Query         psy6788
Match_columns 61
No_of_seqs    22 out of 24
Neff          1.8 
Searched_HMMs 46136
Date          Fri Aug 16 18:24:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6788.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6788hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG2816 NPY1 NTP pyrophosphohy  48.2     8.4 0.00018   29.0   0.8   15   31-45    168-182 (279)
  2 PHA00515 hypothetical protein   32.5      14 0.00031   22.3  -0.1   10   41-50     39-48  (53)
  3 KOG3084|consensus               23.5      20 0.00044   28.2  -0.7   14   32-45    214-227 (345)
  4 PF13340 DUF4096:  Putative tra  20.8      40 0.00087   19.3   0.4   14   45-58     25-38  (75)
  5 smart00646 Ami_3 Ami_3.         20.5      54  0.0012   19.3   0.9   15   37-51     79-93  (113)
  6 cd03119 alpha_CA_I_II_III_XIII  15.5 1.6E+02  0.0035   20.6   2.5   19   29-48    136-154 (259)
  7 PF10921 DUF2710:  Protein of u  14.5      41 0.00089   22.9  -0.7   15   41-55     10-24  (109)
  8 PF08750 CNP1:  CNP1-like famil  13.9 1.6E+02  0.0034   19.8   2.0   52    4-59      9-60  (139)
  9 cd04089 eRF3_II eRF3_II: domai  13.7 1.5E+02  0.0032   16.9   1.6   18   34-51     15-32  (82)
 10 PF07697 7TMR-HDED:  7TM-HD ext  13.4      51  0.0011   21.0  -0.5   12   41-52      2-13  (222)

No 1  
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=48.25  E-value=8.4  Score=28.97  Aligned_cols=15  Identities=33%  Similarity=0.631  Sum_probs=12.6

Q ss_pred             eeeEEEEEEEEeeee
Q psy6788          31 LKFGVLIGLIEVGEV   45 (61)
Q Consensus        31 ~KFavLigLiEvg~V   45 (61)
                      --|.+|.||||+||-
T Consensus       168 g~yS~LAGFVE~GET  182 (279)
T COG2816         168 GMYSLLAGFVEPGET  182 (279)
T ss_pred             cceeeeeecccCCcc
Confidence            447899999999983


No 2  
>PHA00515 hypothetical protein
Probab=32.52  E-value=14  Score=22.30  Aligned_cols=10  Identities=60%  Similarity=0.760  Sum_probs=7.9

Q ss_pred             Eeeeeechhh
Q psy6788          41 EVGEVSNREV   50 (61)
Q Consensus        41 Evg~Vsnrdi   50 (61)
                      -|||||+||-
T Consensus        39 pvgqvsrrew   48 (53)
T PHA00515         39 PVGQVSRREW   48 (53)
T ss_pred             ccchhhhhhc
Confidence            5799999873


No 3  
>KOG3084|consensus
Probab=23.47  E-value=20  Score=28.21  Aligned_cols=14  Identities=36%  Similarity=0.620  Sum_probs=12.2

Q ss_pred             eeEEEEEEEEeeee
Q psy6788          32 KFGVLIGLIEVGEV   45 (61)
Q Consensus        32 KFavLigLiEvg~V   45 (61)
                      =|.+|+|++|.||=
T Consensus       214 l~t~lAGFlEpGES  227 (345)
T KOG3084|consen  214 LWTCLAGFLEPGES  227 (345)
T ss_pred             hhhhhhccCCcccc
Confidence            48899999999984


No 4  
>PF13340 DUF4096:  Putative transposase of IS4/5 family (DUF4096)
Probab=20.79  E-value=40  Score=19.27  Aligned_cols=14  Identities=43%  Similarity=0.593  Sum_probs=11.7

Q ss_pred             eechhhhheeeEee
Q psy6788          45 VSNREVVNTILHLA   58 (61)
Q Consensus        45 Vsnrdiv~TVl~Ll   58 (61)
                      +++|+++|.|++.+
T Consensus        25 ~~~R~v~~ail~~l   38 (75)
T PF13340_consen   25 IDLREVLNAILYVL   38 (75)
T ss_pred             cchHHHHhcccccc
Confidence            68899999998765


No 5  
>smart00646 Ami_3 Ami_3.
Probab=20.52  E-value=54  Score=19.26  Aligned_cols=15  Identities=27%  Similarity=0.357  Sum_probs=12.0

Q ss_pred             EEEEEeeeeechhhh
Q psy6788          37 IGLIEVGEVSNREVV   51 (61)
Q Consensus        37 igLiEvg~Vsnrdiv   51 (61)
                      .-|||+|-+||.+=.
T Consensus        79 avlvE~gfisN~~d~   93 (113)
T smart00646       79 AVLVELGFITNPSDA   93 (113)
T ss_pred             eeeEEecccCCHHHH
Confidence            568999999997643


No 6  
>cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII.  Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. Most alpha CAs are monomeric enzymes.  The zinc ion is complexed by three histidines. This vertebrate subgroup comprises isozymes I, II, and III, which are cytoplasmic enzymes. CA I, for example, is expressed in erythrocyes of many vertebrates; CA II is the most active cytosolic isozyme; while it is being expressed nearly ubiquitously, it comprises 95% of the renal carbonic anhydrase and is  required for renal acidification; C
Probab=15.54  E-value=1.6e+02  Score=20.59  Aligned_cols=19  Identities=26%  Similarity=0.331  Sum_probs=15.3

Q ss_pred             cceeeEEEEEEEEeeeeech
Q psy6788          29 DELKFGVLIGLIEVGEVSNR   48 (61)
Q Consensus        29 d~~KFavLigLiEvg~Vsnr   48 (61)
                      ..-.+|||.-|+|+|+ +|.
T Consensus       136 ~~~glaVvgvl~~~g~-~n~  154 (259)
T cd03119         136 QPDGLAVVGVFLKVGE-ANP  154 (259)
T ss_pred             CCCCeEEEEEEEEecc-cch
Confidence            3356999999999999 664


No 7  
>PF10921 DUF2710:  Protein of unknown function (DUF2710);  InterPro: IPR024296 This family of uncharacterised proteins appears to be restricted to Mycobacteriaceae.
Probab=14.53  E-value=41  Score=22.87  Aligned_cols=15  Identities=27%  Similarity=0.671  Sum_probs=12.5

Q ss_pred             Eeeeeechhhhheee
Q psy6788          41 EVGEVSNREVVNTIL   55 (61)
Q Consensus        41 Evg~Vsnrdiv~TVl   55 (61)
                      |-+|+|+||.|++|+
T Consensus        10 ~~~~lsDkdLvesVl   24 (109)
T PF10921_consen   10 EPSQLSDKDLVESVL   24 (109)
T ss_pred             cccccchhhHHHHHH
Confidence            456899999999886


No 8  
>PF08750 CNP1:  CNP1-like family;  InterPro: IPR014861 This group of proteins are likely to be lipoproteins. CNP1 (cryptic neisserial protein) has been expressed in Escherichia coli and shown to be localised periplasmicly []. 
Probab=13.89  E-value=1.6e+02  Score=19.82  Aligned_cols=52  Identities=25%  Similarity=0.179  Sum_probs=31.7

Q ss_pred             CCCCCCCCCCCCCCChHHHhhhccccceeeEEEEEEEEeeeeechhhhheeeEeee
Q psy6788           4 AESKVPPVQFPDIKRPEDVVQMIMKDELKFGVLIGLIEVGEVSNREVVNTILHLAI   59 (61)
Q Consensus         4 ~e~~~~~~~~~dikrPeevv~m~~~d~~KFavLigLiEvg~Vsnrdiv~TVl~Lli   59 (61)
                      .|++.+.||+++-..--+. .++-+..+||.+-.-=|.+|   ...+|.-+|+.-.
T Consensus         9 ~E~~~~LPp~P~~~~l~~f-~v~~~~~~~f~ID~~Sisvg---~DgvVRY~lv~~S   60 (139)
T PF08750_consen    9 KEAEVPLPPAPQDANLLPF-DVSPTSPLKFFIDPKSISVG---PDGVVRYTLVVRS   60 (139)
T ss_pred             EecccCCCCCCCcCCccEE-ECCCCCCceEEEchhheEEC---CCCcEEEEEEEcC
Confidence            3566677777654432211 22555689999988778666   4556666665543


No 9  
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=13.72  E-value=1.5e+02  Score=16.88  Aligned_cols=18  Identities=22%  Similarity=0.545  Sum_probs=14.5

Q ss_pred             EEEEEEEEeeeeechhhh
Q psy6788          34 GVLIGLIEVGEVSNREVV   51 (61)
Q Consensus        34 avLigLiEvg~Vsnrdiv   51 (61)
                      .+..|-||.|.+..-|-+
T Consensus        15 ~vv~G~v~~G~i~~G~~v   32 (82)
T cd04089          15 TVVLGKVESGTIKKGDKL   32 (82)
T ss_pred             EEEEEEEeeeEEecCCEE
Confidence            488999999999876643


No 10 
>PF07697 7TMR-HDED:  7TM-HD extracellular;  InterPro: IPR011624 This entry represents the extracellular domain of the 7TM-HD (7TM Receptors with HD hydrolase) protein family []. These proteins are known or predicted, to posses metal-dependent phospohydrolase activity.
Probab=13.37  E-value=51  Score=20.96  Aligned_cols=12  Identities=33%  Similarity=0.828  Sum_probs=10.0

Q ss_pred             Eeeeeechhhhh
Q psy6788          41 EVGEVSNREVVN   52 (61)
Q Consensus        41 Evg~Vsnrdiv~   52 (61)
                      ++|+|+.+||+-
T Consensus         2 ~~G~ia~~dI~A   13 (222)
T PF07697_consen    2 KVGQIAPRDIVA   13 (222)
T ss_pred             CCCCcCCCceEC
Confidence            689999999874


Done!