Diaphorina citri psyllid: psy6819


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MSVKQFQSTLFKRCFNHFLERKFKSYIIENNEQFIKHVMNNPVPVIVNFHAEWCEPCHLLTPQLKKMLGNSDSIDLAIIDVEKNAELVHTFEVKAVPAVLAVKNGLVIDKFIGLIENEMIENMVSKLLPKDKTNP
cccccccccccccccccccccccEEEEEEcHHHHHHHHHcccccEEEEECcccccHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHcccccccc
************RCFNHFLERKFKSYIIENNEQFIKHVMNNPVPVIVNFHAEWCEPCHLLTPQLKKMLGNSDSIDLAIIDVEKNAELVHTFEVKAVPAVLAVKNGLVIDKFIGLIENEMIENMV****P******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVKQFQSTLFKRCFNHFLERKFKSYIIENNEQFIKHVMNNPVPVIVNFHAEWCEPCHLLTPQLKKMLGNSDSIDLAIIDVEKNAELVHTFEVKAVPAVLAVKNGLVIDKFIGLIENEMIENMVSKLLPKDKTNP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin Component of the thioredoxin-thioredoxin reductase system. Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.confidentQ4L5F0
Thioredoxin, mitochondrial Has an anti-apoptotic function and plays an important role in the regulation of mitochondrial membrane potential (By similarity). Possesses a dithiol-reducing activity.confidentP97615
Probable thioredoxin-2 Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.confidentQ17424

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009055 [MF]electron carrier activityprobableGO:0003674
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008113 [MF]peptide-methionine (S)-S-oxide reductase activityprobableGO:0003824, GO:0016671, GO:0003674, GO:0016667, GO:0016491
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0033743 [MF]peptide-methionine (R)-S-oxide reductase activityprobableGO:0003824, GO:0016671, GO:0003674, GO:0016667, GO:0016491
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003756 [MF]protein disulfide isomerase activityprobableGO:0016853, GO:0003824, GO:0003674, GO:0016864, GO:0016862, GO:0016860
GO:0034599 [BP]cellular response to oxidative stressprobableGO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0045454 [BP]cell redox homeostasisprobableGO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0080058 [BP]protein deglutathionylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 24-130
View the alignment between query and template
View the model in PyMOL