BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6842
(189 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LL4|A Chain A, Structure Of The H13a Mutant Of Ykr043c In Complex With
Fructose-1,6- Bisphosphate
pdb|3LL4|B Chain B, Structure Of The H13a Mutant Of Ykr043c In Complex With
Fructose-1,6- Bisphosphate
Length = 292
Score = 27.7 bits (60), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 10/40 (25%), Positives = 20/40 (50%)
Query: 124 KELMKLWNLHVMKYGWGREKELMKLWNLHVMKYGYIVWLG 163
+ + ++ NLH GR ++M + H ++Y +W G
Sbjct: 171 RAIARIQNLHRKHQSEGRASDIMVFAHGHALRYFAAIWFG 210
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,282,495
Number of Sequences: 62578
Number of extensions: 266103
Number of successful extensions: 582
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 579
Number of HSP's gapped (non-prelim): 8
length of query: 189
length of database: 14,973,337
effective HSP length: 93
effective length of query: 96
effective length of database: 9,153,583
effective search space: 878743968
effective search space used: 878743968
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)