BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6771
         (493 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In The Unbound State
 pdb|2JAE|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In The Unbound State
 pdb|2JB1|A Chain A, The L-Amino Acid Oxidase From Rhodococcus Opacus In
           Complex With L-Alanine
 pdb|2JB1|B Chain B, The L-Amino Acid Oxidase From Rhodococcus Opacus In
           Complex With L-Alanine
 pdb|2JB3|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With O-Aminobenzoate
 pdb|2JB3|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With O-Aminobenzoate
 pdb|2JB2|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With L-Phenylalanine.
 pdb|2JB2|B Chain B, The Structure Of L-Amino Acid Oxidase From Rhodococcus
           Opacus In Complex With L-Phenylalanine
          Length = 489

 Score = 28.5 bits (62), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 227 IENSSLIKESENTFTLWCSGRSCCEGMLVELKLIKRQDLVGLIAQLIRPSTDQLSMSFDL 286
           +E      ++ NTF  + S  S   G  V  +  K  D  G +++L++ +TDQ ++   L
Sbjct: 99  VEIQGFGNQNANTFVNYQSDTSLS-GQSVTYRAAK-ADTFGYMSELLKKATDQGALDQVL 156

Query: 287 GKEDMDSFS 295
            +ED D+ S
Sbjct: 157 SREDKDALS 165


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.132    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,307,329
Number of Sequences: 62578
Number of extensions: 404225
Number of successful extensions: 816
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 816
Number of HSP's gapped (non-prelim): 4
length of query: 493
length of database: 14,973,337
effective HSP length: 103
effective length of query: 390
effective length of database: 8,527,803
effective search space: 3325843170
effective search space used: 3325843170
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)