BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6853
(154 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3DWB|A Chain A, Structure Of Human Ece-1 Complexed With Phosphoramidon
Length = 670
Score = 29.3 bits (64), Expect = 0.98, Method: Compositional matrix adjust.
Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
Query: 81 IVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQEEM-KLLESDTDEAFR 129
++++ + G G PSR+ +N+ E ++++ Y ++ KLL +EA R
Sbjct: 152 VIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEEAIR 201
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
Spinach In Complex With Nad
pdb|4A0M|B Chain B, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
Spinach In Complex With Nad
pdb|4A0M|C Chain C, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
Spinach In Complex With Nad
pdb|4A0M|D Chain D, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
Spinach In Complex With Nad
Length = 496
Score = 28.9 bits (63), Expect = 1.1, Method: Composition-based stats.
Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
Query: 56 WFAGKAMHRDKFVRDFLGK-NEKCKAIVKISKIGSGAPSREPVMNEEEKKQLMLHYYRKQ 114
W A HR ++R K EK VK+ I SG P E V++ ++ Y+ Q
Sbjct: 63 WSATSGAHRATYLRAIAAKITEKKDHFVKLETIDSGKPFDEAVLDIDDVASC-FEYFAGQ 121
Query: 115 EE 116
E
Sbjct: 122 AE 123
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.134 0.409
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,787,476
Number of Sequences: 62578
Number of extensions: 182362
Number of successful extensions: 467
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 464
Number of HSP's gapped (non-prelim): 7
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)