Diaphorina citri psyllid: psy6774


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYAP
ccccccCEEEccccccccccccccccccccccccccEEEEEEEccccccEEEccccccccccccEEEEEEEcccccccccccccccccccEEEEccccccccHHHcccccccccccccccEEECccccccccccccCCcc
**GKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMGKTVTLHWHGLYQRYTPFMDGVQFVTQCPILHNTKFRYKFPAVPDGTFFYHSHIALQKMDGIEGSFIIREPRSIDKTAPLWDYDLPSHVIIITDWLHDMTDEKYPGFLRTNTGNFPETYLINGKNNYVYVSNNYIYAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0009505 [CC]plant-type cell wallprobableGO:0005618, GO:0044464, GO:0005623, GO:0030312, GO:0005575, GO:0071944
GO:0046658 [CC]anchored to plasma membraneprobableGO:0031226, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224, GO:0031225
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0008150 [BP]biological_processprobable
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AOZ, chain A
Confidence level:very confident
Coverage over the Query: 3-131
View the alignment between query and template
View the model in PyMOL