Diaphorina citri psyllid: psy6820

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------64

ISWHIEEHSLEEEYKAHPLVILVILDLIFSFYMTCHPRLNHILANTSSVSNRTMSMILGDTKSAMVLSQSTDPLKDQCNTVDMQRHFSDFTPSPLKSRRAKRIRFLCNGDKFFKGVVMAVGPERYRSFDSLLEELTRALAENINLPSGVRILFTMDGQKVTNIDELEDGKFYICSSSGDQFKKVDYAILNNNNSSNTLPRSGKFITKSAPPRVNKTPTSFVVRPRIIIVIRNGIRPRKVVRALLNKRNAPSLDQCFSTITDIVKLDTGAVRKVYTLNGNQLARLSDFFKSDDVFFAYGSERVLPDDFELDVEEVKAIQALKKDLRRPEHTKLKSGTTCLDASGREVPKMPTKTSVARCATATIKRRENLNIPSKLLQRYSVGQIIGDGNFAVVRQVYDKHKDMDCALKIIDKSKLLGKKQMIENEVNILRSVNHPNIIKLLDEYDTNNELYLVIELIKGGDLFDAISKNVKFSEEDSKFMTQSLASALSYLHDNYIVHRDIKPENLLVEMSGCHVKVLKVGDFGLAQRVLRPMFTVCGTPTYVAPEILNESGYGVKIDVWAAGVILYILLCGFPPFVSDTNDQDELFDDILSGQYGFPSPYWDDISEEAKELISHMLESNPDLRFSAEDVLDHPWLERS

cccccccccHHHHHccccEEHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccEEEEEEccccccccEEEEEcccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEEEEccccccccHHHHHHHHHHHHHcccccEEEEEEEcccEEEEEccccccccEEEEcccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccEEEEEEEEcccccEEEEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEEEccccEEEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccEEEEcCCcccEEcccccccccccccccccHHccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHccCECccccccccccHHHHHHHHHHccccccccccHHHHHcccccccc

*SWH***HSLEEEYKAHPLVILVILDLIFSFYMTCHPRLNHIL*NTS*****************************************************KRIRFLCNGDKFFKGVVMAVGPERYRSFDSLLEELTRALAENINLPSGVRILFTMDGQKVTNIDELEDGKFYICSSSGDQFKKVDYAIL******************************FVVRPRIIIVIRNGIRPRKVVRALLNKRNAPSLDQCFSTITDIVKLDTGAVRKVYTLNGNQLARLSDFFKSDDVFFAYGSERVLPDDFELDV***********************************************************IPSKLLQRYSVGQIIGDGNFAVVRQVYDKHKDMDCALKIIDKSKLLGKKQMIENEVNILRSVNHPNIIKLLDEYDTNNELYLVIELIKGGDLFDAISKNVKFSEEDSKFMTQSLASALSYLHDNYIVHRDIKPENLLVEMSGCHVKVLKVGDFGLAQRVLRPMFTVCGTPTYVAPEILNESGYGVKIDVWAAGVILYILLCGFPPFVSDTNDQDELFDDILSGQYGFPSPYWDDISEEAKELISHMLESNPDLRFSAEDVLDHPWLER*

xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein kinase DCLK2	Protein kinase with a significantly reduced C(a2+)/CAM affinity and dependence compared to other members of the CaMK family. May play a role in the down-regulation of CRE-dependent gene activation probably by phosphorylation of the CREB coactivator CRTC2/TORC2 and the resulting retention of TORC2 in the cytoplasm.	confident	Q8N568
Serine/threonine-protein kinase GA29083		confident	B5DK35
Serine/threonine-protein kinase DCLK2	Protein kinase with a significantly reduced Ca(2+)/CAM affinity and dependence compared to other members of the CaMK family. May play a role in the down-regulation of CRE-dependent gene activation probably by phosphorylation of the CREB coactivator CRTC2/TORC2 and the resulting retention of TORC2 in the cytoplasm.	confident	D2I3C6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051049 [BP]	regulation of transport	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0007026 [BP]	negative regulation of microtubule depolymerization	probable	GO:0031110, GO:0031111, GO:0031114, GO:0033043, GO:1901879, GO:0051129, GO:0051128, GO:0043244, GO:0032886, GO:0050789, GO:0044699, GO:0043242, GO:0051494, GO:0051493, GO:0065007, GO:0048519, GO:0009987, GO:1901880, GO:0044763, GO:0050794, GO:0010639, GO:0008150, GO:0070507, GO:0048523
GO:0000922 [CC]	spindle pole	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0005876 [CC]	spindle microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0044767 [BP]	single-organism developmental process	probable	GO:0032502, GO:0008150, GO:0044699
GO:0007165 [BP]	signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0044093 [BP]	positive regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032880 [BP]	regulation of protein localization	probable	GO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0051179 [BP]	localization	probable	GO:0008150
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0031325 [BP]	positive regulation of cellular metabolic process	probable	GO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0016043 [BP]	cellular component organization	probable	GO:0008150, GO:0071840
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0004683 [MF]	calmodulin-dependent protein kinase activity	probable	GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004674, GO:0016740, GO:0003674, GO:0004672
GO:0048699 [BP]	generation of neurons	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0007417 [BP]	central nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.7.-.-	Transferring phosphorous-containing groups.	probable
2.7.11.-	Protein-serine/threonine kinases.	probable
2.7.11.1	Transferred entry: 2.7.11.19.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MG4, chain A
Confidence level:very confident
Coverage over the Query: 98-197
View the alignment between query and template
View the model in PyMOL

Template: 2BDW, chain A
Confidence level:very confident
Coverage over the Query: 374-638
View the alignment between query and template
View the model in PyMOL

Template: 4ATU, chain I
Confidence level:very confident
Coverage over the Query: 99-205
View the alignment between query and template
View the model in PyMOL

Template: 1UU3, chain A
Confidence level:very confident
Coverage over the Query: 377-635
View the alignment between query and template
View the model in PyMOL

Template: 3O96, chain A
Confidence level:confident
Coverage over the Query: 312-327,367-528,540-633
View the alignment between query and template
View the model in PyMOL