Diaphorina citri psyllid: psy6799

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MNTIVNGYHNPKLISSYPTKDFACDLSSLDPPVGPRQRVHVSEMLKEKARKVFTKKMLHKKVPILQWLPEYNSESAVSDLVAGVTVGLTVIPQAIAYSNVAGLPPQVGLYSSFMACFVYTIFGSCKDSAIGPTAIMSILTRENLHGLGPQFAVFLTFVSGIVQLFMGLLQLALITL
ccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcEEEc
************LISSYPTKDFACDL****************EMLKEKARKVFTKKMLHKKVPILQWLPEYNSESAVSDLVAGVTVGLTVIPQAIAYSNVAGLPPQVGLYSSFMACFVYTIFGSCKDSAIGPTAIMSILTRENLHGLGPQFAVFLTFVSGIVQLFMGLLQLALITL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTIVNGYHNPKLISSYPTKDFACDLSSLDPPVGPRQRVHVSEMLKEKARKVFTKKMLHKKVPILQWLPEYNSESAVSDLVAGVTVGLTVIPQAIAYSNVAGLPPQVGLYSSFMACFVYTIFGSCKDSAIGPTAIMSILTRENLHGLGPQFAVFLTFVSGIVQLFMGLLQLALITL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium-independent sulfate anion transporter Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).confidentQ80ZD3
Sodium-independent sulfate anion transporter Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).confidentQ58DD2
Sodium-independent sulfate anion transporter Exhibits sodium-independent sulfate anion transporter activity that may cooperate with SLC26A2 to mediate DIDS-sensitive sulfate uptake into high endothelial venules endothelial cells (HEVEC).confidentQ86WA9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019531 [MF]oxalate transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005310, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0005215, GO:0046943
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005765 [CC]lysosomal membraneprobableGO:0005737, GO:0044446, GO:0000323, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0005764, GO:0044444, GO:0044437, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0019532 [BP]oxalate transportprobableGO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0006835, GO:0071702, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0046942
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015301 [MF]anion:anion antiporter activityprobableGO:0022891, GO:0015297, GO:0022892, GO:0015291, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0022804
GO:0015116 [MF]sulfate transmembrane transporter activityprobableGO:0022891, GO:1901682, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0022892, GO:0003674, GO:0015103
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0006821 [BP]chloride transportprobableGO:0006811, GO:0006810, GO:0006820, GO:0044765, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0008272 [BP]sulfate transportprobableGO:0006811, GO:0006810, GO:0072348, GO:0044765, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0051179, GO:0044699
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0050801 [BP]ion homeostasisprobableGO:0042592, GO:0008150, GO:0065008, GO:0065007, GO:0048878
GO:0015108 [MF]chloride transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0015103

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QE7, chain A
Confidence level:probable
Coverage over the Query: 75-172
View the alignment between query and template
View the model in PyMOL