BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6889
(166 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PTR|B Chain B, Phf2 Jumonji Domain
pdb|3PU3|A Chain A, Phf2 Jumonji Domain-Nog Complex
pdb|3PU3|B Chain B, Phf2 Jumonji Domain-Nog Complex
pdb|3PU8|B Chain B, Phf2 Jumonji-Nog-Fe(Ii) Complex
pdb|3PU8|A Chain A, Phf2 Jumonji-Nog-Fe(Ii) Complex
pdb|3PUA|A Chain A, Phf2 Jumonji-Nog-Ni(Ii)
pdb|3PUS|A Chain A, Phf2 Jumonji-Nog-Ni(Ii)
pdb|3PUS|B Chain B, Phf2 Jumonji-Nog-Ni(Ii)
Length = 392
Score = 26.9 bits (58), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 5/50 (10%)
Query: 17 LNGVFHKWSQNEGRSVRPSQISRSVRPSQ----IPRSVRPSQ-IPRSVRP 61
LNG F W++ + + ++ +PSQ + + +R S+ ++VRP
Sbjct: 343 LNGAFRSWTKKQALAEHEDELPEHFKPSQLIKDLAKEIRLSENASKAVRP 392
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.132 0.383
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,772,867
Number of Sequences: 62578
Number of extensions: 180482
Number of successful extensions: 246
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 245
Number of HSP's gapped (non-prelim): 3
length of query: 166
length of database: 14,973,337
effective HSP length: 92
effective length of query: 74
effective length of database: 9,216,161
effective search space: 681995914
effective search space used: 681995914
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 47 (22.7 bits)