Query psy6845
Match_columns 67
No_of_seqs 29 out of 31
Neff 1.9
Searched_HMMs 46136
Date Fri Aug 16 19:52:56 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy6845.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6845hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG4458|consensus 99.9 2.5E-24 5.4E-29 139.3 2.6 42 1-42 1-44 (78)
2 cd01268 Numb Numb Phosphotyros 94.9 0.018 3.9E-07 39.3 1.9 24 22-45 3-27 (138)
3 cd01270 DYC-1 DYC-1 (DYB-1 bin 94.5 0.018 3.9E-07 39.7 1.2 15 30-44 1-15 (140)
4 cd01215 Dab Disabled (Dab) Pho 82.1 0.44 9.6E-06 32.9 0.1 18 29-46 10-27 (139)
5 PF11730 DUF3297: Protein of u 77.1 1.1 2.4E-05 28.9 0.8 19 15-33 5-23 (71)
6 cd01273 CED-6 CED-6 Phosphotyr 64.8 4.1 8.8E-05 26.8 1.3 16 28-43 5-20 (142)
7 cd00934 PTB Phosphotyrosine-bi 56.5 6.2 0.00014 23.3 1.0 15 31-45 1-15 (123)
8 PF04411 DUF524: Protein of un 49.8 5.4 0.00012 25.5 -0.0 32 15-46 81-112 (154)
9 KOG4412|consensus 49.6 5.1 0.00011 30.5 -0.2 22 7-30 29-50 (226)
10 cd01267 CED6_AIDA1b Phosphotyr 49.2 8.9 0.00019 24.4 0.9 15 32-46 2-16 (132)
11 smart00462 PTB Phosphotyrosine 46.8 11 0.00023 22.9 1.0 14 30-43 2-15 (134)
12 PF12644 DUF3782: Protein of u 43.4 5.3 0.00011 22.6 -0.7 15 19-33 42-56 (64)
13 PF13019 Telomere_Sde2: Telome 41.4 13 0.00028 26.5 0.8 25 37-61 133-157 (162)
14 cd01209 SHC SHC phosphotyrosin 40.3 17 0.00037 25.9 1.3 22 24-45 3-24 (160)
15 PF11214 Med2: Mediator comple 36.8 33 0.00071 23.3 2.2 14 45-58 87-100 (105)
16 cd01208 X11 X11 Phosphotyrosin 34.9 22 0.00047 25.3 1.2 14 30-43 3-16 (156)
17 PF06936 Selenoprotein_S: Sele 30.8 48 0.001 23.8 2.3 16 45-60 104-119 (190)
18 COG5417 Uncharacterized small 30.5 17 0.00037 24.0 0.1 12 13-24 16-27 (81)
19 PF13998 MgrB: MgrB protein 29.9 26 0.00056 19.3 0.7 17 25-41 13-29 (29)
20 cd01274 AIDA-1b AIDA-1b Phosph 28.3 31 0.00068 22.7 1.0 13 32-44 2-14 (127)
21 PHA02087 hypothetical protein 27.1 31 0.00067 22.8 0.8 30 3-35 42-71 (83)
22 PF10669 Phage_Gp23: Protein g 27.0 44 0.00095 23.4 1.6 21 39-59 44-64 (121)
23 PF08265 YL1_C: YL1 nuclear pr 26.6 35 0.00075 18.3 0.8 13 17-29 16-28 (30)
24 PF12500 TRSP: TRSP domain C t 25.8 21 0.00045 24.8 -0.2 24 17-40 91-118 (155)
25 KOG1094|consensus 25.3 37 0.00081 29.9 1.2 24 9-32 318-341 (807)
26 PF08632 Zds_C: Activator of m 24.7 26 0.00055 21.6 0.1 15 14-28 6-20 (53)
27 PF00640 PID: Phosphotyrosine 24.3 36 0.00079 20.5 0.7 10 34-43 1-10 (140)
28 PF07966 A1_Propeptide: A1 Pro 23.2 19 0.00041 18.7 -0.6 7 18-24 2-8 (29)
29 cd04190 Chitin_synth_C C-termi 21.3 31 0.00068 23.0 -0.0 7 20-26 3-9 (244)
No 1
>KOG4458|consensus
Probab=99.89 E-value=2.5e-24 Score=139.34 Aligned_cols=42 Identities=52% Similarity=0.883 Sum_probs=39.2
Q ss_pred CCCCcc--ccccccCCCccccccCCchhhhhhcceEeeeechhh
Q psy6845 1 MPSKKQ--QYNLVQQDEYDTRIPMHSEEAFQHGITFQAKTRQKN 42 (67)
Q Consensus 1 MPskk~--~YnLV~dD~~D~RIPLHnEeAFqHGI~FqAKyig~~ 42 (67)
||++++ .||++-||++|||||||||.||||||+|+|||+|+-
T Consensus 1 mp~k~k~~pydii~dd~~d~riplhne~a~qhgi~feakyvgsl 44 (78)
T KOG4458|consen 1 MPSKKKHGPYDIIADDGHDCRIPLHNEDAFQHGICFEAKYVGSL 44 (78)
T ss_pred CCcccccCCcceeecccccceeeccchhhhhccceEeeeeeeee
Confidence 999876 788888899999999999999999999999999975
No 2
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain. Numb Phosphotyrosine-binding (PTB) domain. Numb is a membrane associated adaptor protein, which is a determinant of asymmetric cell division. Numb has an N-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=94.86 E-value=0.018 Score=39.28 Aligned_cols=24 Identities=25% Similarity=0.324 Sum_probs=20.7
Q ss_pred CCchhhhhhcc-eEeeeechhhHHH
Q psy6845 22 MHSEEAFQHGI-TFQAKTRQKNKKE 45 (67)
Q Consensus 22 LHnEeAFqHGI-~FqAKyig~~~~~ 45 (67)
.|+||++.+|. +|.|||.|.-+-.
T Consensus 3 ~~~~~~~~~g~~~f~vKyLG~veV~ 27 (138)
T cd01268 3 QTDEEAVRTGTCSFPVKYLGHVEVD 27 (138)
T ss_pred cCCHHHHhcCceeEEeEecceEEcc
Confidence 58999999998 9999999975543
No 3
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain. DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain. DYC-1 contains an N-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. The PTB domains of both SHC and IRS-1, for example, bind to a NPXpY sequence. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated; whereas, other PTB domains can bind motifs lacking tyrosine residues altogether.
Probab=94.50 E-value=0.018 Score=39.74 Aligned_cols=15 Identities=47% Similarity=0.645 Sum_probs=13.1
Q ss_pred hcceEeeeechhhHH
Q psy6845 30 HGITFQAKTRQKNKK 44 (67)
Q Consensus 30 HGI~FqAKyig~~~~ 44 (67)
|||+|+|||+|+-+-
T Consensus 1 ~GitF~vKYlG~~eV 15 (140)
T cd01270 1 HGITFEAKYVGSEEV 15 (140)
T ss_pred CceEEEEEEcceEEe
Confidence 899999999998653
No 4
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain. Disabled (Dab) Phosphotyrosine-binding domain. Dab is a cystosolic adaptor protein, which binds to the cytoplasmic tails of lipoprotein receptors, such as ApoER2 and VLDLR, via its PTB domain. The dab PTB domain has a preference for unphosphorylated tyrosine within an NPxY motif. Additionally, the Dab PTB domain, which is structurally similar to PH domains, binds to phosphatidlyinositol phosphate 4,5 bisphosphate in a manner characteristic of phosphoinositide binding PH domains.
Probab=82.11 E-value=0.44 Score=32.95 Aligned_cols=18 Identities=17% Similarity=0.388 Sum_probs=15.2
Q ss_pred hhcceEeeeechhhHHHH
Q psy6845 29 QHGITFQAKTRQKNKKEE 46 (67)
Q Consensus 29 qHGI~FqAKyig~~~~~~ 46 (67)
.+||+|+|||+|+.+-+|
T Consensus 10 g~gv~f~aKylG~~eV~e 27 (139)
T cd01215 10 GNGVSYKAKLIGIQEVDK 27 (139)
T ss_pred CCcEEEEEEecccEeccc
Confidence 599999999999876553
No 5
>PF11730 DUF3297: Protein of unknown function (DUF3297); InterPro: IPR021724 This family is expressed in Proteobacteria and Actinobacteria. The function is not known.
Probab=77.13 E-value=1.1 Score=28.88 Aligned_cols=19 Identities=26% Similarity=0.471 Sum_probs=15.8
Q ss_pred CccccccCCchhhhhhcce
Q psy6845 15 EYDTRIPMHSEEAFQHGIT 33 (67)
Q Consensus 15 ~~D~RIPLHnEeAFqHGI~ 33 (67)
+-|-|-|-|++++|+|||-
T Consensus 5 S~~P~Sp~~~~~~l~~~iG 23 (71)
T PF11730_consen 5 SINPRSPHYDAEVLERGIG 23 (71)
T ss_pred ccCCCChhhHHHHHhcCcc
Confidence 4578999999999999654
No 6
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. CED-6 Phosphotyrosine-binding (PTB) domain. CED6 is an adaptor protein involved in the engulfment of apoptotic cells. It has a C-terminal PTB domain, which can bind to NPXY motifs. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=64.78 E-value=4.1 Score=26.80 Aligned_cols=16 Identities=13% Similarity=0.042 Sum_probs=12.4
Q ss_pred hhhcceEeeeechhhH
Q psy6845 28 FQHGITFQAKTRQKNK 43 (67)
Q Consensus 28 FqHGI~FqAKyig~~~ 43 (67)
..++|+|.|||.|.-+
T Consensus 5 ~~g~v~f~vkyLG~~e 20 (142)
T cd01273 5 INGHVEYVAKFLGCVE 20 (142)
T ss_pred ccCceEEEEEEeeeEE
Confidence 3456999999999743
No 7
>cd00934 PTB Phosphotyrosine-binding (PTB) domain. Phosphotyrosine-binding (PTB) domain; PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. The PTB domain of SHC binds to a NPXpY sequence. More recent studies have found that some types of PTB domains such as the neuronal protein X11 and in the cell-fate determinant protein Numb can bind to peptides which are not tyrosine phosphorylated; whereas, other PTB domains can bind motifs lacking tyrosine residues altogether.
Probab=56.51 E-value=6.2 Score=23.30 Aligned_cols=15 Identities=27% Similarity=0.332 Sum_probs=12.0
Q ss_pred cceEeeeechhhHHH
Q psy6845 31 GITFQAKTRQKNKKE 45 (67)
Q Consensus 31 GI~FqAKyig~~~~~ 45 (67)
|++|.++|.|+-.-.
T Consensus 1 ~~~f~v~ylG~~~v~ 15 (123)
T cd00934 1 GISFNVKYLGSVEVP 15 (123)
T ss_pred CcEEEEEEEEEEEec
Confidence 689999999986543
No 8
>PF04411 DUF524: Protein of unknown function (DUF524); InterPro: IPR007505 This domain has been identified as a member of the PD-(D/E)XK nuclease superfamily through transitive meta profile searches []. The domain has two additional beta-strands inserted to the core fold after the first core alpha-helix. It has been speculated that it could function as s methylation-dependent restriction [].
Probab=49.82 E-value=5.4 Score=25.46 Aligned_cols=32 Identities=19% Similarity=0.220 Sum_probs=24.4
Q ss_pred CccccccCCchhhhhhcceEeeeechhhHHHH
Q psy6845 15 EYDTRIPMHSEEAFQHGITFQAKTRQKNKKEE 46 (67)
Q Consensus 15 ~~D~RIPLHnEeAFqHGI~FqAKyig~~~~~~ 46 (67)
--|++|=+...+..+.=|.|.|||+-......
T Consensus 81 rPDi~L~i~~~~~~~~~iifDAKYR~~~~~~~ 112 (154)
T PF04411_consen 81 RPDIVLEIYKKGGYGGSIIFDAKYRIDSNIWK 112 (154)
T ss_pred CCCEEEEEEECCCccEEEEEEeeeecchhccc
Confidence 45777777777777788999999987665443
No 9
>KOG4412|consensus
Probab=49.61 E-value=5.1 Score=30.45 Aligned_cols=22 Identities=36% Similarity=0.567 Sum_probs=17.7
Q ss_pred ccccccCCCccccccCCchhhhhh
Q psy6845 7 QYNLVQQDEYDTRIPMHSEEAFQH 30 (67)
Q Consensus 7 ~YnLV~dD~~D~RIPLHnEeAFqH 30 (67)
.-|++ |++|.|+|||=--.|+|
T Consensus 29 SL~~r--~dqD~Rt~LHwa~S~g~ 50 (226)
T KOG4412|consen 29 SLNAR--DDQDGRTPLHWACSFGH 50 (226)
T ss_pred hhhcc--ccccCCceeeeeeecCc
Confidence 45666 58999999998888866
No 10
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain. Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=49.16 E-value=8.9 Score=24.43 Aligned_cols=15 Identities=13% Similarity=0.146 Sum_probs=11.8
Q ss_pred ceEeeeechhhHHHH
Q psy6845 32 ITFQAKTRQKNKKEE 46 (67)
Q Consensus 32 I~FqAKyig~~~~~~ 46 (67)
|+|.|||.|+.+-.+
T Consensus 2 v~f~vkyLGs~~V~~ 16 (132)
T cd01267 2 VVYRAKFLGSLEIGK 16 (132)
T ss_pred cEEEEEEEEEEEecC
Confidence 789999999865443
No 11
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain. PTB/PI domain structure similar to those of pleckstrin homology (PH) and IRS-1-like PTB domains.
Probab=46.80 E-value=11 Score=22.89 Aligned_cols=14 Identities=21% Similarity=0.401 Sum_probs=11.8
Q ss_pred hcceEeeeechhhH
Q psy6845 30 HGITFQAKTRQKNK 43 (67)
Q Consensus 30 HGI~FqAKyig~~~ 43 (67)
.|++|.|+|.|+-.
T Consensus 2 ~~~~f~v~YLGs~~ 15 (134)
T smart00462 2 SGVSFRVKYLGSVE 15 (134)
T ss_pred CceEEEEEEEEEEE
Confidence 58999999999754
No 12
>PF12644 DUF3782: Protein of unknown function (DUF3782); InterPro: IPR024271 This functionally uncharacterised family of proteins is found in bacteria and archaea. Proteins in this family are typically between 91 and 186 amino acids in length.
Probab=43.44 E-value=5.3 Score=22.60 Aligned_cols=15 Identities=47% Similarity=0.742 Sum_probs=11.8
Q ss_pred cccCCchhhhhhcce
Q psy6845 19 RIPMHSEEAFQHGIT 33 (67)
Q Consensus 19 RIPLHnEeAFqHGI~ 33 (67)
|==++||.||..|+.
T Consensus 42 ~~~~~~e~afr~G~~ 56 (64)
T PF12644_consen 42 RWGLESEEAFRQGFR 56 (64)
T ss_pred HhHHHHHHHHHHHHH
Confidence 445789999999975
No 13
>PF13019 Telomere_Sde2: Telomere stability and silencing
Probab=41.42 E-value=13 Score=26.51 Aligned_cols=25 Identities=44% Similarity=0.557 Sum_probs=14.4
Q ss_pred eechhhHHHHHHHHHHHHHhhhhcc
Q psy6845 37 KTRQKNKKEEKKKKEEEKKKREKMV 61 (67)
Q Consensus 37 Kyig~~~~~~~~~~~~~~~~~~~~~ 61 (67)
+|...+...+++++|+.++|.|+++
T Consensus 133 ~~~~~~~er~k~~~e~~~~k~~~l~ 157 (162)
T PF13019_consen 133 EWLEKKPEREKKEKEKRRKKLEKLV 157 (162)
T ss_pred HHHhcChhHHHHHHHHHHHHHHHHH
Confidence 4444455555666666666666654
No 14
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain. SHC phosphotyrosine-binding (PTB) domain. SHC is a substrate for receptor tyrosine kinases, which can interact with phosphoproteins at NPXY motifs. SHC contains an PTB domain followed by an SH2 domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=40.25 E-value=17 Score=25.87 Aligned_cols=22 Identities=5% Similarity=0.132 Sum_probs=17.3
Q ss_pred chhhhhhcceEeeeechhhHHH
Q psy6845 24 SEEAFQHGITFQAKTRQKNKKE 45 (67)
Q Consensus 24 nEeAFqHGI~FqAKyig~~~~~ 45 (67)
+++.-..|++|.|||.|.-+-.
T Consensus 3 ~~~l~~~GV~y~vrYlG~~eV~ 24 (160)
T cd01209 3 DDKVMGPGVSYLVRYMGCVEVL 24 (160)
T ss_pred HHHhhcCCcEEEEEEeeEEeeh
Confidence 3556689999999999986544
No 15
>PF11214 Med2: Mediator complex subunit 2; InterPro: IPR021017 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins. The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22. The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4. The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16. The CDK8 module contains: MED12, MED13, CCNC and CDK8. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. This family of mediator complex subunit 2 proteins is conserved in fungi. Cyclin-dependent kinase CDK8 or Srb10 interacts with and phosphorylates Med2. Post-translational modifications of Mediator subunits are important for regulation of gene expression [, ].
Probab=36.83 E-value=33 Score=23.26 Aligned_cols=14 Identities=64% Similarity=0.914 Sum_probs=7.0
Q ss_pred HHHHHHHHHHHhhh
Q psy6845 45 EEKKKKEEEKKKRE 58 (67)
Q Consensus 45 ~~~~~~~~~~~~~~ 58 (67)
|+|.+.|+|.++||
T Consensus 87 e~K~keE~E~~rkE 100 (105)
T PF11214_consen 87 EEKIKEEEERKRKE 100 (105)
T ss_pred HHHHHHHHHHHHHH
Confidence 34445555555554
No 16
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 Phosphotyrosine-binding (PTB) domain. The neuronal protein X11 has a PTB domain followed by two PDZ domains. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether. X11 binds to the cytoplasmic domain of the beta-amyloid precursor protein (beta-APP) and does not require the substrate to be tyrosine-phosphorylated for binding.
Probab=34.86 E-value=22 Score=25.29 Aligned_cols=14 Identities=21% Similarity=0.463 Sum_probs=12.4
Q ss_pred hcceEeeeechhhH
Q psy6845 30 HGITFQAKTRQKNK 43 (67)
Q Consensus 30 HGI~FqAKyig~~~ 43 (67)
.||.|.|+|.|.-.
T Consensus 3 ~Gv~f~a~YlG~t~ 16 (156)
T cd01208 3 EGVLFRARYLGSTQ 16 (156)
T ss_pred CceEEEEEeeceee
Confidence 59999999999864
No 17
>PF06936 Selenoprotein_S: Selenoprotein S (SelS); InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner []. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.; GO: 0008430 selenium binding, 0006886 intracellular protein transport, 0030176 integral to endoplasmic reticulum membrane; PDB: 2Q2F_A.
Probab=30.78 E-value=48 Score=23.78 Aligned_cols=16 Identities=56% Similarity=0.920 Sum_probs=8.8
Q ss_pred HHHHHHHHHHHhhhhc
Q psy6845 45 EEKKKKEEEKKKREKM 60 (67)
Q Consensus 45 ~~~~~~~~~~~~~~~~ 60 (67)
.||++++||+|.|+++
T Consensus 104 kEKq~q~EEEKRrqki 119 (190)
T PF06936_consen 104 KEKQKQEEEEKRRQKI 119 (190)
T ss_dssp HHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHH
Confidence 4455555556665554
No 18
>COG5417 Uncharacterized small protein [Function unknown]
Probab=30.49 E-value=17 Score=23.95 Aligned_cols=12 Identities=33% Similarity=0.501 Sum_probs=9.9
Q ss_pred CCCccccccCCc
Q psy6845 13 QDEYDTRIPMHS 24 (67)
Q Consensus 13 dD~~D~RIPLHn 24 (67)
-+.||+|+|-|-
T Consensus 16 g~~yDLrl~d~~ 27 (81)
T COG5417 16 GGTYDLRLPDYL 27 (81)
T ss_pred CceEEEeccccc
Confidence 378999999874
No 19
>PF13998 MgrB: MgrB protein
Probab=29.94 E-value=26 Score=19.29 Aligned_cols=17 Identities=24% Similarity=0.143 Sum_probs=14.2
Q ss_pred hhhhhhcceEeeeechh
Q psy6845 25 EEAFQHGITFQAKTRQK 41 (67)
Q Consensus 25 EeAFqHGI~FqAKyig~ 41 (67)
.+.|+.||+.-.+|+.|
T Consensus 13 g~~F~~GiC~it~~iP~ 29 (29)
T PF13998_consen 13 GEQFFSGICSITRFIPW 29 (29)
T ss_pred CCCceeeeeEEeeecCC
Confidence 36799999999998875
No 20
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain. AIDA-1b Phosphotyrosine-binding (PTB) domain. AIDA-1b is an amyloid-beta precursor protein interacting protein. It consists of ankyrin repeats, a SAM domain and a C-terminal PTB domain. PTB domains have a PH-like fold and are found in various eukaryotic signaling molecules. They were initially identified based upon their ability to recognize phosphorylated tyrosine residues In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. More recent studies have found that some types of PTB domains can bind to peptides which are not tyrosine phosphorylated or lack tyrosine residues altogether.
Probab=28.26 E-value=31 Score=22.66 Aligned_cols=13 Identities=8% Similarity=0.100 Sum_probs=10.6
Q ss_pred ceEeeeechhhHH
Q psy6845 32 ITFQAKTRQKNKK 44 (67)
Q Consensus 32 I~FqAKyig~~~~ 44 (67)
|.|.|||.|.-+-
T Consensus 2 v~f~akyLGs~eV 14 (127)
T cd01274 2 VVYRAHYLGSLEI 14 (127)
T ss_pred cEEEEEccceEEc
Confidence 7899999997553
No 21
>PHA02087 hypothetical protein
Probab=27.07 E-value=31 Score=22.80 Aligned_cols=30 Identities=40% Similarity=0.534 Sum_probs=21.0
Q ss_pred CCccccccccCCCccccccCCchhhhhhcceEe
Q psy6845 3 SKKQQYNLVQQDEYDTRIPMHSEEAFQHGITFQ 35 (67)
Q Consensus 3 skk~~YnLV~dD~~D~RIPLHnEeAFqHGI~Fq 35 (67)
.+.-+|-|||.|+--+-+| |+-=.-||+|.
T Consensus 42 nk~v~y~lvdsdg~~ielp---e~~ggggi~fd 71 (83)
T PHA02087 42 NKLVQYMLVDSDGVKIELP---ESEGGGGITFD 71 (83)
T ss_pred ccceeEEEEcCCCcEEECC---cccCCCceeec
Confidence 3445899999888777776 33345678875
No 22
>PF10669 Phage_Gp23: Protein gp23 (Bacteriophage A118); InterPro: IPR018926 This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli. The function is currently unknown.
Probab=26.98 E-value=44 Score=23.38 Aligned_cols=21 Identities=43% Similarity=0.635 Sum_probs=11.6
Q ss_pred chhhHHHHHHHHHHHHHhhhh
Q psy6845 39 RQKNKKEEKKKKEEEKKKREK 59 (67)
Q Consensus 39 ig~~~~~~~~~~~~~~~~~~~ 59 (67)
+...-|||..|+|++..+|++
T Consensus 44 ~r~~MKEER~K~E~~~q~r~r 64 (121)
T PF10669_consen 44 VRIRMKEERSKKEEKRQKRNR 64 (121)
T ss_pred HHHHHHHHHHHHHHHHHHHhh
Confidence 344456666666665555443
No 23
>PF08265 YL1_C: YL1 nuclear protein C-terminal domain; InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=26.63 E-value=35 Score=18.25 Aligned_cols=13 Identities=31% Similarity=0.644 Sum_probs=11.4
Q ss_pred cccccCCchhhhh
Q psy6845 17 DTRIPMHSEEAFQ 29 (67)
Q Consensus 17 D~RIPLHnEeAFq 29 (67)
-++||-+|-+||+
T Consensus 16 ~T~l~Y~n~~ayk 28 (30)
T PF08265_consen 16 KTGLPYANSEAYK 28 (30)
T ss_pred CCCCcccCHHHhh
Confidence 4789999999996
No 24
>PF12500 TRSP: TRSP domain C terminus to PRTase_2 ; InterPro: IPR022537 This domain is found in bacteria, and is typically between 174 and 217 amino acids in length. There is a conserved TRSP sequence motif.
Probab=25.83 E-value=21 Score=24.84 Aligned_cols=24 Identities=25% Similarity=0.387 Sum_probs=20.0
Q ss_pred cccccCCc----hhhhhhcceEeeeech
Q psy6845 17 DTRIPMHS----EEAFQHGITFQAKTRQ 40 (67)
Q Consensus 17 D~RIPLHn----EeAFqHGI~FqAKyig 40 (67)
=||=|+|. .-|.++|+.|.+=|-.
T Consensus 91 TTRSPI~~~d~~gyaI~~~~~F~~~~~~ 118 (155)
T PF12500_consen 91 TTRSPILPVDDPGYAIRSGFSFPDPYDP 118 (155)
T ss_pred CCCCCceecCCCCCccceeeEecCCCCC
Confidence 37889998 8999999999987643
No 25
>KOG1094|consensus
Probab=25.28 E-value=37 Score=29.88 Aligned_cols=24 Identities=25% Similarity=0.310 Sum_probs=17.0
Q ss_pred ccccCCCccccccCCchhhhhhcc
Q psy6845 9 NLVQQDEYDTRIPMHSEEAFQHGI 32 (67)
Q Consensus 9 nLV~dD~~D~RIPLHnEeAFqHGI 32 (67)
|++++-.-+.||||||--|-.--|
T Consensus 318 ~~~n~~~R~vrvPl~nR~ar~~k~ 341 (807)
T KOG1094|consen 318 DLGNPRARAVRVPLHNRVARFLKI 341 (807)
T ss_pred ccCCCccceEEeeccchhhheeEE
Confidence 445555678999999998854333
No 26
>PF08632 Zds_C: Activator of mitotic machinery Cdc14 phosphatase activation C-term; InterPro: IPR013941 This region of the Zds1 protein is critical for sporulation and has also been shown to suppress the calcium sensitivity of Zds1 deletions []. The C-terminal motif is common to both Zds1 and Zds2 proteins, both of which are putative interactors of Cdc55 and are required for the completion of mitotic exit and cytokinesis. They both contribute to timely Cdc14 activation during mitotic exit and are required downstream of separase to facilitate nucleolar Cdc14 release[].
Probab=24.68 E-value=26 Score=21.63 Aligned_cols=15 Identities=53% Similarity=0.815 Sum_probs=12.7
Q ss_pred CCccccccCCchhhh
Q psy6845 14 DEYDTRIPMHSEEAF 28 (67)
Q Consensus 14 D~~D~RIPLHnEeAF 28 (67)
+-+|.|.|+|-|-|.
T Consensus 6 ~~~~~R~pi~vERaI 20 (53)
T PF08632_consen 6 DMNDTRFPIHVERAI 20 (53)
T ss_pred eeecccCchHHHHHH
Confidence 468999999999875
No 27
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains.; InterPro: IPR006020 The PI domain has a similar structure to the insulin receptor substrate-1 PTB domain, a 7-stranded beta-sandwich, capped by a C-terminal helix. However, the PI domain contains an additional short N-terminal helix and a large insertion between strands 1 and 2, which forms a helix and 2 long connecting loops. The substrate peptide fits into a surface cleft formed from the C-terminal helix and strand 5 [].; GO: 0005515 protein binding; PDB: 1WGU_A 2YT0_A 2YT1_A 2YSZ_A 2ROZ_B 3SO6_A 2DYQ_A 1AQC_A 1X11_B 1WJ1_A ....
Probab=24.32 E-value=36 Score=20.51 Aligned_cols=10 Identities=20% Similarity=0.202 Sum_probs=7.7
Q ss_pred EeeeechhhH
Q psy6845 34 FQAKTRQKNK 43 (67)
Q Consensus 34 FqAKyig~~~ 43 (67)
|.|||.|+-.
T Consensus 1 F~vkYLGs~~ 10 (140)
T PF00640_consen 1 FEVKYLGSVE 10 (140)
T ss_dssp EEEEEEEEEE
T ss_pred CEEEEEEEEE
Confidence 7889988743
No 28
>PF07966 A1_Propeptide: A1 Propeptide ; InterPro: IPR012848 Most eukaryotic endopeptidases (MEROPS peptidase family A1) are synthesised with signal and propeptides. The animal pepsin-like endopeptidase propeptides form a distinct family of propeptides, which contain a conserved motif approximately 30 residues long. In pepsinogen A, the first 11 residues of the mature pepsin sequence are displaced by residues of the propeptide. The propeptide contains two helices that block the active site cleft, in particular the conserved Asp11 residue, in pepsin, hydrogen bonds to a conserved Arg residue in the propeptide. This hydrogen bond stabilises the propeptide conformation and is probably responsible for triggering the conversion of pepsinogen to pepsin under acidic conditions [, ]. ; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis; PDB: 1AVF_Q 1HTR_P 3PSG_A 2PSG_A 3VCM_Q 1TZS_P.
Probab=23.24 E-value=19 Score=18.70 Aligned_cols=7 Identities=43% Similarity=0.942 Sum_probs=4.5
Q ss_pred ccccCCc
Q psy6845 18 TRIPMHS 24 (67)
Q Consensus 18 ~RIPLHn 24 (67)
.||||+-
T Consensus 2 ~rIPL~K 8 (29)
T PF07966_consen 2 VRIPLKK 8 (29)
T ss_dssp EEEEEEE
T ss_pred EEEeccC
Confidence 4777763
No 29
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
Probab=21.26 E-value=31 Score=23.01 Aligned_cols=7 Identities=29% Similarity=0.596 Sum_probs=5.4
Q ss_pred ccCCchh
Q psy6845 20 IPMHSEE 26 (67)
Q Consensus 20 IPLHnEe 26 (67)
||+|||+
T Consensus 3 ip~yNE~ 9 (244)
T cd04190 3 VTMYNED 9 (244)
T ss_pred EeeecCC
Confidence 7888885
Done!