Diaphorina citri psyllid: psy6889

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MRSSDNELKLNDNEWKLNGVFHKWSQNEGRSVRPSQISRSVRPSQIPRSVRPSQIPRSVRPSQIPGPVRPSQIPGSVRPSQIPGSVRPSQIPRSVRPSQIPGSVRPSQIPGSVRPSQIPGSVRPSQIPRKSKEPKLMGREVERRKFMVRGKNMVFGVQEASLVKII

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcc

**************************************************************************************************************************************************MVRGKNMVFGV***SLVKII

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRSSDNELKLNDNEWKLNGVFHKWSQNEGRSVRPSQISRSVRPSQIPRSVRPSQIPRSVRPSQIPGPVRPSQIPGSVRPSQIPGSVRPSQIPRSVRPSQIPGSVRPSQIPGSVRPSQIPGSVRPSQIPRKSKEPKLMGREVERRKFMVRGKNMVFGVQEASLVKII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005575 [CC]	cellular_component	probable

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted