BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6815
         (263 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DSB|A Chain A, The Crystal Structure Of A Possible Acetyltransferase
          From Clostridium Difficile 630
 pdb|3DSB|B Chain B, The Crystal Structure Of A Possible Acetyltransferase
          From Clostridium Difficile 630
          Length = 157

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 28/69 (40%), Gaps = 6/69 (8%)

Query: 5  LVGINSRILPITDGGRIGQDVIQPGVASHVEGEDQIKYHKYYQWVCFVLFFQAMLFYVPR 64
          +   N  +   T+G  +  DV+  GV + +  E + KYH       + +F + +      
Sbjct: 20 IAKFNYNLAKETEGKELDXDVLTKGVKALLLDERKGKYH------VYTVFDKVVAQIXYT 73

Query: 65 YLWKSWEGG 73
          Y W  W  G
Sbjct: 74 YEWSDWRNG 82


>pdb|3KZX|A Chain A, Crystal Structure Of A Had-Superfamily Hydrolase From
           Ehrlichia Chaffeensis At 1.9a Resolution
          Length = 231

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 5/32 (15%)

Query: 98  LLVEYFTTN-----LHTQNFYAIRFFICEVLN 124
           L ++Y +TN     L  +NFY IR FIC+++N
Sbjct: 199 LPIKYGSTNIIKDILSFKNFYDIRNFICQLIN 230


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.144    0.456 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,875,982
Number of Sequences: 62578
Number of extensions: 318395
Number of successful extensions: 531
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 525
Number of HSP's gapped (non-prelim): 12
length of query: 263
length of database: 14,973,337
effective HSP length: 97
effective length of query: 166
effective length of database: 8,903,271
effective search space: 1477942986
effective search space used: 1477942986
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)