), also called ponsin.
          Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
          associated protein). It is an adaptor protein
          containing one sorbin homology (SoHo) and three SH3
          domains. It binds Cbl and plays a major role in
          regulating the insulin signaling pathway by enhancing
          insulin-induced phosphorylation of Cbl. Sorbs1, like
          vinexin, localizes at cell-ECM and cell-cell adhesion
          sites where it binds vinculin, paxillin, and afadin. It
          may function in the control of cell motility. Other
          interaction partners of Sorbs1 include c-Abl, Sos,
          flotillin, Grb4, ataxin-7, filamin C, among others. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 58

 Score = 25.3 bits (55), Expect = 2.3
 Identities = 11/52 (21%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 14 FDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ-VIRSSGKPFYVPASYVEVYK 64
          F+++      +  ++GE++ L+++ +++W++  I  + +    P +YV+V K
Sbjct: 7  FNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIK 58


>gnl|CDD|203750 pfam07738, Sad1_UNC, Sad1 / UNC-like C-terminal.  The C. elegans
           UNC-84 protein is a nuclear envelope protein that is
           involved in nuclear anchoring and migration during
           development. The S. pombe Sad1 protein localises at the
           spindle pole body. UNC-84 and and Sad1 share a common
           C-terminal region, that is often termed the SUN (Sad1
           and UNC) domain. In mammals, the SUN domain is present
           in two proteins, Sun1 and Sun2. The SUN domain of Sun2
           has been demonstrated to be in the periplasm.
          Length = 135

 Score = 26.1 bits (58), Expect = 3.0
 Identities = 5/36 (13%), Positives = 11/36 (30%), Gaps = 5/36 (13%)

Query: 33  FLIKKTNKDWWQVIRSS-----GKPFYVPASYVEVY 63
           F ++     W + ++       G   Y       V+
Sbjct: 97  FQLENPPDIWVKYVKLRILSNYGNEHYTCLYRFRVH 132


>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or
          SH3E) of Intersectin-2.  Intersectin-2 (ITSN2) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN2 also functions as a
          specific GEF for Cdc42 activation in epithelial
          morphogenesis, and is required in mitotic spindle
          orientation. It exists in alternatively spliced short
          and long isoforms. The short isoform contains two Eps15
          homology domains (EH1 and EH2), a coiled-coil region
          and five SH3 domains (SH3A-E), while the long isoform,
          in addition, contains RhoGEF (also called
          Dbl-homologous or DH), Pleckstrin homology (PH) and C2
          domains. The fifth SH3 domain (or SH3E) of ITSN2 is
          expected to bind protein partners, similar to ITSN1
          which has been shown to bind many protein partners
          including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
          N-WASP, and synaptojanin-1, among others. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 24.9 bits (54), Expect = 3.1
 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +V+  +DY+  +   +   +G+ + ++ K + DWWQ    +G     P++YV++
Sbjct: 2  QVIAMYDYTANNEDELSFSKGQLINVLNKDDPDWWQG-EINGVTGLFPSNYVKM 54


>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
          Adaptor Molecule 2.  STAM2, also called EAST (Epidermal
          growth factor receptor-associated protein with SH3 and
          TAM domain) or Hbp (Hrs binding protein), is part of
          the endosomal sorting complex required for transport
          (ESCRT-0). It plays a role in sorting mono-ubiquinated
          endosomal cargo for trafficking to the lysosome for
          degradation. It is also involved in the regulation of
          exocytosis. STAMs were discovered as proteins that are
          highly phosphorylated following cytokine and growth
          factor stimulation. They function in cytokine signaling
          and surface receptor degradation, as well as regulate
          Golgi morphology. They associate with many proteins
          including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH,
          and UBPY. STAM adaptor proteins contain VHS (Vps27,
          Hrs, STAM homology), ubiquitin interacting (UIM), and
          SH3 domains. SH3 domains are protein interaction
          domains that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 57

 Score = 25.0 bits (54), Expect = 3.2
 Identities = 9/37 (24%), Positives = 24/37 (64%), Gaps = 2/37 (5%)

Query: 8  LKVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQ 44
          ++ LYDF+ + +D + +  + GE + ++  ++ +WW+
Sbjct: 4  VRALYDFE-AVEDNE-LTFKHGEIIIVLDDSDANWWK 38


>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of
          CD2-associated protein and similar proteins.  This
          subfamily is composed of the third SH3 domain (SH3C) of
          CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
          similar domains. CD2AP and CIN85 are adaptor proteins
          that bind to protein partners and assemble complexes
          that have been implicated in T cell activation, kidney
          function, and apoptosis of neuronal cells. They also
          associate with endocytic proteins, actin cytoskeleton
          components, and other adaptor proteins involved in
          receptor tyrosine kinase (RTK) signaling. CD2AP and the
          main isoform of CIN85 contain three SH3 domains, a
          proline-rich region, and a C-terminal coiled-coil
          domain. All of these domains enable CD2AP and CIN85 to
          bind various protein partners and assemble complexes
          that have been implicated in many different functions.
          SH3C of both proteins have been shown to bind to
          ubiquitin. SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 55

 Score = 24.6 bits (54), Expect = 3.4
 Identities = 11/38 (28%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKD--WWQ 44
          +VL  FDY  ++   + ++EG+ + ++ K  +D  WW+
Sbjct: 3  RVL--FDYEAENEDELTLREGDIVTILSKDCEDKGWWK 38


>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or
          SH3E) of Intersectin-1.  Intersectin-1 (ITSN1) is an
          adaptor protein that functions in exo- and endocytosis,
          actin cytoskeletal reorganization, and signal
          transduction. It plays a role in clathrin-coated pit
          (CCP) formation. It binds to many proteins through its
          multidomain structure and facilitate the assembly of
          multimeric complexes. ITSN1 localizes in membranous
          organelles, CCPs, the Golgi complex, and may be
          involved in the cell membrane trafficking system. It
          exists in alternatively spliced short and long
          isoforms. The short isoform contains two Eps15 homology
          domains (EH1 and EH2), a coiled-coil region and five
          SH3 domains (SH3A-E), while the long isoform, in
          addition, contains RhoGEF (also called Dbl-homologous
          or DH), Pleckstrin homology (PH) and C2 domains. The
          fifth SH3 domain (or SH3E) of ITSN1 has been shown to
          bind many protein partners including SGIP1, Sos1,
          dynamin1/2, CIN85, c-Cbl, SHIP2, N-WASP, and
          synaptojanin-1, among others. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 54

 Score = 24.5 bits (53), Expect = 4.2
 Identities = 12/54 (22%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +V+  +DY+ ++   +   +G+ + ++ K + DWW+    +G+    P++YV++
Sbjct: 2  QVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKG-ELNGQVGLFPSNYVKL 54


>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane
          Protein, Palmitoylated 1 (or MAGUK p55 subfamily member
          1)-like proteins.  This subfamily includes MPP1, CASK
          (Calcium/calmodulin-dependent Serine protein Kinase),
          Caenorhabditis elegans lin-2, and similar proteins.
          MPP1 and CASK are scaffolding proteins from the MAGUK
          (membrane-associated guanylate kinase) protein family,
          which is characterized by the presence of a core of
          three domains: PDZ, SH3, and guanylate kinase (GuK). In
          addition, they also have the Hook (Protein 4.1 Binding)
          motif in between the SH3 and GuK domains. The GuK
          domain in MAGUK proteins is enzymatically inactive;
          instead, the domain mediates protein-protein
          interactions and associates intramolecularly with the
          SH3 domain. CASK and lin-2 also contain an N-terminal
          calmodulin-dependent kinase (CaMK)-like domain and two
          L27 domains. MPP1 is ubiquitously-expressed and plays
          roles in regulating neutrophil polarity, cell shape,
          hair cell development, and neural development and
          patterning of the retina. CASK is highly expressed in
          the mammalian nervous system and plays roles in
          synaptic protein targeting, neural development, and
          gene expression regulation. SH3 domains are protein
          interaction domains that bind to proline-rich ligands
          with moderate affinity and selectivity, preferentially
          to PxxP motifs. They play versatile and diverse roles
          in the cell including the regulation of enzymes,
          changing the subcellular localization of signaling
          pathway components, and mediating the formation of
          multiprotein complex assemblies.
          Length = 62

 Score = 24.7 bits (54), Expect = 4.6
 Identities = 11/39 (28%), Positives = 17/39 (43%), Gaps = 7/39 (17%)

Query: 14 FDYSTKDGKYVRIQE-------GEKLFLIKKTNKDWWQV 45
          FDY       +  Q+       G+ L +I K + +WWQ 
Sbjct: 6  FDYDPSKDDLIPCQQAGIAFKTGDILQIISKDDHNWWQA 44


>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain
          containing ring finger proteins.  This model represents
          the second SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
          POSHER), SH3RF3 (POSH2), and similar domains. Members
          of this family are scaffold proteins that function as
          E3 ubiquitin-protein ligases. They all contain an
          N-terminal RING finger domain and multiple SH3 domains;
          SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
          has three. SH3RF1 plays a role in calcium homeostasis
          through the control of the ubiquitin domain protein
          Herp. It may also have a role in regulating death
          receptor mediated and JNK mediated apoptosis. SH3RF3
          interacts with p21-activated kinase 2 (PAK2) and
          GTP-loaded Rac1. It may play a role in regulating JNK
          mediated apoptosis in certain conditions. SH3RF2 acts
          as an anti-apoptotic regulator of the JNK pathway by
          binding to and promoting the degradation of SH3RF1. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 24.2 bits (53), Expect = 5.0
 Identities = 10/35 (28%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 9  KVLYDFDYSTKDGK-YVRIQEGEKLFLIKKTNKDW 42
          K LYDF+   +D K  +  ++G+ + +I++ +++W
Sbjct: 3  KALYDFEMKDEDEKDCLTFKKGDVITVIRRVDENW 37


>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein,
          Palmitoylated (or MAGUK p55 subfamily member) proteins.
           The MPP/p55 subfamily of MAGUK (membrane-associated
          guanylate kinase) proteins includes at least eight
          vertebrate members (MPP1-7 and CASK), four Drosophila
          proteins (Stardust, Varicose, CASK and Skiff), and
          other similar proteins; they all contain one each of
          the core of three domains characteristic of MAGUK
          proteins: PDZ, SH3, and guanylate kinase (GuK). In
          addition, most members except for MPP1 contain
          N-terminal L27 domains and some also contain a Hook
          (Protein 4.1 Binding) motif in between the SH3 and GuK
          domains. CASK has an additional calmodulin-dependent
          kinase (CaMK)-like domain at the N-terminus. Members of
          this subfamily are scaffolding proteins that play
          important roles in regulating and establishing cell
          polarity, cell adhesion, and synaptic targeting and
          transmission, among others. The GuK domain in MAGUK
          proteins is enzymatically inactive; instead, the domain
          mediates protein-protein interactions and associates
          intramolecularly with the SH3 domain. SH3 domains are
          protein interaction domains that bind to proline-rich
          ligands with moderate affinity and selectivity,
          preferentially to PxxP motifs. They play versatile and
          diverse roles in the cell including the regulation of
          enzymes, changing the subcellular localization of
          signaling pathway components, and mediating the
          formation of multiprotein complex assemblies.
          Length = 61

 Score = 24.5 bits (54), Expect = 5.5
 Identities = 9/41 (21%), Positives = 20/41 (48%), Gaps = 7/41 (17%)

Query: 14 FDYSTKDGKYVRIQE-------GEKLFLIKKTNKDWWQVIR 47
          FDY  ++   +  +E       G+ L ++ + + +WWQ  +
Sbjct: 6  FDYDPEEDPLIPCKEAGLSFKKGDILQIVNQDDPNWWQARK 46


>gnl|CDD|225789 COG3250, LacZ, Beta-galactosidase/beta-glucuronidase
          [Carbohydrate transport and metabolism].
          Length = 808

 Score = 25.5 bits (56), Expect = 5.9
 Identities = 7/50 (14%), Positives = 16/50 (32%), Gaps = 2/50 (4%)

Query: 38 TNKDWWQVIRSSGKPFYVPASYVE--VYKKLSNGNRNNVENINPTMEKTR 85
            + W + + S  +   VP ++ +   Y +    N      + P      
Sbjct: 30 VPQRWPESLLSESRAIAVPGNWQDQGEYDRPIYTNVWYPREVFPPKVPAG 79


>gnl|CDD|213008 cd12075, SH3_Tks4_1, First Src homology 3 domain of Tyrosine
          kinase substrate with four SH3 domains.  Tks4, also
          called SH3 and PX domain-containing protein 2B
          (SH3PXD2B) or HOFI, is a Src substrate and scaffolding
          protein that plays an important role in the formation
          of podosomes and invadopodia, the dynamic actin-rich
          structures that are related to cell migration and
          cancer cell invasion. It is required in the formation
          of functional podosomes, EGF-induced membrane ruffling,
          and lamellipodia generation. It plays an important role
          in cellular attachment and cell spreading. Tks4 is
          essential for the localization of MT1-MMP
          (membrane-type 1 matrix metalloproteinase) to
          invadopodia. It contains an N-terminal Phox homology
          (PX) domain and four SH3 domains. This model
          characterizes the first SH3 domain of Tks4. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 55

 Score = 24.3 bits (52), Expect = 6.5
 Identities = 10/47 (21%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 15 DYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +Y  ++   + +  G+ + +I+K    WW  + ++ +  +VPA+ +E
Sbjct: 8  NYQKQESSEISLYVGQVVDIIEKNESGWW-FVSTADEQGWVPATCLE 53


>gnl|CDD|234204 TIGR03423, pbp2_mrdA, penicillin-binding protein 2.  Members of
          this protein family are penicillin-binding protein 2
          (PBP-2), a protein whose gene (designated pbpA or mrdA)
          generally is found next to the gene for RodA, a protein
          required for rod (bacillus) shape in many bacteria.
          PBP-2 acts as a transpeptidase for cell elongation
          (hence, rod-shape) [Cell envelope, Biosynthesis and
          degradation of murein sacculus and peptidoglycan].
          Length = 592

 Score = 25.2 bits (56), Expect = 7.8
 Identities = 8/20 (40%), Positives = 9/20 (45%)

Query: 61 EVYKKLSNGNRNNVENINPT 80
          E Y  LS  NR  +  I P 
Sbjct: 30 EEYATLSEDNRIRLVPIPPP 49


>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
          of Intersectin.  Intersectins (ITSNs) are adaptor
          proteins that function in exo- and endocytosis, actin
          cytoskeletal reorganization, and signal transduction.
          They are essential for initiating clathrin-coated pit
          formation. They bind to many proteins through their
          multidomain structure and facilitate the assembly of
          multimeric complexes. Vertebrates contain two ITSN
          proteins, ITSN1 and ITSN2, which exist in alternatively
          spliced short and long isoforms. The short isoforms
          contain two Eps15 homology domains (EH1 and EH2), a
          coiled-coil region and five SH3 domains (SH3A-E), while
          the long isoforms, in addition, contain RhoGEF (also
          called Dbl-homologous or DH), Pleckstrin homology (PH)
          and C2 domains. ITSN1 and ITSN2 are both widely
          expressed, with variations depending on tissue type and
          stage of development. The fifth SH3 domain (or SH3E) of
          ITSN1 has been shown to bind many protein partners
          including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
          N-WASP, and synaptojanin-1, among others. SH3 domains
          are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 53

 Score = 23.9 bits (52), Expect = 8.0
 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 9  KVLYDFDYSTKDGKYVRIQEGEKLFLIKKTNKDWWQVIRSSGKPFYVPASYVEV 62
          +V+  F Y+ ++   +  Q+G+ + ++ K + DWW+    +G+    P++YVE 
Sbjct: 1  QVIALFPYTAQNEDELSFQKGDIINVLSKDDPDWWRG-ELNGQTGLFPSNYVEP 53


>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog
          4.  DLG4, also called postsynaptic density-95 (PSD95)
          or synapse-associated protein 90 (SAP90), is a
          scaffolding protein that clusters at synapses and plays
          an important role in synaptic development and
          plasticity. It is responsible for the membrane
          clustering and retention of many transporters and
          receptors such as potassium channels and PMCA4b, a
          P-type ion transport ATPase, among others. DLG4 is a
          member of the MAGUK (membrane-associated guanylate
          kinase) protein family, which is characterized by the
          presence of a core of three domains: PDZ, SH3, and
          guanylate kinase (GuK). The GuK domain in MAGUK
          proteins is enzymatically inactive; instead, the domain
          mediates protein-protein interactions and associates
          intramolecularly with the SH3 domain. DLG4 contains
          three PDZ domains. The SH3 domain of DLG4 binds and
          clusters the kainate subgroup of glutamate receptors
          via two proline-rich sequences in their C-terminal
          tail. It also binds AKAP79/150 (A-kinase anchoring
          protein). SH3 domains are protein interaction domains
          that bind to proline-rich ligands with moderate
          affinity and selectivity, preferentially to PxxP
          motifs. They play versatile and diverse roles in the
          cell including the regulation of enzymes, changing the
          subcellular localization of signaling pathway
          components, and mediating the formation of multiprotein
          complex assemblies.
          Length = 66

 Score = 24.1 bits (52), Expect = 9.0
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 5/44 (11%)

Query: 8  LKVLYDFDYSTKD----GKYVRIQEGEKLFLIKKTNKDWWQVIR 47
          ++ L+D+D  TKD     + +  + G+ L +I   +++WWQ  R
Sbjct: 4  IRALFDYD-KTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARR 46


>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain
          of VAV proteins.  VAV proteins function both as
          cytoplasmic guanine nucleotide exchange factors (GEFs)
          for Rho GTPases and scaffold proteins and they play
          important roles in cell signaling by coupling cell
          surface receptors to various effector functions. They
          play key roles in processes that require cytoskeletal
          reorganization including immune synapse formation,
          phagocytosis, cell spreading, and platelet aggregation,
          among others. Vertebrates have three VAV proteins
          (VAV1, VAV2, and VAV3). VAV proteins contain several
          domains that enable their function: N-terminal calponin
          homology (CH), acidic, RhoGEF (also called
          Dbl-homologous or DH), Pleckstrin Homology (PH), C1
          (zinc finger), SH2, and two SH3 domains. The SH3 domain
          of VAV is involved in the localization of proteins to
          specific sites within the cell, by interacting with
          proline-rich sequences within target proteins. SH3
          domains are protein interaction domains that bind to
          proline-rich ligands with moderate affinity and
          selectivity, preferentially to PxxP motifs. They play
          versatile and diverse roles in the cell including the
          regulation of enzymes, changing the subcellular
          localization of signaling pathway components, and
          mediating the formation of multiprotein complex
          assemblies.
          Length = 54

 Score = 23.7 bits (51), Expect = 9.9
 Identities = 13/49 (26%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 14 FDYSTKDGKYVRIQEGEKL-FLIKKTNKDWWQVIRSSGKPFYVPASYVE 61
          +D+  +D + + ++EG+ +    KK  + WW+    +G+  + P++YVE
Sbjct: 6  YDFCARDMRELSLKEGDVVKIYNKKGQQGWWRG-EINGRIGWFPSTYVE 53


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.313    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0813    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,012,612
Number of extensions: 413859
Number of successful extensions: 487
Number of sequences better than 10.0: 1
Number of HSP's gapped: 468
Number of HSP's successfully gapped: 147
Length of query: 101
Length of database: 10,937,602
Length adjustment: 67
Effective length of query: 34
Effective length of database: 7,965,884
Effective search space: 270840056
Effective search space used: 270840056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (24.0 bits)