Query psy6788
Match_columns 61
No_of_seqs 22 out of 24
Neff 1.8
Searched_HMMs 46136
Date Fri Aug 16 18:24:01 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy6788.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6788hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 COG2816 NPY1 NTP pyrophosphohy 48.2 8.4 0.00018 29.0 0.8 15 31-45 168-182 (279)
2 PHA00515 hypothetical protein 32.5 14 0.00031 22.3 -0.1 10 41-50 39-48 (53)
3 KOG3084|consensus 23.5 20 0.00044 28.2 -0.7 14 32-45 214-227 (345)
4 PF13340 DUF4096: Putative tra 20.8 40 0.00087 19.3 0.4 14 45-58 25-38 (75)
5 smart00646 Ami_3 Ami_3. 20.5 54 0.0012 19.3 0.9 15 37-51 79-93 (113)
6 cd03119 alpha_CA_I_II_III_XIII 15.5 1.6E+02 0.0035 20.6 2.5 19 29-48 136-154 (259)
7 PF10921 DUF2710: Protein of u 14.5 41 0.00089 22.9 -0.7 15 41-55 10-24 (109)
8 PF08750 CNP1: CNP1-like famil 13.9 1.6E+02 0.0034 19.8 2.0 52 4-59 9-60 (139)
9 cd04089 eRF3_II eRF3_II: domai 13.7 1.5E+02 0.0032 16.9 1.6 18 34-51 15-32 (82)
10 PF07697 7TMR-HDED: 7TM-HD ext 13.4 51 0.0011 21.0 -0.5 12 41-52 2-13 (222)
No 1
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=48.25 E-value=8.4 Score=28.97 Aligned_cols=15 Identities=33% Similarity=0.631 Sum_probs=12.6
Q ss_pred eeeEEEEEEEEeeee
Q psy6788 31 LKFGVLIGLIEVGEV 45 (61)
Q Consensus 31 ~KFavLigLiEvg~V 45 (61)
--|.+|.||||+||-
T Consensus 168 g~yS~LAGFVE~GET 182 (279)
T COG2816 168 GMYSLLAGFVEPGET 182 (279)
T ss_pred cceeeeeecccCCcc
Confidence 447899999999983
No 2
>PHA00515 hypothetical protein
Probab=32.52 E-value=14 Score=22.30 Aligned_cols=10 Identities=60% Similarity=0.760 Sum_probs=7.9
Q ss_pred Eeeeeechhh
Q psy6788 41 EVGEVSNREV 50 (61)
Q Consensus 41 Evg~Vsnrdi 50 (61)
-|||||+||-
T Consensus 39 pvgqvsrrew 48 (53)
T PHA00515 39 PVGQVSRREW 48 (53)
T ss_pred ccchhhhhhc
Confidence 5799999873
No 3
>KOG3084|consensus
Probab=23.47 E-value=20 Score=28.21 Aligned_cols=14 Identities=36% Similarity=0.620 Sum_probs=12.2
Q ss_pred eeEEEEEEEEeeee
Q psy6788 32 KFGVLIGLIEVGEV 45 (61)
Q Consensus 32 KFavLigLiEvg~V 45 (61)
=|.+|+|++|.||=
T Consensus 214 l~t~lAGFlEpGES 227 (345)
T KOG3084|consen 214 LWTCLAGFLEPGES 227 (345)
T ss_pred hhhhhhccCCcccc
Confidence 48899999999984
No 4
>PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096)
Probab=20.79 E-value=40 Score=19.27 Aligned_cols=14 Identities=43% Similarity=0.593 Sum_probs=11.7
Q ss_pred eechhhhheeeEee
Q psy6788 45 VSNREVVNTILHLA 58 (61)
Q Consensus 45 Vsnrdiv~TVl~Ll 58 (61)
+++|+++|.|++.+
T Consensus 25 ~~~R~v~~ail~~l 38 (75)
T PF13340_consen 25 IDLREVLNAILYVL 38 (75)
T ss_pred cchHHHHhcccccc
Confidence 68899999998765
No 5
>smart00646 Ami_3 Ami_3.
Probab=20.52 E-value=54 Score=19.26 Aligned_cols=15 Identities=27% Similarity=0.357 Sum_probs=12.0
Q ss_pred EEEEEeeeeechhhh
Q psy6788 37 IGLIEVGEVSNREVV 51 (61)
Q Consensus 37 igLiEvg~Vsnrdiv 51 (61)
.-|||+|-+||.+=.
T Consensus 79 avlvE~gfisN~~d~ 93 (113)
T smart00646 79 AVLVELGFITNPSDA 93 (113)
T ss_pred eeeEEecccCCHHHH
Confidence 568999999997643
No 6
>cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII. Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidines. This vertebrate subgroup comprises isozymes I, II, and III, which are cytoplasmic enzymes. CA I, for example, is expressed in erythrocyes of many vertebrates; CA II is the most active cytosolic isozyme; while it is being expressed nearly ubiquitously, it comprises 95% of the renal carbonic anhydrase and is required for renal acidification; C
Probab=15.54 E-value=1.6e+02 Score=20.59 Aligned_cols=19 Identities=26% Similarity=0.331 Sum_probs=15.3
Q ss_pred cceeeEEEEEEEEeeeeech
Q psy6788 29 DELKFGVLIGLIEVGEVSNR 48 (61)
Q Consensus 29 d~~KFavLigLiEvg~Vsnr 48 (61)
..-.+|||.-|+|+|+ +|.
T Consensus 136 ~~~glaVvgvl~~~g~-~n~ 154 (259)
T cd03119 136 QPDGLAVVGVFLKVGE-ANP 154 (259)
T ss_pred CCCCeEEEEEEEEecc-cch
Confidence 3356999999999999 664
No 7
>PF10921 DUF2710: Protein of unknown function (DUF2710); InterPro: IPR024296 This family of uncharacterised proteins appears to be restricted to Mycobacteriaceae.
Probab=14.53 E-value=41 Score=22.87 Aligned_cols=15 Identities=27% Similarity=0.671 Sum_probs=12.5
Q ss_pred Eeeeeechhhhheee
Q psy6788 41 EVGEVSNREVVNTIL 55 (61)
Q Consensus 41 Evg~Vsnrdiv~TVl 55 (61)
|-+|+|+||.|++|+
T Consensus 10 ~~~~lsDkdLvesVl 24 (109)
T PF10921_consen 10 EPSQLSDKDLVESVL 24 (109)
T ss_pred cccccchhhHHHHHH
Confidence 456899999999886
No 8
>PF08750 CNP1: CNP1-like family; InterPro: IPR014861 This group of proteins are likely to be lipoproteins. CNP1 (cryptic neisserial protein) has been expressed in Escherichia coli and shown to be localised periplasmicly [].
Probab=13.89 E-value=1.6e+02 Score=19.82 Aligned_cols=52 Identities=25% Similarity=0.179 Sum_probs=31.7
Q ss_pred CCCCCCCCCCCCCCChHHHhhhccccceeeEEEEEEEEeeeeechhhhheeeEeee
Q psy6788 4 AESKVPPVQFPDIKRPEDVVQMIMKDELKFGVLIGLIEVGEVSNREVVNTILHLAI 59 (61)
Q Consensus 4 ~e~~~~~~~~~dikrPeevv~m~~~d~~KFavLigLiEvg~Vsnrdiv~TVl~Lli 59 (61)
.|++.+.||+++-..--+. .++-+..+||.+-.-=|.+| ...+|.-+|+.-.
T Consensus 9 ~E~~~~LPp~P~~~~l~~f-~v~~~~~~~f~ID~~Sisvg---~DgvVRY~lv~~S 60 (139)
T PF08750_consen 9 KEAEVPLPPAPQDANLLPF-DVSPTSPLKFFIDPKSISVG---PDGVVRYTLVVRS 60 (139)
T ss_pred EecccCCCCCCCcCCccEE-ECCCCCCceEEEchhheEEC---CCCcEEEEEEEcC
Confidence 3566677777654432211 22555689999988778666 4556666665543
No 9
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination. Sup35NM is a non-pathogenic prion-li
Probab=13.72 E-value=1.5e+02 Score=16.88 Aligned_cols=18 Identities=22% Similarity=0.545 Sum_probs=14.5
Q ss_pred EEEEEEEEeeeeechhhh
Q psy6788 34 GVLIGLIEVGEVSNREVV 51 (61)
Q Consensus 34 avLigLiEvg~Vsnrdiv 51 (61)
.+..|-||.|.+..-|-+
T Consensus 15 ~vv~G~v~~G~i~~G~~v 32 (82)
T cd04089 15 TVVLGKVESGTIKKGDKL 32 (82)
T ss_pred EEEEEEEeeeEEecCCEE
Confidence 488999999999876643
No 10
>PF07697 7TMR-HDED: 7TM-HD extracellular; InterPro: IPR011624 This entry represents the extracellular domain of the 7TM-HD (7TM Receptors with HD hydrolase) protein family []. These proteins are known or predicted, to posses metal-dependent phospohydrolase activity.
Probab=13.37 E-value=51 Score=20.96 Aligned_cols=12 Identities=33% Similarity=0.828 Sum_probs=10.0
Q ss_pred Eeeeeechhhhh
Q psy6788 41 EVGEVSNREVVN 52 (61)
Q Consensus 41 Evg~Vsnrdiv~ 52 (61)
++|+|+.+||+-
T Consensus 2 ~~G~ia~~dI~A 13 (222)
T PF07697_consen 2 KVGQIAPRDIVA 13 (222)
T ss_pred CCCCcCCCceEC
Confidence 689999999874
Done!