Diaphorina citri psyllid: psy6808


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MLTSPTHWCNSTVHFWPFTSPTQELAKMSTSQKHQNFVSEPMGEKPVTELAGVGDVLGKRLESKGFDKSINPQMFPDPDIEEKVLLFKNPNSLPIPIGVEVLGYTKIKNNKSRYPYLDYGCTEIHNTCTEWD
ccccccccccccEEECccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHcccccccc
***S*THWCNSTVHFWPFT******************VSEPMGEKPVTELAGVGDVLGKRLESKGFDKSINPQMFPDPDIEEKVLLFKNPNSLPIPIGVEVLGYTKIKNNKSRYPYLDYGCTEIHNTCTEW*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTSPTHWCNSTVHFWPFTSPTQELAKMSTSQKHQNFVSEPMGEKPVTELAGVGDVLGKRLESKGFDKSINPQMFPDPDIEEKVLLFKNPNSLPIPIGVEVLGYTKIKNNKSRYPYLDYGCTEIHNTCTEWD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.confidentQ5RBU9
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging.confidentO54962
Barrier-to-autointegration factor Plays fundamental roles in nuclear assembly, chromatin organization, gene expression and gonad development. May potently compress chromatin structure and be involved in membrane recruitment and chromatin decondensation during nuclear assembly. Contains 2 non-specific dsDNA-binding sites which may promote DNA cross-bridging. Exploited by retroviruses for inhibiting self-destructing autointegration of retroviral DNA, thereby promoting integration of viral DNA into the host chromosome. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD.confidentO75531

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0015074 [BP]DNA integrationprobableGO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0009615 [BP]response to virusprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0050792 [BP]regulation of viral reproductionprobableGO:0008150, GO:0043900, GO:0065007, GO:0050789, GO:0050794
GO:0030717 [BP]karyosome formationprobableGO:0006996, GO:0044702, GO:0048610, GO:0051276, GO:0032504, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0048609, GO:0022412, GO:0008150, GO:0048477, GO:0007276, GO:0000003
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0075713 [BP]establishment of integrated proviral latencyprobableGO:0044419, GO:0044703, GO:0000003, GO:0019042, GO:0019043, GO:0009987, GO:0019048, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0000779 [CC]condensed chromosome, centromeric regionprobableGO:0005575, GO:0005622, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000793, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CI4, chain A
Confidence level:very confident
Coverage over the Query: 29-73
View the alignment between query and template
View the model in PyMOL