Diaphorina citri psyllid: psy6816

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---

APSVFFLLLSNYLFSLLQSHSNYVTKYFACEFLCFLNIIVQMYAMNKFFDGEFINYGMRVLTFSEQAQEDRVDPMSSSMRPHGLCISQSYKVYFPQVWCFRINSNPRFLVYTSTKYSQRKDLHFHLVLVCYAFCPGWPDPMVYVFPRVTKCTFHKYGASGSIQTHDSLCILPLNIVNEKTYIFIWFWFVMLFVLVGLQVVYRLALIFCPKVRPLVMRTKNRLVPHEIADALCRKTSLGDWWILYMLERNIDPVIYRDIAAELAKKIEAPKAHI

ccccHHHHHHHHHHHHHcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHcccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccCEEEEEEEEEccccccCEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccc

*PSVFFLLLSNYLFSLLQSHSNYVTKYFACEFLCFLNIIVQMYAMNKFFDGEFINYGMRVLTFSEQAQEDRVDPMSSSMRPHGLCISQSYKVYFPQVWCFRINSNPRFLVYTSTKYSQRKDLHFHLVLVCYAFCPGWPDPMVYVFPRVTKCTFHKYGASGSIQTHDSLCILPLNIVNEKTYIFIWFWFVMLFVLVGLQVVYRLALIFCPKVRPLVMRTKNRLVPHEIADALCRKTSLGDWWILYMLERNIDPVIYRDIAAELAKK*E******

xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Innexin inx1	Structural component of the gap junctions. Essential for generation and/or maintenance of postembryonic neuroblasts and normal development of optic lobe.	confident	P27716

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005921 [CC]	gap junction	probable	GO:0005575, GO:0030054, GO:0005911
GO:0010496 [BP]	intercellular transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016327 [CC]	apicolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]	basolateral plasma membrane	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0007154 [BP]	cell communication	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted