Query         psy691
Match_columns 134
No_of_seqs    204 out of 2345
Neff          10.3
Searched_HMMs 46136
Date          Fri Aug 16 21:33:32 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy691.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/691hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 8.6E-23 1.9E-27  135.8   1.1   74   59-132   187-260 (279)
  2 KOG2462|consensus               99.8 1.2E-19 2.6E-24  120.9   2.6   74   57-132   159-232 (279)
  3 KOG3576|consensus               99.8 2.4E-19 5.2E-24  114.8   2.6   78   54-131   112-189 (267)
  4 KOG3623|consensus               99.7 4.5E-19 9.8E-24  130.9   3.0   82   50-131   885-966 (1007)
  5 KOG3623|consensus               99.6 4.8E-16 1.1E-20  115.1   3.0   76   57-132   238-326 (1007)
  6 KOG3576|consensus               99.4 7.6E-14 1.7E-18   89.8   0.8   74   55-128   141-225 (267)
  7 PHA02768 hypothetical protein;  99.4 4.5E-13 9.8E-18   69.1   2.6   42   60-103     6-47  (55)
  8 PHA02768 hypothetical protein;  99.3 1.1E-12 2.4E-17   67.6   2.2   46   87-134     5-50  (55)
  9 KOG1074|consensus               99.2 9.8E-12 2.1E-16   93.8   4.1   74   55-128   601-681 (958)
 10 KOG3608|consensus               99.2 4.7E-12   1E-16   87.6   1.0   75   56-132   234-309 (467)
 11 KOG1074|consensus               99.2 1.1E-11 2.4E-16   93.6   2.9   57   58-114   352-408 (958)
 12 PHA00733 hypothetical protein   99.1 5.8E-11 1.3E-15   72.8   1.6   75   55-131    36-115 (128)
 13 PF13465 zf-H2C2_2:  Zinc-finge  99.1 1.5E-10 3.3E-15   51.4   2.5   25   74-98      1-25  (26)
 14 PHA00733 hypothetical protein   99.0 7.1E-10 1.5E-14   68.0   4.5   56   55-112    69-124 (128)
 15 PF13465 zf-H2C2_2:  Zinc-finge  99.0   3E-10 6.5E-15   50.4   1.8   26  102-127     1-26  (26)
 16 KOG3608|consensus               98.9   6E-10 1.3E-14   77.4   2.9   79   53-132   286-369 (467)
 17 PHA00616 hypothetical protein   98.9 7.6E-10 1.6E-14   54.5   1.5   32   60-91      2-33  (44)
 18 PLN03086 PRLI-interacting fact  98.8 4.4E-09 9.6E-14   78.1   4.8   67   55-126   449-515 (567)
 19 PHA00616 hypothetical protein   98.8 2.2E-09 4.9E-14   52.9   1.7   33   87-119     1-33  (44)
 20 PHA00732 hypothetical protein   98.7 1.3E-08 2.8E-13   57.2   2.8   48   59-112     1-49  (79)
 21 PLN03086 PRLI-interacting fact  98.7 2.2E-08 4.8E-13   74.5   4.3   69   58-129   477-555 (567)
 22 PF05605 zf-Di19:  Drought indu  98.5 2.7E-07 5.9E-12   48.2   4.2   51   59-112     2-54  (54)
 23 COG5189 SFP1 Putative transcri  98.4 4.1E-07 8.9E-12   62.8   3.6   54   56-109   346-420 (423)
 24 PF00096 zf-C2H2:  Zinc finger,  98.3 4.4E-07 9.5E-12   38.8   2.2   22   60-81      1-22  (23)
 25 PF00096 zf-C2H2:  Zinc finger,  98.3 5.5E-07 1.2E-11   38.5   2.0   23   88-110     1-23  (23)
 26 KOG3993|consensus               98.3 3.9E-07 8.4E-12   65.0   2.0   53   60-112   296-381 (500)
 27 PHA00732 hypothetical protein   98.2 7.8E-07 1.7E-11   50.0   2.2   39   87-128     1-40  (79)
 28 PF13912 zf-C2H2_6:  C2H2-type   98.0 3.3E-06 7.2E-11   37.5   1.8   25   87-111     1-25  (27)
 29 PF13894 zf-C2H2_4:  C2H2-type   98.0 5.8E-06 1.3E-10   35.4   2.1   22   60-81      1-22  (24)
 30 PF13894 zf-C2H2_4:  C2H2-type   98.0 8.5E-06 1.8E-10   34.8   2.4   24   88-111     1-24  (24)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.9 9.4E-06   2E-10   36.0   1.9   25   59-83      1-25  (27)
 32 PF09237 GAGA:  GAGA factor;  I  97.8 4.7E-05   1E-09   38.5   3.7   30   57-86     22-51  (54)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.8 1.7E-05 3.7E-10   46.2   2.3   50   61-110     1-73  (100)
 34 KOG3993|consensus               97.8 2.1E-06 4.5E-11   61.4  -2.3   73   60-132   268-373 (500)
 35 PRK04860 hypothetical protein;  97.7 2.1E-05 4.7E-10   50.0   2.1   38   87-128   119-156 (160)
 36 PF09237 GAGA:  GAGA factor;  I  97.7 4.6E-05 9.9E-10   38.5   2.7   39   77-115    13-52  (54)
 37 PRK04860 hypothetical protein;  97.5 6.7E-05 1.5E-09   47.8   1.9   40   58-101   118-157 (160)
 38 smart00355 ZnF_C2H2 zinc finge  97.5 9.3E-05   2E-09   31.9   1.9   22   61-82      2-23  (26)
 39 smart00355 ZnF_C2H2 zinc finge  97.5 0.00013 2.7E-09   31.5   2.3   25   88-112     1-25  (26)
 40 PF12874 zf-met:  Zinc-finger o  97.4 0.00013 2.8E-09   31.6   1.6   22   60-81      1-22  (25)
 41 COG5189 SFP1 Putative transcri  97.3 0.00017 3.7E-09   50.2   2.0   46   84-129   346-412 (423)
 42 PF12874 zf-met:  Zinc-finger o  97.0 0.00046   1E-08   29.8   1.7   23   88-110     1-23  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   97.0 0.00065 1.4E-08   29.0   1.8   21   60-81      1-21  (24)
 44 COG5048 FOG: Zn-finger [Genera  96.9  0.0007 1.5E-08   49.0   2.6   62   58-119   288-355 (467)
 45 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00085 1.8E-08   28.7   1.8   24   88-112     1-24  (24)
 46 PF05605 zf-Di19:  Drought indu  96.6  0.0019 4.1E-08   33.5   2.2   39   87-126     2-42  (54)
 47 PF12171 zf-C2H2_jaz:  Zinc-fin  96.5 0.00049 1.1E-08   30.4  -0.3   21   60-80      2-22  (27)
 48 KOG2893|consensus               96.4   0.002 4.3E-08   43.3   1.6   48   54-106     6-53  (341)
 49 PF12171 zf-C2H2_jaz:  Zinc-fin  96.3 0.00096 2.1E-08   29.4   0.0   22   88-109     2-23  (27)
 50 PF13913 zf-C2HC_2:  zinc-finge  95.7  0.0085 1.9E-07   25.9   1.5   18   61-79      4-21  (25)
 51 smart00451 ZnF_U1 U1-like zinc  95.6   0.013 2.7E-07   27.2   2.1   23   59-81      3-25  (35)
 52 smart00451 ZnF_U1 U1-like zinc  95.1   0.017 3.7E-07   26.8   1.7   23   87-109     3-25  (35)
 53 PF12756 zf-C2H2_2:  C2H2 type   94.2   0.055 1.2E-06   31.1   2.6   24   59-82     50-73  (100)
 54 KOG2186|consensus               93.8    0.04 8.7E-07   37.5   1.7   48   59-109     3-50  (276)
 55 cd00350 rubredoxin_like Rubred  93.6   0.043 9.2E-07   25.3   1.1   24   60-95      2-25  (33)
 56 KOG1146|consensus               93.4   0.052 1.1E-06   44.8   2.0   53   57-109   463-540 (1406)
 57 COG4049 Uncharacterized protei  92.9   0.056 1.2E-06   28.0   1.0   31   51-81      9-39  (65)
 58 KOG4167|consensus               90.7    0.28   6E-06   38.5   3.0   30   55-84    788-817 (907)
 59 PF05443 ROS_MUCR:  ROS/MUCR tr  90.5    0.18 3.8E-06   31.2   1.5   25   58-85     71-95  (132)
 60 KOG2893|consensus               90.4    0.17 3.7E-06   34.3   1.5   39   89-131    12-50  (341)
 61 KOG2785|consensus               89.9    0.52 1.1E-05   34.1   3.6   53   57-109   164-242 (390)
 62 PF09538 FYDLN_acid:  Protein o  89.7     0.2 4.4E-06   29.8   1.3   30   60-100    10-39  (108)
 63 KOG2482|consensus               89.4    0.59 1.3E-05   33.5   3.6   51   59-109   195-301 (423)
 64 COG5048 FOG: Zn-finger [Genera  89.0     0.4 8.6E-06   34.7   2.7   62   56-117    30-93  (467)
 65 PF05443 ROS_MUCR:  ROS/MUCR tr  88.4    0.51 1.1E-05   29.2   2.4   28   85-115    70-97  (132)
 66 cd00729 rubredoxin_SM Rubredox  87.9    0.28   6E-06   22.8   0.8   25   59-95      2-26  (34)
 67 PF13719 zinc_ribbon_5:  zinc-r  87.2    0.57 1.2E-05   22.1   1.7   32   61-97      4-35  (37)
 68 TIGR02098 MJ0042_CXXC MJ0042 f  87.2    0.53 1.1E-05   22.2   1.6   34   60-98      3-36  (38)
 69 COG4049 Uncharacterized protei  86.8    0.35 7.5E-06   25.1   0.9   32   81-112    11-42  (65)
 70 KOG4173|consensus               86.3    0.39 8.4E-06   31.9   1.1   46   59-107    79-126 (253)
 71 KOG1146|consensus               86.2    0.62 1.3E-05   39.0   2.4   71   61-131   438-534 (1406)
 72 PF02892 zf-BED:  BED zinc fing  86.0    0.81 1.8E-05   22.3   2.0   23   57-79     14-40  (45)
 73 KOG2186|consensus               85.7    0.47   1E-05   32.5   1.3   41   88-130     4-44  (276)
 74 smart00614 ZnF_BED BED zinc fi  85.6    0.88 1.9E-05   22.9   2.1   25   59-83     18-48  (50)
 75 KOG4173|consensus               85.5    0.38 8.3E-06   31.9   0.8   49   61-109   108-168 (253)
 76 PF04959 ARS2:  Arsenite-resist  85.4    0.85 1.9E-05   30.6   2.4   29   55-83     73-101 (214)
 77 COG4957 Predicted transcriptio  85.2     2.7 5.8E-05   26.1   4.3   25   60-87     77-101 (148)
 78 PF04959 ARS2:  Arsenite-resist  85.1    0.39 8.5E-06   32.2   0.8   30   85-114    75-104 (214)
 79 PRK09678 DNA-binding transcrip  85.1    0.18   4E-06   27.7  -0.7   18   85-102    25-44  (72)
 80 KOG2785|consensus               84.5     1.3 2.7E-05   32.2   3.1   51   59-109     3-90  (390)
 81 COG1592 Rubrerythrin [Energy p  84.3    0.64 1.4E-05   29.9   1.4   23   59-94    134-156 (166)
 82 smart00659 RPOLCX RNA polymera  84.1    0.79 1.7E-05   22.6   1.4   26   60-96      3-28  (44)
 83 PF09986 DUF2225:  Uncharacteri  84.1     0.2 4.2E-06   33.7  -1.0   19   58-76      4-22  (214)
 84 TIGR00622 ssl1 transcription f  83.6     1.1 2.3E-05   26.9   2.1   65   59-125    15-91  (112)
 85 PF13717 zinc_ribbon_4:  zinc-r  83.4     1.2 2.6E-05   20.9   1.8   33   60-97      3-35  (36)
 86 TIGR02300 FYDLN_acid conserved  82.8    0.86 1.9E-05   27.9   1.5   35   59-104     9-43  (129)
 87 PF05290 Baculo_IE-1:  Baculovi  81.8    0.89 1.9E-05   28.1   1.3   55   58-130    79-136 (140)
 88 TIGR00373 conserved hypothetic  81.6     0.8 1.7E-05   29.2   1.1   33   83-124   105-137 (158)
 89 PRK06266 transcription initiat  80.7    0.77 1.7E-05   29.9   0.8   17   87-103   117-133 (178)
 90 COG5236 Uncharacterized conser  80.6    0.65 1.4E-05   33.4   0.5   22   60-81    152-175 (493)
 91 PRK00398 rpoP DNA-directed RNA  80.6    0.75 1.6E-05   22.8   0.6   30   59-98      3-32  (46)
 92 COG2888 Predicted Zn-ribbon RN  79.9     1.8 3.9E-05   22.8   1.9   32   59-95     27-58  (61)
 93 smart00531 TFIIE Transcription  79.9     2.4 5.1E-05   26.7   2.8   36   85-124    97-132 (147)
 94 PRK00464 nrdR transcriptional   79.4    0.39 8.4E-06   30.6  -0.8   16   87-102    28-43  (154)
 95 KOG2593|consensus               79.4     1.8 3.8E-05   32.1   2.3   35   86-123   127-161 (436)
 96 PRK14890 putative Zn-ribbon RN  79.2     1.7 3.6E-05   22.9   1.6   31   59-95     25-56  (59)
 97 smart00734 ZnF_Rad18 Rad18-lik  78.3     2.2 4.7E-05   18.4   1.6   19   61-80      3-21  (26)
 98 COG4957 Predicted transcriptio  77.9     1.3 2.8E-05   27.4   1.1   25   88-115    77-101 (148)
 99 PF12013 DUF3505:  Protein of u  77.4     8.8 0.00019   22.7   4.6   26   59-84     80-109 (109)
100 KOG4167|consensus               77.3    0.67 1.4E-05   36.5  -0.3   26   87-112   792-817 (907)
101 KOG3408|consensus               75.8     2.1 4.6E-05   26.0   1.6   28   54-81     52-79  (129)
102 TIGR02605 CxxC_CxxC_SSSS putat  75.5    0.59 1.3E-05   23.7  -0.7   11   60-70      6-16  (52)
103 PF12013 DUF3505:  Protein of u  75.4     2.5 5.4E-05   25.0   1.9   54   58-112    10-109 (109)
104 TIGR00373 conserved hypothetic  74.3     4.7  0.0001   25.7   3.1   35   56-99    106-140 (158)
105 COG1996 RPC10 DNA-directed RNA  72.9     2.2 4.8E-05   21.6   1.0   28   58-95      5-32  (49)
106 PHA00626 hypothetical protein   72.1     2.6 5.7E-05   21.9   1.2   15   57-71     21-35  (59)
107 KOG2231|consensus               72.1     3.2 6.9E-05   32.6   2.2   21   61-81    184-204 (669)
108 COG1997 RPL43A Ribosomal prote  70.7     1.4   3E-05   25.1   0.0   11   88-98     54-64  (89)
109 PF15269 zf-C2H2_7:  Zinc-finge  69.5     3.4 7.4E-05   20.4   1.2   20   89-108    22-41  (54)
110 PRK06266 transcription initiat  67.7     6.9 0.00015   25.6   2.8   34   57-99    115-148 (178)
111 KOG2482|consensus               65.2       5 0.00011   29.0   1.8   51   59-109   144-217 (423)
112 PF03604 DNA_RNApol_7kD:  DNA d  64.6     2.8   6E-05   19.2   0.4   11   60-70      1-11  (32)
113 COG4530 Uncharacterized protei  64.1     3.8 8.2E-05   24.5   0.9   32   61-104    11-42  (129)
114 PF13878 zf-C2H2_3:  zinc-finge  62.4     9.7 0.00021   18.3   2.1   24   60-83     14-39  (41)
115 COG3091 SprT Zn-dependent meta  62.1     4.1 8.8E-05   25.9   0.9   31   87-122   117-147 (156)
116 PF10571 UPF0547:  Uncharacteri  62.0     3.8 8.3E-05   17.7   0.6   11   60-70     15-25  (26)
117 PF08790 zf-LYAR:  LYAR-type C2  61.1     2.4 5.2E-05   18.8  -0.2    9   61-69      2-10  (28)
118 PF02176 zf-TRAF:  TRAF-type zi  60.7     3.2 6.9E-05   21.5   0.2   40   59-99      9-54  (60)
119 PF13451 zf-trcl:  Probable zin  60.6       9  0.0002   19.4   1.8   38   57-94      2-40  (49)
120 KOG2071|consensus               59.2     5.3 0.00012   30.9   1.2   29   85-113   416-444 (579)
121 PF01363 FYVE:  FYVE zinc finge  58.3     6.1 0.00013   21.1   1.1   28   60-99     10-37  (69)
122 TIGR01206 lysW lysine biosynth  58.3     3.8 8.3E-05   21.2   0.2   30   60-97      3-32  (54)
123 KOG2593|consensus               58.1      14 0.00031   27.6   3.1   39   55-96    124-162 (436)
124 COG5236 Uncharacterized conser  58.0      11 0.00023   27.5   2.4   22   61-82    222-243 (493)
125 PF04780 DUF629:  Protein of un  57.7     9.2  0.0002   28.9   2.2   27   59-85     57-84  (466)
126 COG3357 Predicted transcriptio  57.7     4.8  0.0001   23.2   0.6   14   86-99     57-70  (97)
127 smart00834 CxxC_CXXC_SSSS Puta  57.2     5.3 0.00011   18.8   0.7   29   60-95      6-34  (41)
128 KOG4124|consensus               57.1     1.2 2.6E-05   32.0  -2.2   53   57-109   347-420 (442)
129 PRK03824 hypA hydrogenase nick  57.0     3.5 7.5E-05   25.6  -0.0   15   58-72     69-83  (135)
130 PF05191 ADK_lid:  Adenylate ki  55.2       5 0.00011   18.8   0.4   11   60-70      2-12  (36)
131 PF07754 DUF1610:  Domain of un  54.1     9.1  0.0002   16.3   1.0   11   57-67     14-24  (24)
132 KOG3408|consensus               53.4     9.5 0.00021   23.2   1.4   26   84-109    54-79  (129)
133 PF09723 Zn-ribbon_8:  Zinc rib  51.3     7.6 0.00017   18.7   0.7   29   60-95      6-34  (42)
134 COG4888 Uncharacterized Zn rib  50.2     4.8  0.0001   23.6  -0.2   40   56-99     19-58  (104)
135 PRK12380 hydrogenase nickel in  48.7     8.1 0.00018   23.2   0.6   25   59-95     70-94  (113)
136 PLN03238 probable histone acet  48.7      18 0.00038   25.6   2.3   22   87-108    48-69  (290)
137 PF07282 OrfB_Zn_ribbon:  Putat  48.6      13 0.00028   19.8   1.4   14   85-98     44-57  (69)
138 PF06524 NOA36:  NOA36 protein;  48.6      23  0.0005   24.7   2.8   75   56-132   139-226 (314)
139 PF14311 DUF4379:  Domain of un  48.3      12 0.00027   19.0   1.2   14   59-72     28-41  (55)
140 TIGR00100 hypA hydrogenase nic  48.3     7.7 0.00017   23.4   0.5   25   59-95     70-94  (115)
141 smart00154 ZnF_AN1 AN1-like Zi  47.4     9.7 0.00021   18.1   0.7   14   87-100    12-25  (39)
142 cd00065 FYVE FYVE domain; Zinc  46.6      13 0.00029   18.8   1.2   27   61-99      4-30  (57)
143 COG1773 Rubredoxin [Energy pro  46.5     9.9 0.00021   19.8   0.7   13   59-71      3-15  (55)
144 PF12907 zf-met2:  Zinc-binding  46.3      14  0.0003   17.9   1.1   20   61-80      3-25  (40)
145 PF01428 zf-AN1:  AN1-like Zinc  46.0     8.2 0.00018   18.7   0.3   15   86-100    12-26  (43)
146 KOG2231|consensus               45.8      15 0.00032   29.2   1.7   23   60-82    100-138 (669)
147 COG4306 Uncharacterized protei  45.6     5.6 0.00012   24.4  -0.4   41   60-100    40-81  (160)
148 PTZ00255 60S ribosomal protein  45.4     7.5 0.00016   22.4   0.1    7   88-94     37-43  (90)
149 PF12760 Zn_Tnp_IS1595:  Transp  45.3      20 0.00043   17.5   1.7    8   88-95     19-26  (46)
150 COG2331 Uncharacterized protei  45.0     7.1 0.00015   21.7  -0.0   33   59-98     12-44  (82)
151 KOG2636|consensus               44.8      17 0.00037   27.3   1.8   27   80-106   394-421 (497)
152 PF08209 Sgf11:  Sgf11 (transcr  44.5      21 0.00046   16.4   1.5   22   59-81      4-25  (33)
153 PF14445 Prok-RING_2:  Prokaryo  44.3     7.1 0.00015   19.8  -0.1   14   59-72      7-20  (57)
154 COG4896 Uncharacterized protei  44.1      13 0.00029   19.7   0.9   40   60-99      3-43  (68)
155 PRK00564 hypA hydrogenase nick  44.1     9.4  0.0002   23.1   0.4   13   59-71     71-83  (117)
156 PF10263 SprT-like:  SprT-like   43.8       7 0.00015   24.5  -0.2   31   59-97    123-153 (157)
157 PF01155 HypA:  Hydrogenase exp  43.5     9.6 0.00021   22.8   0.4   15   59-73     70-84  (113)
158 smart00064 FYVE Protein presen  43.1      21 0.00045   18.9   1.7   28   60-99     11-38  (68)
159 PF12230 PRP21_like_P:  Pre-mRN  42.7     8.2 0.00018   26.1   0.0   30   58-88    167-196 (229)
160 KOG1280|consensus               42.3      29 0.00062   25.3   2.6   37   58-94     78-116 (381)
161 PF09963 DUF2197:  Uncharacteri  42.3      14  0.0003   19.3   0.8   37   60-96      3-40  (56)
162 KOG0978|consensus               41.9     8.8 0.00019   30.5   0.1   13   58-70    642-654 (698)
163 KOG4602|consensus               41.7      42  0.0009   23.4   3.2   45   55-99    229-280 (318)
164 TIGR00280 L37a ribosomal prote  41.4     8.3 0.00018   22.3  -0.1    7   88-94     36-42  (91)
165 KOG2636|consensus               40.9      42 0.00091   25.4   3.3   27   54-80    396-423 (497)
166 PF04423 Rad50_zn_hook:  Rad50   40.7      11 0.00025   19.1   0.4   12   61-72     22-33  (54)
167 PF08274 PhnA_Zn_Ribbon:  PhnA   40.3      12 0.00025   16.8   0.3    8   87-94     19-26  (30)
168 PLN00104 MYST -like histone ac  40.2      21 0.00045   27.0   1.7   25   85-109   196-220 (450)
169 COG5188 PRP9 Splicing factor 3  40.1      46   0.001   24.4   3.3   26   55-80    370-396 (470)
170 PF10276 zf-CHCC:  Zinc-finger   39.8      19 0.00042   17.3   1.0   12   58-69     28-39  (40)
171 KOG0717|consensus               38.7      23  0.0005   26.9   1.7   22   60-81    293-314 (508)
172 PF00301 Rubredoxin:  Rubredoxi  38.3      15 0.00033   18.3   0.6   12   60-71      2-13  (47)
173 PTZ00064 histone acetyltransfe  38.1      26 0.00056   26.9   2.0   25   85-109   278-302 (552)
174 KOG0717|consensus               37.9      21 0.00045   27.1   1.4   22   88-109   293-314 (508)
175 KOG4727|consensus               37.8      33 0.00072   22.3   2.2   27   54-80     70-96  (193)
176 KOG2923|consensus               37.7     7.8 0.00017   20.7  -0.5   16  116-131    23-38  (67)
177 PTZ00448 hypothetical protein;  37.4      27 0.00059   25.6   1.9   23   59-81    314-336 (373)
178 COG1198 PriA Primosomal protei  37.2     6.1 0.00013   31.6  -1.4   11   60-70    436-446 (730)
179 PLN02748 tRNA dimethylallyltra  37.1      29 0.00063   26.4   2.1   25   57-81    416-441 (468)
180 cd00924 Cyt_c_Oxidase_Vb Cytoc  37.1      18 0.00038   21.2   0.8   24   76-100    69-92  (97)
181 PRK04351 hypothetical protein;  36.5      18 0.00039   22.9   0.8    9   87-95    132-140 (149)
182 PF07975 C1_4:  TFIIH C1-like d  36.4     5.2 0.00011   20.4  -1.3   26   57-82     19-44  (51)
183 COG4338 Uncharacterized protei  36.2      12 0.00027   18.8   0.1   12   89-100    14-25  (54)
184 PF10013 DUF2256:  Uncharacteri  36.1      24 0.00051   17.2   1.0   15   61-75     10-24  (42)
185 PLN02294 cytochrome c oxidase   35.7      19 0.00041   23.4   0.8   13   58-70    140-152 (174)
186 cd00730 rubredoxin Rubredoxin;  35.1      17 0.00036   18.5   0.4   12   60-71      2-13  (50)
187 PRK03681 hypA hydrogenase nick  35.0      12 0.00027   22.4  -0.0   26   59-95     70-95  (114)
188 PF04780 DUF629:  Protein of un  34.9      30 0.00064   26.3   1.9   27   86-112    56-83  (466)
189 KOG2071|consensus               34.4      28 0.00062   27.1   1.7   27   57-83    416-442 (579)
190 KOG2747|consensus               34.3      26 0.00057   26.0   1.5   26   85-110   156-181 (396)
191 PF03811 Zn_Tnp_IS1:  InsA N-te  34.1       7 0.00015   18.4  -1.0    7   86-92     28-34  (36)
192 COG1655 Uncharacterized protei  34.1     7.8 0.00017   26.4  -1.1   26   57-82     17-42  (267)
193 PRK03976 rpl37ae 50S ribosomal  34.1      11 0.00024   21.7  -0.3    7   88-94     37-43  (90)
194 PF06220 zf-U1:  U1 zinc finger  33.9      32 0.00069   16.2   1.3   11   87-97      3-13  (38)
195 PRK05978 hypothetical protein;  33.4      19  0.0004   22.9   0.5   32   60-100    34-65  (148)
196 PF09845 DUF2072:  Zn-ribbon co  33.2      18 0.00038   22.4   0.4   15   87-101     1-15  (131)
197 PF11931 DUF3449:  Domain of un  32.9      14 0.00031   24.5   0.0    9   59-67    101-109 (196)
198 KOG2807|consensus               32.3      73  0.0016   23.2   3.3   20   59-78    290-309 (378)
199 COG1327 Predicted transcriptio  31.6      14  0.0003   23.5  -0.2   16   86-101    27-42  (156)
200 PLN03239 histone acetyltransfe  30.8      33 0.00071   25.1   1.5   25   85-109   104-128 (351)
201 COG3677 Transposase and inacti  30.7      27 0.00059   21.5   0.9   16   57-72     51-66  (129)
202 PF07800 DUF1644:  Protein of u  30.0 1.6E+02  0.0034   19.1   4.9   56   58-115    79-137 (162)
203 KOG1994|consensus               30.0      37  0.0008   23.2   1.5   22   57-78    237-258 (268)
204 smart00731 SprT SprT homologue  30.0      24 0.00052   22.0   0.6   10   87-96    112-121 (146)
205 COG1571 Predicted DNA-binding   29.9      29 0.00063   26.0   1.1   29   61-100   352-380 (421)
206 KOG1842|consensus               29.6      30 0.00066   26.1   1.1   23   59-81     15-37  (505)
207 COG5112 UFD2 U1-like Zn-finger  29.2      46   0.001   19.8   1.7   26   56-81     52-77  (126)
208 PF04606 Ogr_Delta:  Ogr/Delta-  28.7       9  0.0002   19.0  -1.2   16  113-128    23-40  (47)
209 PF04216 FdhE:  Protein involve  28.6      13 0.00028   26.1  -0.8   36   87-123   211-246 (290)
210 KOG1280|consensus               28.4      57  0.0012   23.8   2.3   38   86-123    78-117 (381)
211 PRK12387 formate hydrogenlyase  28.2      23 0.00051   23.0   0.4   20   85-104   112-131 (180)
212 KOG1842|consensus               28.0      37  0.0008   25.7   1.4   24   89-112    17-40  (505)
213 KOG3002|consensus               28.0      32 0.00069   24.6   1.0   61   57-121    78-142 (299)
214 PLN03238 probable histone acet  27.9      76  0.0017   22.6   2.8   26   56-81     45-70  (290)
215 PF11672 DUF3268:  Protein of u  27.6      26 0.00056   20.7   0.4   10   59-68      2-11  (102)
216 KOG0782|consensus               27.3      18 0.00038   28.3  -0.3   26   74-99    240-265 (1004)
217 PRK00762 hypA hydrogenase nick  26.3      22 0.00048   21.7  -0.0   13   59-72     70-82  (124)
218 PF06397 Desulfoferrod_N:  Desu  26.3      31 0.00066   16.2   0.5   12   58-69      5-16  (36)
219 PF05207 zf-CSL:  CSL zinc fing  26.2     9.2  0.0002   19.7  -1.4   17  115-131    18-34  (55)
220 PF10537 WAC_Acf1_DNA_bd:  ATP-  26.1 1.3E+02  0.0028   17.8   3.2   38   58-96      2-39  (102)
221 PF07503 zf-HYPF:  HypF finger;  26.0       5 0.00011   18.7  -2.2   10   88-97     22-31  (35)
222 KOG2461|consensus               25.8 1.2E+02  0.0025   22.8   3.6   56   63-118   335-390 (396)
223 PF11789 zf-Nse:  Zinc-finger o  25.4      99  0.0022   16.0   2.4   13   87-99     24-36  (57)
224 PRK03564 formate dehydrogenase  25.2      28 0.00062   24.9   0.4    9   87-95    226-234 (309)
225 COG2879 Uncharacterized small   25.0      95   0.002   16.6   2.2   18   70-87     23-40  (65)
226 COG0675 Transposase and inacti  25.0      40 0.00087   23.7   1.1   15   85-99    320-334 (364)
227 TIGR01562 FdhE formate dehydro  24.6      28 0.00061   24.9   0.3   10   87-96    224-233 (305)
228 PF13824 zf-Mss51:  Zinc-finger  24.5      48   0.001   17.2   1.1   12   58-69     13-24  (55)
229 PF08576 DUF1764:  Eukaryotic p  24.3      38 0.00083   19.8   0.8   11  111-121    91-101 (102)
230 PF02748 PyrI_C:  Aspartate car  24.2      44 0.00096   17.0   0.9   17   55-71     31-47  (52)
231 PF14353 CpXC:  CpXC protein     24.1      37  0.0008   20.6   0.7   23   58-80     37-59  (128)
232 COG5151 SSL1 RNA polymerase II  23.8   1E+02  0.0022   22.3   2.8   48   61-110   364-411 (421)
233 PTZ00303 phosphatidylinositol   23.7      45 0.00097   27.4   1.2   33   60-99    461-493 (1374)
234 PTZ00448 hypothetical protein;  23.6      53  0.0011   24.2   1.5   23   87-109   314-336 (373)
235 PF08792 A2L_zn_ribbon:  A2L zi  22.9      52  0.0011   15.0   0.9   12   59-70     21-32  (33)
236 PRK04023 DNA polymerase II lar  22.6      68  0.0015   27.1   2.0   10   59-68    626-635 (1121)
237 COG0068 HypF Hydrogenase matur  22.3      13 0.00028   29.7  -1.8   56   61-123   125-181 (750)
238 COG4391 Uncharacterized protei  22.1      53  0.0011   17.5   0.9   14   57-70     46-59  (62)
239 KOG2907|consensus               22.0      36 0.00077   20.5   0.3   11  116-126   103-113 (116)
240 PF01927 Mut7-C:  Mut7-C RNAse   21.9      71  0.0015   20.0   1.7   47   60-106    92-143 (147)
241 COG3364 Zn-ribbon containing p  21.7      42 0.00091   19.9   0.6   15   87-101     2-16  (112)
242 TIGR00627 tfb4 transcription f  21.7      61  0.0013   22.9   1.4   12   88-99    256-267 (279)
243 COG5216 Uncharacterized conser  21.6      21 0.00044   18.8  -0.6   16  116-131    23-38  (67)
244 KOG4215|consensus               21.6      39 0.00085   24.9   0.5   18   89-107    38-55  (432)
245 COG5027 SAS2 Histone acetyltra  21.2      59  0.0013   23.9   1.3   25   86-110   157-181 (395)
246 PF06467 zf-FCS:  MYM-type Zinc  21.2      16 0.00034   17.4  -1.1   13   60-72      7-19  (43)
247 TIGR00515 accD acetyl-CoA carb  21.1      54  0.0012   23.2   1.1   32   59-99     26-57  (285)
248 PRK12860 transcriptional activ  20.8      49  0.0011   21.9   0.8   30   68-98    116-145 (189)
249 PF13821 DUF4187:  Domain of un  20.7      65  0.0014   16.6   1.1   19   59-77     27-45  (55)
250 PF01215 COX5B:  Cytochrome c o  20.7      42  0.0009   21.0   0.4   14   58-71    111-124 (136)
251 COG1675 TFA1 Transcription ini  20.6 1.3E+02  0.0028   19.8   2.7   15   85-99    111-125 (176)
252 PRK12722 transcriptional activ  20.6      50  0.0011   21.9   0.8   30   68-98    116-145 (187)
253 PRK11823 DNA repair protein Ra  20.3      82  0.0018   23.8   2.0   25   57-95      5-29  (446)
254 TIGR00416 sms DNA repair prote  20.2      82  0.0018   23.9   2.0   24   58-95      6-29  (454)

No 1  
>KOG2462|consensus
Probab=99.85  E-value=8.6e-23  Score=135.80  Aligned_cols=74  Identities=30%  Similarity=0.601  Sum_probs=67.9

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCcccee
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEYLV  132 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~l~  132 (134)
                      +++|.+|||.|.+.=.|+.|+|+|+|||||.|..|+|.|..+++|+.||++|.+.|+|.|.-|++.|-...+|.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHH
Confidence            68899999999999999999999999999999999999999999999999999999999998988888777663


No 2  
>KOG2462|consensus
Probab=99.77  E-value=1.2e-19  Score=120.90  Aligned_cols=74  Identities=27%  Similarity=0.508  Sum_probs=66.4

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCcccee
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEYLV  132 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~l~  132 (134)
                      .+.+.|++|+|.|.+-..|+.|+++|+  -+++|.+|||.|.+..-|+-|+|+|||||||.|..|.+.|-.+++|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHH
Confidence            556778888888888888888888886  67999999999999999999999999999999999999999998885


No 3  
>KOG3576|consensus
Probab=99.76  E-value=2.4e-19  Score=114.84  Aligned_cols=78  Identities=59%  Similarity=0.996  Sum_probs=73.2

Q ss_pred             CCCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCccce
Q psy691           54 RKDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEYL  131 (134)
Q Consensus        54 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~l  131 (134)
                      ......|.|.+|+|.|.....|.+|++-|...+.|.|.+|||.|.....|++|+|+|+|-+||+|..|++.|+.+..|
T Consensus       112 ssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsl  189 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSL  189 (267)
T ss_pred             CCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccH
Confidence            344667999999999999999999999999999999999999999999999999999999999999999999988766


No 4  
>KOG3623|consensus
Probab=99.75  E-value=4.5e-19  Score=130.88  Aligned_cols=82  Identities=26%  Similarity=0.506  Sum_probs=75.3

Q ss_pred             ccCCCCCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCcc
Q psy691           50 STTGRKDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTE  129 (134)
Q Consensus        50 ~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~  129 (134)
                      .......+..|.|+.|.|.|.....|.+|..-|+|.+||+|.+|.|.|+.+.+|..|+|.|.|||||.|+.|.++|.++-
T Consensus       885 tk~~kte~gmyaCDqCDK~FqKqSSLaRHKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSG  964 (1007)
T KOG3623|consen  885 TKHAKTEDGMYACDQCDKAFQKQSSLARHKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSG  964 (1007)
T ss_pred             cccccCccccchHHHHHHHHHhhHHHHHhhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhccccc
Confidence            33456677899999999999999999999999999999999999999999999999999999999999999999998875


Q ss_pred             ce
Q psy691          130 YL  131 (134)
Q Consensus       130 ~l  131 (134)
                      ..
T Consensus       965 SY  966 (1007)
T KOG3623|consen  965 SY  966 (1007)
T ss_pred             ch
Confidence            43


No 5  
>KOG3623|consensus
Probab=99.59  E-value=4.8e-16  Score=115.14  Aligned_cols=76  Identities=33%  Similarity=0.630  Sum_probs=68.2

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCC-------------CCceecccccccccChhhHHHHHhHhcCCCccccccCCC
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSD-------------VKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKT  123 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~  123 (134)
                      ..-|.|..|.++|..+..|.+||.+|..             .+.|+|..|+|.|+.+.+|+.|+|+|.|||||.|+-|++
T Consensus       238 e~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkK  317 (1007)
T KOG3623|consen  238 EPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKK  317 (1007)
T ss_pred             CCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCccccc
Confidence            3458999999999999999999999843             257999999999999999999999999999999999999


Q ss_pred             cccCcccee
Q psy691          124 NVLTTEYLV  132 (134)
Q Consensus       124 ~~~~~~~l~  132 (134)
                      +|.++-..+
T Consensus       318 RFSHSGSyS  326 (1007)
T KOG3623|consen  318 RFSHSGSYS  326 (1007)
T ss_pred             ccccCCccc
Confidence            998876544


No 6  
>KOG3576|consensus
Probab=99.39  E-value=7.6e-14  Score=89.78  Aligned_cols=74  Identities=28%  Similarity=0.503  Sum_probs=62.8

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcC-----------CCccccccCCC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTG-----------KEEEEEEDGKT  123 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~-----------~~~~~c~~~~~  123 (134)
                      ...+.|-|..||+.|.....|++|+|+|+|.+||+|..|+|.|.++-+|..|.+.-+|           +|-|.|+.|++
T Consensus       141 ~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~  220 (267)
T KOG3576|consen  141 SDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGY  220 (267)
T ss_pred             cHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCC
Confidence            4456789999999999999999999999999999999999999999999999775333           35588988887


Q ss_pred             cccCc
Q psy691          124 NVLTT  128 (134)
Q Consensus       124 ~~~~~  128 (134)
                      .-.+.
T Consensus       221 t~~~~  225 (267)
T KOG3576|consen  221 TSERP  225 (267)
T ss_pred             CCCCh
Confidence            65443


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.36  E-value=4.5e-13  Score=69.10  Aligned_cols=42  Identities=14%  Similarity=0.366  Sum_probs=21.9

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDL  103 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l  103 (134)
                      |.|++||+.|....+|..|+++|+  ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            455555555555555555555554  445555555555544443


No 8  
>PHA02768 hypothetical protein; Provisional
Probab=99.31  E-value=1.1e-12  Score=67.63  Aligned_cols=46  Identities=22%  Similarity=0.369  Sum_probs=42.6

Q ss_pred             ceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCccceeeC
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEYLVVV  134 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~l~~~  134 (134)
                      -|.|+.||+.|.+.++|..|+++|+  ++|+|..|++.|...+.|++|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~~~   50 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYIEI   50 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeEEE
Confidence            4899999999999999999999998  799999999999999988864


No 9  
>KOG1074|consensus
Probab=99.22  E-value=9.8e-12  Score=93.84  Aligned_cols=74  Identities=22%  Similarity=0.432  Sum_probs=64.7

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCC----ccccc---cCCCcccC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKE----EEEEE---DGKTNVLT  127 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~----~~~c~---~~~~~~~~  127 (134)
                      +...+..|.+|.+...-+..|+.|.|+|+|+|||+|.+|++.|.++.+|+.|+-+|-..-    ++.|+   .|-.-|.+
T Consensus       601 ~~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn  680 (958)
T KOG1074|consen  601 KRTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTN  680 (958)
T ss_pred             ccCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccc
Confidence            344568999999999999999999999999999999999999999999999999997653    47787   77777765


Q ss_pred             c
Q psy691          128 T  128 (134)
Q Consensus       128 ~  128 (134)
                      .
T Consensus       681 ~  681 (958)
T KOG1074|consen  681 A  681 (958)
T ss_pred             c
Confidence            4


No 10 
>KOG3608|consensus
Probab=99.19  E-value=4.7e-12  Score=87.60  Aligned_cols=75  Identities=24%  Similarity=0.484  Sum_probs=63.8

Q ss_pred             CCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhH-hcCCCccccccCCCcccCcccee
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRT-HTGKEEEEEEDGKTNVLTTEYLV  132 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~c~~~~~~~~~~~~l~  132 (134)
                      ..++|.|..|.|.|.....|..|+..|.  .-|+|+.|+......+.|.+|++. |..+|||+|++|.+.|++-..|.
T Consensus       234 ~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~  309 (467)
T KOG3608|consen  234 NTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLA  309 (467)
T ss_pred             cCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHH
Confidence            3457888888888888888888888885  448999999999999999999997 88899999999999998876653


No 11 
>KOG1074|consensus
Probab=99.18  E-value=1.1e-11  Score=93.57  Aligned_cols=57  Identities=28%  Similarity=0.640  Sum_probs=52.5

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCC
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKE  114 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~  114 (134)
                      -+++|.+|.|.|.....|+.|.|+|+|++||+|.+||.+|.++.+|+.|...|+.+-
T Consensus       352 ~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTkGNLKvH~~rH~e~~  408 (958)
T KOG1074|consen  352 FKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTKGNLKVHFQRHREKY  408 (958)
T ss_pred             ccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccccceeeeeeeccccC
Confidence            357899999999999999999999999999999999999999999999988776543


No 12 
>PHA00733 hypothetical protein
Probab=99.06  E-value=5.8e-11  Score=72.81  Aligned_cols=75  Identities=17%  Similarity=0.283  Sum_probs=50.3

Q ss_pred             CCCCceeccccccccCChHHHHHH--HH---HcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCcc
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRH--MK---CHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTE  129 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H--~~---~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~  129 (134)
                      ..++++.|.+|.+.|.....|..+  +.   .+.+.+||.|..|++.|.....|..|++.|  +.+|.|..|++.|.+..
T Consensus        36 ~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~  113 (128)
T PHA00733         36 PEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTD  113 (128)
T ss_pred             hhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHH
Confidence            345567777777777766665554  11   233466788888888888888887777765  34677777777777665


Q ss_pred             ce
Q psy691          130 YL  131 (134)
Q Consensus       130 ~l  131 (134)
                      .|
T Consensus       114 sL  115 (128)
T PHA00733        114 ST  115 (128)
T ss_pred             HH
Confidence            54


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.05  E-value=1.5e-10  Score=51.39  Aligned_cols=25  Identities=48%  Similarity=1.046  Sum_probs=15.6

Q ss_pred             HHHHHHHHcCCCCceeccccccccc
Q psy691           74 LLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        74 ~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      +|.+|+++|++++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3556666666666666666666664


No 14 
>PHA00733 hypothetical protein
Probab=98.99  E-value=7.1e-10  Score=68.01  Aligned_cols=56  Identities=27%  Similarity=0.527  Sum_probs=50.4

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      ...++|.|+.|++.|.....|..|++.|  ..+|.|..|++.|.....|.+|+...++
T Consensus        69 ~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         69 KAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            3467899999999999999999999987  4579999999999999999999988765


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.98  E-value=3e-10  Score=50.42  Aligned_cols=26  Identities=31%  Similarity=0.409  Sum_probs=23.6

Q ss_pred             hHHHHHhHhcCCCccccccCCCcccC
Q psy691          102 DLKRHTRTHTGKEEEEEEDGKTNVLT  127 (134)
Q Consensus       102 ~l~~H~~~h~~~~~~~c~~~~~~~~~  127 (134)
                      +|.+|+++|+|++||.|+.|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            58899999999999999999998864


No 16 
>KOG3608|consensus
Probab=98.93  E-value=6e-10  Score=77.39  Aligned_cols=79  Identities=18%  Similarity=0.293  Sum_probs=66.1

Q ss_pred             CCCCCCceeccccccccCChHHHHHHHHHcCCCCceeccc--ccccccChhhHHHHHhHhc-CCC--ccccccCCCcccC
Q psy691           53 GRKDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTF--CGKGFNDTFDLKRHTRTHT-GKE--EEEEEDGKTNVLT  127 (134)
Q Consensus        53 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~~f~~~~~l~~H~~~h~-~~~--~~~c~~~~~~~~~  127 (134)
                      .+..+++|+|+.|.+.+.+...|.+|...|. +..|.|..  |..+|.+...+.+|++-++ |..  +|.|-+|+++|++
T Consensus       286 rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~  364 (467)
T KOG3608|consen  286 RHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTS  364 (467)
T ss_pred             hhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhcc
Confidence            3445788999999999999999999999887 66799988  9999999999999988744 654  5999999999999


Q ss_pred             cccee
Q psy691          128 TEYLV  132 (134)
Q Consensus       128 ~~~l~  132 (134)
                      -..|.
T Consensus       365 G~~L~  369 (467)
T KOG3608|consen  365 GKSLS  369 (467)
T ss_pred             chhHH
Confidence            87764


No 17 
>PHA00616 hypothetical protein
Probab=98.89  E-value=7.6e-10  Score=54.52  Aligned_cols=32  Identities=13%  Similarity=0.324  Sum_probs=15.6

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCT   91 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~   91 (134)
                      |.|..||+.|..+..|..|++.|++++++.|+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            44444554444444444444444444444444


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.84  E-value=4.4e-09  Score=78.08  Aligned_cols=67  Identities=18%  Similarity=0.332  Sum_probs=54.8

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCccc
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVL  126 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~  126 (134)
                      ..++.+.|+.|++.|. ...|..|+..|+  +++.|. |++.+ .+..|..|+.+|..++++.|..|+..|.
T Consensus       449 el~~H~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        449 EAKNHVHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             ccccCccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccc
Confidence            3455678999999986 677899999875  789998 98755 6688999998999999999998888774


No 19 
>PHA00616 hypothetical protein
Probab=98.81  E-value=2.2e-09  Score=52.86  Aligned_cols=33  Identities=21%  Similarity=0.340  Sum_probs=31.7

Q ss_pred             ceecccccccccChhhHHHHHhHhcCCCccccc
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEE  119 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~  119 (134)
                      ||+|..||+.|.....|.+|++.|+|++++.|+
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~   33 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLE   33 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCcccee
Confidence            689999999999999999999999999999986


No 20 
>PHA00732 hypothetical protein
Probab=98.70  E-value=1.3e-08  Score=57.17  Aligned_cols=48  Identities=23%  Similarity=0.505  Sum_probs=40.2

Q ss_pred             ceeccccccccCChHHHHHHHHH-cCCCCceecccccccccChhhHHHHHhHhcC
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC-HSDVKRYLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      +|.|..|++.|.....|..|++. |.   ++.|..|++.|.   .+..|.+++..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            58899999999999999999985 65   358999999998   58888866543


No 21 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.68  E-value=2.2e-08  Score=74.46  Aligned_cols=69  Identities=16%  Similarity=0.366  Sum_probs=59.3

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceecccccccccC----------hhhHHHHHhHhcCCCccccccCCCcccC
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND----------TFDLKRHTRTHTGKEEEEEEDGKTNVLT  127 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~----------~~~l~~H~~~h~~~~~~~c~~~~~~~~~  127 (134)
                      .++.|+ |++.+ .+..|..|+..|...+++.|.+|++.|..          ...|..|...+ |.+++.|..|++.|.-
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cgk~Vrl  553 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCGRSVML  553 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccCCeeee
Confidence            578999 99766 56899999999999999999999999852          35899999885 9999999988888876


Q ss_pred             cc
Q psy691          128 TE  129 (134)
Q Consensus       128 ~~  129 (134)
                      ++
T Consensus       554 rd  555 (567)
T PLN03086        554 KE  555 (567)
T ss_pred             hh
Confidence            65


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.50  E-value=2.7e-07  Score=48.16  Aligned_cols=51  Identities=25%  Similarity=0.501  Sum_probs=40.7

Q ss_pred             ceeccccccccCChHHHHHHHHH-cCCC-CceecccccccccChhhHHHHHhHhcC
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC-HSDV-KRYLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~-k~~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      .|.|++|++. .+...|..|... |..+ +.+.|++|...+.  .+|..|+..+++
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H~   54 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQHR   54 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhcC
Confidence            5899999995 557889999876 6654 5799999998655  489999988654


No 23 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.37  E-value=4.1e-07  Score=62.76  Aligned_cols=54  Identities=31%  Similarity=0.630  Sum_probs=46.3

Q ss_pred             CCCceeccc--cccccCChHHHHHHHHH-cC------------------CCCceecccccccccChhhHHHHHhH
Q psy691           56 DNTRFACHL--CSKSFSLQRLLNRHMKC-HS------------------DVKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        56 ~~~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      ..++|+|++  |.|.++....|+.|+.- |-                  ..|||.|++|+|+++....|+.|+..
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr~H  420 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHRKH  420 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecccc
Confidence            358999998  99999999999999874 41                  13899999999999999999998764


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.34  E-value=4.4e-07  Score=38.84  Aligned_cols=22  Identities=45%  Similarity=0.922  Sum_probs=12.0

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      |.|++|++.|.....|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4455555555555555555554


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.29  E-value=5.5e-07  Score=38.52  Aligned_cols=23  Identities=52%  Similarity=1.096  Sum_probs=21.6

Q ss_pred             eecccccccccChhhHHHHHhHh
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      |.|..|++.|.....|.+|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            78999999999999999999875


No 26 
>KOG3993|consensus
Probab=98.28  E-value=3.9e-07  Score=64.97  Aligned_cols=53  Identities=32%  Similarity=0.600  Sum_probs=46.6

Q ss_pred             eeccccccccCChHHHHHHHHHcCC--------C-------------------------CceecccccccccChhhHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSD--------V-------------------------KRYLCTFCGKGFNDTFDLKRH  106 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~--------~-------------------------k~~~C~~C~~~f~~~~~l~~H  106 (134)
                      |+|++|+|.|.-..||..|.|.|--        .                         -.|.|..|+|.|.+...|+.|
T Consensus       296 YrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKH  375 (500)
T KOG3993|consen  296 YRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKH  375 (500)
T ss_pred             ecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHh
Confidence            8999999999999999999999821        1                         148999999999999999999


Q ss_pred             HhHhcC
Q psy691          107 TRTHTG  112 (134)
Q Consensus       107 ~~~h~~  112 (134)
                      +-+|+.
T Consensus       376 qlthq~  381 (500)
T KOG3993|consen  376 QLTHQR  381 (500)
T ss_pred             HHhhhc
Confidence            888764


No 27 
>PHA00732 hypothetical protein
Probab=98.23  E-value=7.8e-07  Score=49.95  Aligned_cols=39  Identities=26%  Similarity=0.362  Sum_probs=33.3

Q ss_pred             ceecccccccccChhhHHHHHhH-hcCCCccccccCCCcccCc
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRT-HTGKEEEEEEDGKTNVLTT  128 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~c~~~~~~~~~~  128 (134)
                      ||.|..|++.|.....|..|++. |++   +.|+.|++.|.+.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~~l   40 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYRRL   40 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeCCh
Confidence            58999999999999999999985 653   5899898888753


No 28 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.03  E-value=3.3e-06  Score=37.51  Aligned_cols=25  Identities=36%  Similarity=0.775  Sum_probs=14.7

Q ss_pred             ceecccccccccChhhHHHHHhHhc
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHT  111 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~  111 (134)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            3556666666666666666665553


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.99  E-value=5.8e-06  Score=35.36  Aligned_cols=22  Identities=41%  Similarity=0.890  Sum_probs=10.4

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      |.|++|++.|.....|..|++.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~   22 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRT   22 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHh
Confidence            3455555555555555555544


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.97  E-value=8.5e-06  Score=34.82  Aligned_cols=24  Identities=42%  Similarity=1.000  Sum_probs=20.3

Q ss_pred             eecccccccccChhhHHHHHhHhc
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTHT  111 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h~  111 (134)
                      |.|.+|++.|.....|..|++.|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            689999999999999999999874


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.89  E-value=9.4e-06  Score=35.99  Aligned_cols=25  Identities=36%  Similarity=0.721  Sum_probs=23.1

Q ss_pred             ceeccccccccCChHHHHHHHHHcC
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHS   83 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~   83 (134)
                      +|.|..|++.|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5899999999999999999998875


No 32 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.81  E-value=4.7e-05  Score=38.48  Aligned_cols=30  Identities=23%  Similarity=0.428  Sum_probs=14.2

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCC
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDVK   86 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k   86 (134)
                      +.+..|++|+..+....+|++|+..+++.|
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle~~H~~k   51 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLEIRHFKK   51 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCcchhhccchhhHHHHHHHHhccc
Confidence            344556666666666666666665544444


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.79  E-value=1.7e-05  Score=46.21  Aligned_cols=50  Identities=32%  Similarity=0.654  Sum_probs=21.5

Q ss_pred             eccccccccCChHHHHHHHHHcCCC-----------------------CceecccccccccChhhHHHHHhHh
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDV-----------------------KRYLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------k~~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      .|.+|+..|.....|..|+...++.                       ..+.|.+|++.|.....|..|++.+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CccccccccccccccccccccccccccccccccccccccccccccccCCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            4889999999999999998753221                       2489999999999999999999974


No 34 
>KOG3993|consensus
Probab=97.75  E-value=2.1e-06  Score=61.36  Aligned_cols=73  Identities=22%  Similarity=0.306  Sum_probs=60.3

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcC--------C------------------
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTG--------K------------------  113 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~--------~------------------  113 (134)
                      |.|..|-..|.....|.+|.....-..-|+|..|+|.|.-..+|..|+|.|--        .                  
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~r  347 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAER  347 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccc
Confidence            89999999999999999998654444569999999999999999999987741        1                  


Q ss_pred             -------CccccccCCCcccCcccee
Q psy691          114 -------EEEEEEDGKTNVLTTEYLV  132 (134)
Q Consensus       114 -------~~~~c~~~~~~~~~~~~l~  132 (134)
                             --|.|..|.+.|.+..+|.
T Consensus       348 sg~dss~gi~~C~~C~KkFrRqAYLr  373 (500)
T KOG3993|consen  348 SGDDSSSGIFSCHTCGKKFRRQAYLR  373 (500)
T ss_pred             cCCcccCceeecHHhhhhhHHHHHHH
Confidence                   1278988888888887764


No 35 
>PRK04860 hypothetical protein; Provisional
Probab=97.72  E-value=2.1e-05  Score=50.02  Aligned_cols=38  Identities=18%  Similarity=0.423  Sum_probs=24.3

Q ss_pred             ceecccccccccChhhHHHHHhHhcCCCccccccCCCcccCc
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTT  128 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~  128 (134)
                      +|.|. |++   ....+.+|.++|+++++|.|..|+..|...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            46666 665   455666777777777777776666665543


No 36 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.70  E-value=4.6e-05  Score=38.53  Aligned_cols=39  Identities=21%  Similarity=0.382  Sum_probs=25.8

Q ss_pred             HHHHH-cCCCCceecccccccccChhhHHHHHhHhcCCCc
Q psy691           77 RHMKC-HSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEE  115 (134)
Q Consensus        77 ~H~~~-h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  115 (134)
                      .+.+. +..+.|..|++|+..+.+..+|++|+.++++.||
T Consensus        13 ~~~k~~~~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   13 KKPKSKSQSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ---CCCCTTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             hHHHHhhccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            34433 3457899999999999999999999999888776


No 37 
>PRK04860 hypothetical protein; Provisional
Probab=97.48  E-value=6.7e-05  Score=47.77  Aligned_cols=40  Identities=23%  Similarity=0.440  Sum_probs=34.7

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceecccccccccChh
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTF  101 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~  101 (134)
                      -+|.|. |++   ....+.+|.++|.++++|.|..|+..|....
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~~  157 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFKG  157 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEec
Confidence            479998 997   5678899999999999999999999887643


No 38 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.48  E-value=9.3e-05  Score=31.93  Aligned_cols=22  Identities=36%  Similarity=0.756  Sum_probs=11.0

Q ss_pred             eccccccccCChHHHHHHHHHc
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCH   82 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h   82 (134)
                      .|..|++.|.....|..|++.|
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHHHh
Confidence            4455555555555555555443


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.48  E-value=0.00013  Score=31.48  Aligned_cols=25  Identities=48%  Similarity=0.778  Sum_probs=22.2

Q ss_pred             eecccccccccChhhHHHHHhHhcC
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      |.|..|++.|.....|..|++.|..
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~~   25 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHXX   25 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhcc
Confidence            5799999999999999999997753


No 40 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.36  E-value=0.00013  Score=31.58  Aligned_cols=22  Identities=41%  Similarity=0.934  Sum_probs=13.5

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      |.|.+|++.|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4566666666666666666553


No 41 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.26  E-value=0.00017  Score=50.16  Aligned_cols=46  Identities=24%  Similarity=0.333  Sum_probs=37.4

Q ss_pred             CCCceeccc--ccccccChhhHHHHHhH-hc------------------CCCccccccCCCcccCcc
Q psy691           84 DVKRYLCTF--CGKGFNDTFDLKRHTRT-HT------------------GKEEEEEEDGKTNVLTTE  129 (134)
Q Consensus        84 ~~k~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~~~~~c~~~~~~~~~~~  129 (134)
                      ++|||+|++  |.|.++....|+.|+.. |.                  ..|||.|+.|.+....-+
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlN  412 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLN  412 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCc
Confidence            359999998  99999999999999875 31                  238999998988776544


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.05  E-value=0.00046  Score=29.76  Aligned_cols=23  Identities=30%  Similarity=0.847  Sum_probs=21.0

Q ss_pred             eecccccccccChhhHHHHHhHh
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      |.|.+|++.|.....|..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            67999999999999999998864


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.97  E-value=0.00065  Score=29.03  Aligned_cols=21  Identities=43%  Similarity=0.708  Sum_probs=9.9

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      |.|+.|+.... +..|..|++.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHh
Confidence            34555555554 5555555554


No 44 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=96.91  E-value=0.0007  Score=48.96  Aligned_cols=62  Identities=35%  Similarity=0.567  Sum_probs=58.0

Q ss_pred             CceeccccccccCChHHHHHHHH--HcCCC--Cceecc--cccccccChhhHHHHHhHhcCCCccccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMK--CHSDV--KRYLCT--FCGKGFNDTFDLKRHTRTHTGKEEEEEE  119 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~--~h~~~--k~~~C~--~C~~~f~~~~~l~~H~~~h~~~~~~~c~  119 (134)
                      .++.|..|...|.....|..|.+  .|.++  +++.|.  .|++.|.+...+.+|...|++.+++.+.
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            46899999999999999999999  79999  999999  7999999999999999999999888874


No 45 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.90  E-value=0.00085  Score=28.66  Aligned_cols=24  Identities=33%  Similarity=0.678  Sum_probs=19.0

Q ss_pred             eecccccccccChhhHHHHHhHhcC
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      |+|..|+.... ...|.+|++.|++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhCc
Confidence            68999998887 8899999998754


No 46 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=96.61  E-value=0.0019  Score=33.52  Aligned_cols=39  Identities=23%  Similarity=0.447  Sum_probs=29.8

Q ss_pred             ceecccccccccChhhHHHHHhH-hcCC-CccccccCCCccc
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRT-HTGK-EEEEEEDGKTNVL  126 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~c~~~~~~~~  126 (134)
                      .|.|++|++. .....|..|... |..+ +.+.|+.|...+.
T Consensus         2 ~f~CP~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~   42 (54)
T PF05605_consen    2 SFTCPYCGKG-FSESSLVEHCEDEHRSESKNVVCPICSSRVT   42 (54)
T ss_pred             CcCCCCCCCc-cCHHHHHHHHHhHCcCCCCCccCCCchhhhh
Confidence            4899999994 556789999777 5554 5699998887544


No 47 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.53  E-value=0.00049  Score=30.37  Aligned_cols=21  Identities=48%  Similarity=0.890  Sum_probs=11.2

Q ss_pred             eeccccccccCChHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMK   80 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~   80 (134)
                      |.|..|++.|.....|..|++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~   22 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMK   22 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTT
T ss_pred             CCcccCCCCcCCHHHHHHHHc
Confidence            445555555555555555443


No 48 
>KOG2893|consensus
Probab=96.36  E-value=0.002  Score=43.31  Aligned_cols=48  Identities=25%  Similarity=0.544  Sum_probs=36.5

Q ss_pred             CCCCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHH
Q psy691           54 RKDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRH  106 (134)
Q Consensus        54 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H  106 (134)
                      ++..++|. =+|++.|....-|..|++    .|.|+|.+|.|....-..|..|
T Consensus         6 kk~~kpwc-wycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen    6 KKVDKPWC-WYCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             cccCCcee-eecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            34455654 479999999999998887    4569999999776666666666


No 49 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.33  E-value=0.00096  Score=29.42  Aligned_cols=22  Identities=32%  Similarity=0.750  Sum_probs=20.2

Q ss_pred             eecccccccccChhhHHHHHhH
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      |-|..|++.|.....+..|++.
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            7899999999999999999875


No 50 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.68  E-value=0.0085  Score=25.90  Aligned_cols=18  Identities=28%  Similarity=0.833  Sum_probs=9.1

Q ss_pred             eccccccccCChHHHHHHH
Q psy691           61 ACHLCSKSFSLQRLLNRHM   79 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~   79 (134)
                      .|+.|++.|. ...|..|+
T Consensus         4 ~C~~CgR~F~-~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKFN-PDRLEKHE   21 (25)
T ss_pred             cCCCCCCEEC-HHHHHHHH
Confidence            4555555552 44455554


No 51 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.60  E-value=0.013  Score=27.24  Aligned_cols=23  Identities=30%  Similarity=0.665  Sum_probs=15.4

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      +|.|.+|++.|.....+..|+..
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            46677777777766666666653


No 52 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=95.12  E-value=0.017  Score=26.77  Aligned_cols=23  Identities=22%  Similarity=0.712  Sum_probs=20.7

Q ss_pred             ceecccccccccChhhHHHHHhH
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      +|.|.+|++.|.....+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            58899999999999999999775


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.17  E-value=0.055  Score=31.14  Aligned_cols=24  Identities=33%  Similarity=0.804  Sum_probs=21.6

Q ss_pred             ceeccccccccCChHHHHHHHHHc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCH   82 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h   82 (134)
                      .+.|.+|++.|.+...|..|++.+
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCc
Confidence            699999999999999999999975


No 54 
>KOG2186|consensus
Probab=93.78  E-value=0.04  Score=37.45  Aligned_cols=48  Identities=29%  Similarity=0.677  Sum_probs=38.9

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      .|.|..||.... +..+.+|+..-++ .-|.|.-|++.|.+ ..+..|..-
T Consensus         3 ~FtCnvCgEsvK-Kp~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVK-KPQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhcc-ccchHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            488999998877 5567889988776 56999999999998 677778654


No 55 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.58  E-value=0.043  Score=25.35  Aligned_cols=24  Identities=21%  Similarity=0.870  Sum_probs=14.8

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      |.|.+||..+....            .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            66777776654322            5567777763


No 56 
>KOG1146|consensus
Probab=93.43  E-value=0.052  Score=44.80  Aligned_cols=53  Identities=25%  Similarity=0.492  Sum_probs=45.4

Q ss_pred             CCceeccccccccCChHHHHHHHHH-cCC------------------------CCceecccccccccChhhHHHHHhH
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKC-HSD------------------------VKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~------------------------~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      .+.+.|+.|+..|+....|..|||. |..                        .++|.|..|.-.+..+.+|.+|+..
T Consensus       463 ~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  463 FKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             cccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            4678999999999999999999998 311                        2589999999999999999999875


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=92.94  E-value=0.056  Score=27.96  Aligned_cols=31  Identities=19%  Similarity=0.369  Sum_probs=24.4

Q ss_pred             cCCCCCCCceeccccccccCChHHHHHHHHH
Q psy691           51 TTGRKDNTRFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        51 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      ...+.++.-+.|+-|+..|.....+.+|...
T Consensus         9 v~~RDGE~~lrCPRC~~~FR~~K~Y~RHVNK   39 (65)
T COG4049           9 VRDRDGEEFLRCPRCGMVFRRRKDYIRHVNK   39 (65)
T ss_pred             eeccCCceeeeCCchhHHHHHhHHHHHHhhH
Confidence            3455667778899999999988888888764


No 58 
>KOG4167|consensus
Probab=90.74  E-value=0.28  Score=38.45  Aligned_cols=30  Identities=33%  Similarity=0.545  Sum_probs=25.4

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSD   84 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~   84 (134)
                      ....-|.|.+|+|.|.....+..||++|.-
T Consensus       788 ~~~giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  788 DPTGIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             CCCceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            345679999999999998999999999853


No 59 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=90.52  E-value=0.18  Score=31.22  Aligned_cols=25  Identities=32%  Similarity=0.725  Sum_probs=14.6

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCC
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDV   85 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~   85 (134)
                      ..-.|-+||+.|+   .|++|++.|+|-
T Consensus        71 d~i~clecGk~~k---~LkrHL~~~~gl   95 (132)
T PF05443_consen   71 DYIICLECGKKFK---TLKRHLRTHHGL   95 (132)
T ss_dssp             S-EE-TBT--EES---BHHHHHHHTT-S
T ss_pred             CeeEEccCCcccc---hHHHHHHHccCC
Confidence            3467888888887   358888888665


No 60 
>KOG2893|consensus
Probab=90.40  E-value=0.17  Score=34.32  Aligned_cols=39  Identities=18%  Similarity=0.354  Sum_probs=30.2

Q ss_pred             ecccccccccChhhHHHHHhHhcCCCccccccCCCcccCccce
Q psy691           89 LCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEYL  131 (134)
Q Consensus        89 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~l  131 (134)
                      .|.+|++.|.....|.+|++.    |-|+|..|.+..++---|
T Consensus        12 wcwycnrefddekiliqhqka----khfkchichkkl~sgpgl   50 (341)
T KOG2893|consen   12 WCWYCNREFDDEKILIQHQKA----KHFKCHICHKKLFSGPGL   50 (341)
T ss_pred             eeeecccccchhhhhhhhhhh----ccceeeeehhhhccCCCc
Confidence            599999999999999998875    458998776665554433


No 61 
>KOG2785|consensus
Probab=89.87  E-value=0.52  Score=34.11  Aligned_cols=53  Identities=21%  Similarity=0.405  Sum_probs=44.6

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCC-----------------------Cceeccccc---ccccChhhHHHHHhH
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDV-----------------------KRYLCTFCG---KGFNDTFDLKRHTRT  109 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------k~~~C~~C~---~~f~~~~~l~~H~~~  109 (134)
                      ..|-.|-.|++.+..-..-..||..+++-                       .-|.|.+|+   +.|......+.||..
T Consensus       164 ~~Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  164 LIPTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             cCCcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhh
Confidence            34568999999999988888899987662                       358999999   999999999999885


No 62 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.74  E-value=0.2  Score=29.85  Aligned_cols=30  Identities=27%  Similarity=0.607  Sum_probs=24.1

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccCh
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDT  100 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~  100 (134)
                      ..|+.||+.|..   |        +..|..|+.||..|...
T Consensus        10 R~Cp~CG~kFYD---L--------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYD---L--------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhcc---C--------CCCCccCCCCCCccCcc
Confidence            589999999863   3        35788999999988876


No 63 
>KOG2482|consensus
Probab=89.41  E-value=0.59  Score=33.45  Aligned_cols=51  Identities=27%  Similarity=0.609  Sum_probs=41.1

Q ss_pred             ceeccccccccCChHHHHHHHHH--cCCC---------------------------------------------------
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC--HSDV---------------------------------------------------   85 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~--h~~~---------------------------------------------------   85 (134)
                      .+.|-.|.+.|..+..|+.||+.  |...                                                   
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            48999999999999999999985  4110                                                   


Q ss_pred             -Cc--eecccccccccChhhHHHHHhH
Q psy691           86 -KR--YLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        86 -k~--~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                       .+  ..|.+|.........|..||++
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~  301 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKI  301 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHH
Confidence             12  4888998888888889899886


No 64 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=89.00  E-value=0.4  Score=34.68  Aligned_cols=62  Identities=32%  Similarity=0.641  Sum_probs=53.4

Q ss_pred             CCCceeccccccccCChHHHHHHHHHcCCCCceeccc--ccccccChhhHHHHHhHhcCCCccc
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTF--CGKGFNDTFDLKRHTRTHTGKEEEE  117 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~  117 (134)
                      ....+.|+.|...|....+...|.+.|.+++++.|..  |...|.....+.+|.+.++......
T Consensus        30 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (467)
T COG5048          30 APRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNNPSDL   93 (467)
T ss_pred             CCchhhcccccccccccchhhhhcccccccCCccccccccccccCCcchhhhhccccccccccc
Confidence            3456899999999999999999999999999999987  7788999999999988877655433


No 65 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=88.38  E-value=0.51  Score=29.22  Aligned_cols=28  Identities=46%  Similarity=0.794  Sum_probs=18.3

Q ss_pred             CCceecccccccccChhhHHHHHhHhcCCCc
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRTHTGKEE  115 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  115 (134)
                      ..-..|..||+.|..   |.+|.+.|+|-.|
T Consensus        70 ~d~i~clecGk~~k~---LkrHL~~~~gltp   97 (132)
T PF05443_consen   70 PDYIICLECGKKFKT---LKRHLRTHHGLTP   97 (132)
T ss_dssp             SS-EE-TBT--EESB---HHHHHHHTT-S-H
T ss_pred             cCeeEEccCCcccch---HHHHHHHccCCCH
Confidence            344789999999987   6999999988655


No 66 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.90  E-value=0.28  Score=22.80  Aligned_cols=25  Identities=20%  Similarity=0.555  Sum_probs=15.8

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      .|.|..||..+...            ..|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            37788888665432            14567888764


No 67 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=87.23  E-value=0.57  Score=22.14  Aligned_cols=32  Identities=25%  Similarity=0.573  Sum_probs=17.1

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCceecccccccc
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGF   97 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f   97 (134)
                      .|+.|+..|.-...     +.-.+.+..+|..|+..|
T Consensus         4 ~CP~C~~~f~v~~~-----~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD-----KLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHH-----HcccCCcEEECCCCCcEe
Confidence            56666666654433     112233456666666555


No 68 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=87.18  E-value=0.53  Score=22.18  Aligned_cols=34  Identities=21%  Similarity=0.430  Sum_probs=19.4

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceeccccccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      ..|+.|+..|.-.....     ........|..|+..|.
T Consensus         3 ~~CP~C~~~~~v~~~~~-----~~~~~~v~C~~C~~~~~   36 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQL-----GANGGKVRCGKCGHVWY   36 (38)
T ss_pred             EECCCCCCEEEeCHHHc-----CCCCCEEECCCCCCEEE
Confidence            46777777776544321     11222467777776654


No 69 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=86.77  E-value=0.35  Score=25.06  Aligned_cols=32  Identities=25%  Similarity=0.380  Sum_probs=26.3

Q ss_pred             HcCCCCceecccccccccChhhHHHHHhHhcC
Q psy691           81 CHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        81 ~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      ...|+.-+.|+-|+..|...-.+.+|...-++
T Consensus        11 ~RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          11 DRDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             ccCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            34567778999999999999999999776444


No 70 
>KOG4173|consensus
Probab=86.34  E-value=0.39  Score=31.90  Aligned_cols=46  Identities=26%  Similarity=0.585  Sum_probs=22.6

Q ss_pred             ceeccc--cccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHH
Q psy691           59 RFACHL--CSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHT  107 (134)
Q Consensus        59 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~  107 (134)
                      .|.|++  |...|..-..+..|..+-++.   .|.+|.+.|.+...|..|+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHH
Confidence            355555  445555444444444332222   4555666665555555553


No 71 
>KOG1146|consensus
Probab=86.25  E-value=0.62  Score=38.97  Aligned_cols=71  Identities=17%  Similarity=0.129  Sum_probs=51.6

Q ss_pred             eccccccccCChHHHHHHHHH-cCCCCceecccccccccChhhHHHHHhHhc-------------------------CCC
Q psy691           61 ACHLCSKSFSLQRLLNRHMKC-HSDVKRYLCTFCGKGFNDTFDLKRHTRTHT-------------------------GKE  114 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~-h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~-------------------------~~~  114 (134)
                      .|.-|+..+.++..+..|+.. |...+-+.|..|+..|.....|-.|+|.-+                         +-+
T Consensus       438 e~~~~e~~~~s~r~~~~~t~~L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~  517 (1406)
T KOG1146|consen  438 ELTKAEPLLESKRSLEGQTVVLHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGK  517 (1406)
T ss_pred             cccchhhhhhhhcccccceeeeecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCC
Confidence            344566666766666666654 666788999999999999999999999811                         115


Q ss_pred             ccccccCCCcccCccce
Q psy691          115 EEEEEDGKTNVLTTEYL  131 (134)
Q Consensus       115 ~~~c~~~~~~~~~~~~l  131 (134)
                      +|.|.-|.+.+.....|
T Consensus       518 p~~C~~C~~stttng~L  534 (1406)
T KOG1146|consen  518 PYPCRACNYSTTTNGNL  534 (1406)
T ss_pred             cccceeeeeeeecchHH
Confidence            67777777777665444


No 72 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=86.04  E-value=0.81  Score=22.33  Aligned_cols=23  Identities=26%  Similarity=0.631  Sum_probs=11.2

Q ss_pred             CCceeccccccccCCh----HHHHHHH
Q psy691           57 NTRFACHLCSKSFSLQ----RLLNRHM   79 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~----~~l~~H~   79 (134)
                      .....|..|++.+...    .+|.+|+
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            3445677777666553    5566665


No 73 
>KOG2186|consensus
Probab=85.73  E-value=0.47  Score=32.48  Aligned_cols=41  Identities=15%  Similarity=0.318  Sum_probs=33.3

Q ss_pred             eecccccccccChhhHHHHHhHhcCCCccccccCCCcccCccc
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEY  130 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~  130 (134)
                      |.|..||....- ..+.+|+...++ ..|.|.-|...|...++
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~~sY   44 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFERVSY   44 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeecccccccchh
Confidence            789999987554 567789988888 88999888888887654


No 74 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=85.61  E-value=0.88  Score=22.94  Aligned_cols=25  Identities=36%  Similarity=0.699  Sum_probs=18.5

Q ss_pred             ceeccccccccCCh-----HHHHHHHH-HcC
Q psy691           59 RFACHLCSKSFSLQ-----RLLNRHMK-CHS   83 (134)
Q Consensus        59 ~~~C~~C~~~f~~~-----~~l~~H~~-~h~   83 (134)
                      .-.|..|++.+...     ++|.+|+. .|.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            46899999988765     57888877 453


No 75 
>KOG4173|consensus
Probab=85.49  E-value=0.38  Score=31.93  Aligned_cols=49  Identities=29%  Similarity=0.633  Sum_probs=41.0

Q ss_pred             eccccccccCChHHHHHHHHH-c---------CCCCceeccc--ccccccChhhHHHHHhH
Q psy691           61 ACHLCSKSFSLQRLLNRHMKC-H---------SDVKRYLCTF--CGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~-h---------~~~k~~~C~~--C~~~f~~~~~l~~H~~~  109 (134)
                      .|.+|.+.|.+...|..|+.. |         .|.-.|.|.+  |+..|.+......|+-.
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            899999999999999999864 3         3455699976  99999999888888654


No 76 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.38  E-value=0.85  Score=30.64  Aligned_cols=29  Identities=24%  Similarity=0.614  Sum_probs=21.5

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHS   83 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~   83 (134)
                      ..+..|.|.+|+|.|+-...+..|+...+
T Consensus        73 ~~~~K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   73 EDEDKWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             SSSEEEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             HcCCEECCCCCCcccCChHHHHHHHhhcC
Confidence            44557999999999999999999988733


No 77 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=85.25  E-value=2.7  Score=26.07  Aligned_cols=25  Identities=28%  Similarity=0.476  Sum_probs=21.1

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKR   87 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~   87 (134)
                      ..|-++|+.|+   .|++|+.+|.+.-|
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCCCH
Confidence            57999999997   69999999987543


No 78 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.10  E-value=0.39  Score=32.22  Aligned_cols=30  Identities=20%  Similarity=0.493  Sum_probs=23.0

Q ss_pred             CCceecccccccccChhhHHHHHhHhcCCC
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRTHTGKE  114 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~  114 (134)
                      +..|.|..|+|.|.-......|+..-|.|+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~  104 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEK  104 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHH
Confidence            446999999999999999999999865543


No 79 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=85.09  E-value=0.18  Score=27.72  Aligned_cols=18  Identities=17%  Similarity=0.241  Sum_probs=9.8

Q ss_pred             CCceecc--cccccccChhh
Q psy691           85 VKRYLCT--FCGKGFNDTFD  102 (134)
Q Consensus        85 ~k~~~C~--~C~~~f~~~~~  102 (134)
                      ++-++|.  .||..|.....
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEE
Confidence            4445665  46666655433


No 80 
>KOG2785|consensus
Probab=84.49  E-value=1.3  Score=32.25  Aligned_cols=51  Identities=24%  Similarity=0.485  Sum_probs=41.2

Q ss_pred             ceeccccccccCChHHHHHHHHH--c-----------------------------------CCCCceecccccccccChh
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC--H-----------------------------------SDVKRYLCTFCGKGFNDTF  101 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~--h-----------------------------------~~~k~~~C~~C~~~f~~~~  101 (134)
                      .|.|.-|...|.....-+.|+.+  |                                   ...-++.|..|.+.|....
T Consensus         3 ~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~c~k~~~s~~   82 (390)
T KOG2785|consen    3 GFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKEENLEEAESVVYCEACNKSFASPK   82 (390)
T ss_pred             cceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhhhhhhhcccceehHHhhccccChh
Confidence            48999999999998888888876  4                                   1123688999999999988


Q ss_pred             hHHHHHhH
Q psy691          102 DLKRHTRT  109 (134)
Q Consensus       102 ~l~~H~~~  109 (134)
                      ....|+..
T Consensus        83 a~~~hl~S   90 (390)
T KOG2785|consen   83 AHENHLKS   90 (390)
T ss_pred             hHHHHHHH
Confidence            88888765


No 81 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=84.34  E-value=0.64  Score=29.94  Aligned_cols=23  Identities=26%  Similarity=0.842  Sum_probs=15.0

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceeccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCG   94 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~   94 (134)
                      .|.|.+||..             |.++-|-.|++|+
T Consensus       134 ~~vC~vCGy~-------------~~ge~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGEAPEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCCCCCcCCCCC
Confidence            5777777654             3345667777776


No 82 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=84.09  E-value=0.79  Score=22.63  Aligned_cols=26  Identities=19%  Similarity=0.567  Sum_probs=16.1

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceeccccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKG   96 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~   96 (134)
                      |.|..||..|...           ...+..|+.||..
T Consensus         3 Y~C~~Cg~~~~~~-----------~~~~irC~~CG~r   28 (44)
T smart00659        3 YICGECGRENEIK-----------SKDVVRCRECGYR   28 (44)
T ss_pred             EECCCCCCEeecC-----------CCCceECCCCCce
Confidence            6777777776533           2345677777643


No 83 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=84.06  E-value=0.2  Score=33.66  Aligned_cols=19  Identities=21%  Similarity=0.744  Sum_probs=11.9

Q ss_pred             CceeccccccccCChHHHH
Q psy691           58 TRFACHLCSKSFSLQRLLN   76 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~   76 (134)
                      +...|++|++.|..+....
T Consensus         4 k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    4 KKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CceECCCCCCeeeeeEEEc
Confidence            4567777777777654433


No 84 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.58  E-value=1.1  Score=26.91  Aligned_cols=65  Identities=15%  Similarity=0.137  Sum_probs=32.7

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCc------------eecccccccccChhhHHHHHhHhcCCCccccccCCCcc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKR------------YLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNV  125 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~  125 (134)
                      |-.|++|+-......+|.+...--..-++            ..|-.|.+.|........  ..-.....|.|+.|+..|
T Consensus        15 P~~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~F   91 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVF   91 (112)
T ss_pred             CCcCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCcc
Confidence            45778888777777777653210000111            137777777765431110  001223357776666554


No 85 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=83.39  E-value=1.2  Score=20.93  Aligned_cols=33  Identities=18%  Similarity=0.544  Sum_probs=18.3

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGF   97 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f   97 (134)
                      ..|+.|+..|.-....     .-......+|..|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCCcEEECCCCCCEe
Confidence            3566777766655442     12233456777776655


No 86 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=82.83  E-value=0.86  Score=27.90  Aligned_cols=35  Identities=20%  Similarity=0.314  Sum_probs=26.1

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLK  104 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~  104 (134)
                      ...|+.||+.|..   |        +..|..|+.||..|.....+.
T Consensus         9 Kr~Cp~cg~kFYD---L--------nk~p~vcP~cg~~~~~~~~~~   43 (129)
T TIGR02300         9 KRICPNTGSKFYD---L--------NRRPAVSPYTGEQFPPEEALK   43 (129)
T ss_pred             cccCCCcCccccc---c--------CCCCccCCCcCCccCcchhhc
Confidence            3589999999862   2        357899999999887664443


No 87 
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=81.81  E-value=0.89  Score=28.08  Aligned_cols=55  Identities=18%  Similarity=0.284  Sum_probs=31.4

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceeccc---ccccccChhhHHHHHhHhcCCCccccccCCCcccCccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTF---CGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTNVLTTEY  130 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~---C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~~~~~~  130 (134)
                      +.|+|.+|..+...+..|          ||-.|-.   |+.-   -..|.+|-.+|     =.|+.|+++|.+++.
T Consensus        79 ~lYeCnIC~etS~ee~FL----------KPneCCgY~iCn~C---ya~LWK~~~~y-----pvCPvCkTSFKss~~  136 (140)
T PF05290_consen   79 KLYECNICKETSAEERFL----------KPNECCGYSICNAC---YANLWKFCNLY-----PVCPVCKTSFKSSSS  136 (140)
T ss_pred             CceeccCcccccchhhcC----------CcccccchHHHHHH---HHHHHHHcccC-----CCCCccccccccccc
Confidence            457777777665543332          3433321   3322   23455554433     269999999998864


No 88 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=81.55  E-value=0.8  Score=29.23  Aligned_cols=33  Identities=6%  Similarity=-0.032  Sum_probs=20.8

Q ss_pred             CCCCceecccccccccChhhHHHHHhHhcCCCccccccCCCc
Q psy691           83 SDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTN  124 (134)
Q Consensus        83 ~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~  124 (134)
                      .+..-|.|+.|+..|+....+.         ..|.|+.|+..
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            3345577777777777766664         25777666554


No 89 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=80.70  E-value=0.77  Score=29.93  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=9.4

Q ss_pred             ceecccccccccChhhH
Q psy691           87 RYLCTFCGKGFNDTFDL  103 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l  103 (134)
                      -|.|+.|+..|+....+
T Consensus       117 ~Y~Cp~C~~rytf~eA~  133 (178)
T PRK06266        117 FFFCPNCHIRFTFDEAM  133 (178)
T ss_pred             EEECCCCCcEEeHHHHh
Confidence            45666666555555444


No 90 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=80.58  E-value=0.65  Score=33.37  Aligned_cols=22  Identities=27%  Similarity=0.629  Sum_probs=14.4

Q ss_pred             eeccc--cccccCChHHHHHHHHH
Q psy691           60 FACHL--CSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~--C~~~f~~~~~l~~H~~~   81 (134)
                      |.|+.  |.........|+.|.+.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~  175 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKA  175 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHh
Confidence            66765  55555556677777776


No 91 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=80.56  E-value=0.75  Score=22.76  Aligned_cols=30  Identities=20%  Similarity=0.625  Sum_probs=17.0

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceeccccccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      .|.|+.||..|.....          .....|+.||..+.
T Consensus         3 ~y~C~~CG~~~~~~~~----------~~~~~Cp~CG~~~~   32 (46)
T PRK00398          3 EYKCARCGREVELDEY----------GTGVRCPYCGYRIL   32 (46)
T ss_pred             EEECCCCCCEEEECCC----------CCceECCCCCCeEE
Confidence            4677777776654221          11467777775443


No 92 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=79.88  E-value=1.8  Score=22.79  Aligned_cols=32  Identities=28%  Similarity=0.611  Sum_probs=17.1

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      .|.|+.||.....+..     +-..-..+|.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHcCCceECCCcCc
Confidence            4778888755433221     1111235677777763


No 93 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.88  E-value=2.4  Score=26.70  Aligned_cols=36  Identities=8%  Similarity=-0.005  Sum_probs=19.0

Q ss_pred             CCceecccccccccChhhHHHHHhHhcCCCccccccCCCc
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKTN  124 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~  124 (134)
                      ..-|.|+.|+..|.....+.-   ... +..|.|+.|+..
T Consensus        97 ~~~Y~Cp~C~~~y~~~ea~~~---~d~-~~~f~Cp~Cg~~  132 (147)
T smart00531       97 NAYYKCPNCQSKYTFLEANQL---LDM-DGTFTCPRCGEE  132 (147)
T ss_pred             CcEEECcCCCCEeeHHHHHHh---cCC-CCcEECCCCCCE
Confidence            345777777777765433321   011 233777655554


No 94 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.43  E-value=0.39  Score=30.57  Aligned_cols=16  Identities=38%  Similarity=0.613  Sum_probs=12.0

Q ss_pred             ceecccccccccChhh
Q psy691           87 RYLCTFCGKGFNDTFD  102 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~  102 (134)
                      .++|..||++|..-..
T Consensus        28 ~~~c~~c~~~f~~~e~   43 (154)
T PRK00464         28 RRECLACGKRFTTFER   43 (154)
T ss_pred             eeeccccCCcceEeEe
Confidence            4888899988876443


No 95 
>KOG2593|consensus
Probab=79.35  E-value=1.8  Score=32.06  Aligned_cols=35  Identities=20%  Similarity=0.287  Sum_probs=17.0

Q ss_pred             CceecccccccccChhhHHHHHhHhcCCCccccccCCC
Q psy691           86 KRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKT  123 (134)
Q Consensus        86 k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~  123 (134)
                      .-|.|+.|.+.|.....++   -.--..-.|.|.-|+.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~---L~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ---LLDNETGEFHCENCGG  161 (436)
T ss_pred             ccccCCccccchhhhHHHH---hhcccCceEEEecCCC
Confidence            4466666666665544442   1222233566654443


No 96 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=79.23  E-value=1.7  Score=22.91  Aligned_cols=31  Identities=23%  Similarity=0.529  Sum_probs=16.4

Q ss_pred             ceeccccccc-cCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKS-FSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~-f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      .|.|+.||.. ..+-..-+      ....+|.|+.||.
T Consensus        25 ~F~CPnCG~~~I~RC~~CR------k~~~~Y~CP~CGF   56 (59)
T PRK14890         25 KFLCPNCGEVIIYRCEKCR------KQSNPYTCPKCGF   56 (59)
T ss_pred             EeeCCCCCCeeEeechhHH------hcCCceECCCCCC
Confidence            4777777766 32221111      1135677777763


No 97 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=78.29  E-value=2.2  Score=18.44  Aligned_cols=19  Identities=26%  Similarity=0.756  Sum_probs=11.6

Q ss_pred             eccccccccCChHHHHHHHH
Q psy691           61 ACHLCSKSFSLQRLLNRHMK   80 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~   80 (134)
                      .|++|++.+ ....+..|+.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            577777776 3455555654


No 98 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=77.90  E-value=1.3  Score=27.39  Aligned_cols=25  Identities=44%  Similarity=0.655  Sum_probs=21.1

Q ss_pred             eecccccccccChhhHHHHHhHhcCCCc
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRTHTGKEE  115 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~  115 (134)
                      ..|..+|+.|..   |++|..+|.|--|
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCH
Confidence            578889999875   9999999988655


No 99 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=77.38  E-value=8.8  Score=22.66  Aligned_cols=26  Identities=12%  Similarity=0.378  Sum_probs=22.3

Q ss_pred             ceec----cccccccCChHHHHHHHHHcCC
Q psy691           59 RFAC----HLCSKSFSLQRLLNRHMKCHSD   84 (134)
Q Consensus        59 ~~~C----~~C~~~f~~~~~l~~H~~~h~~   84 (134)
                      -|.|    ..|+....+...+..|++.+++
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            3899    8899999999999999987653


No 100
>KOG4167|consensus
Probab=77.32  E-value=0.67  Score=36.48  Aligned_cols=26  Identities=31%  Similarity=0.516  Sum_probs=23.7

Q ss_pred             ceecccccccccChhhHHHHHhHhcC
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      -|.|..|+|.|...-++..||++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            48999999999999999999999864


No 101
>KOG3408|consensus
Probab=75.75  E-value=2.1  Score=25.98  Aligned_cols=28  Identities=25%  Similarity=0.479  Sum_probs=24.2

Q ss_pred             CCCCCceeccccccccCChHHHHHHHHH
Q psy691           54 RKDNTRFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        54 ~~~~~~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      ..+...|.|-+|.+-|.....|..|.++
T Consensus        52 lPG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   52 LPGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCCceeehhhhhhhhcchHHHHHHHhc
Confidence            3456679999999999999999999875


No 102
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=75.47  E-value=0.59  Score=23.68  Aligned_cols=11  Identities=27%  Similarity=1.029  Sum_probs=7.0

Q ss_pred             eeccccccccC
Q psy691           60 FACHLCSKSFS   70 (134)
Q Consensus        60 ~~C~~C~~~f~   70 (134)
                      |.|..|+..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            56666666665


No 103
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=75.42  E-value=2.5  Score=25.04  Aligned_cols=54  Identities=20%  Similarity=0.469  Sum_probs=40.7

Q ss_pred             CceeccccccccCChHHHHHHHHH-cCCC-----------------------------------------Cceec----c
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKC-HSDV-----------------------------------------KRYLC----T   91 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~~-----------------------------------------k~~~C----~   91 (134)
                      +...|..|+..... ..+..|++. |...                                         .-|.|    .
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            34678888877664 677888874 4211                                         13899    8


Q ss_pred             cccccccChhhHHHHHhHhcC
Q psy691           92 FCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        92 ~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      .|+........+.+|.+.++|
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            899999999999999998765


No 104
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=74.31  E-value=4.7  Score=25.73  Aligned_cols=35  Identities=20%  Similarity=0.507  Sum_probs=26.4

Q ss_pred             CCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      ...-|.|+.|+..|+....+.         .-|.|+.||.....
T Consensus       106 ~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L~~  140 (158)
T TIGR00373       106 NNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAMLDY  140 (158)
T ss_pred             CCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEeee
Confidence            344589999999998776664         36999999975443


No 105
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=72.92  E-value=2.2  Score=21.59  Aligned_cols=28  Identities=21%  Similarity=0.828  Sum_probs=17.3

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      ..|.|..||+.|...          .......|+.||.
T Consensus         5 ~~Y~C~~Cg~~~~~~----------~~~~~irCp~Cg~   32 (49)
T COG1996           5 MEYKCARCGREVELD----------QETRGIRCPYCGS   32 (49)
T ss_pred             EEEEhhhcCCeeehh----------hccCceeCCCCCc
Confidence            357888888887211          1234567888874


No 106
>PHA00626 hypothetical protein
Probab=72.14  E-value=2.6  Score=21.91  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=11.8

Q ss_pred             CCceeccccccccCC
Q psy691           57 NTRFACHLCSKSFSL   71 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~   71 (134)
                      ...|.|+.||..|+.
T Consensus        21 snrYkCkdCGY~ft~   35 (59)
T PHA00626         21 SDDYVCCDCGYNDSK   35 (59)
T ss_pred             CcceEcCCCCCeech
Confidence            457899999988874


No 107
>KOG2231|consensus
Probab=72.07  E-value=3.2  Score=32.65  Aligned_cols=21  Identities=29%  Similarity=0.665  Sum_probs=13.3

Q ss_pred             eccccccccCChHHHHHHHHH
Q psy691           61 ACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      .|..|...|.....|.+|++.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            466666666666666666654


No 108
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=70.71  E-value=1.4  Score=25.14  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=5.2

Q ss_pred             eeccccccccc
Q psy691           88 YLCTFCGKGFN   98 (134)
Q Consensus        88 ~~C~~C~~~f~   98 (134)
                      +.|..|+..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            44555554443


No 109
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=69.52  E-value=3.4  Score=20.40  Aligned_cols=20  Identities=25%  Similarity=0.378  Sum_probs=8.4

Q ss_pred             ecccccccccChhhHHHHHh
Q psy691           89 LCTFCGKGFNDTFDLKRHTR  108 (134)
Q Consensus        89 ~C~~C~~~f~~~~~l~~H~~  108 (134)
                      +|-.|......+++|-.||+
T Consensus        22 kcfqcpftc~~kshl~nhmk   41 (54)
T PF15269_consen   22 KCFQCPFTCNEKSHLFNHMK   41 (54)
T ss_pred             eeecCCcccchHHHHHHHHH
Confidence            34444333344444444443


No 110
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=67.67  E-value=6.9  Score=25.56  Aligned_cols=34  Identities=24%  Similarity=0.643  Sum_probs=25.6

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      ..-|.|+.|+..|+....+.         .-|.|+.||.....
T Consensus       115 ~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~~  148 (178)
T PRK06266        115 NMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLEE  148 (178)
T ss_pred             CCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCee
Confidence            34589999999998766542         36999999975544


No 111
>KOG2482|consensus
Probab=65.24  E-value=5  Score=28.99  Aligned_cols=51  Identities=27%  Similarity=0.532  Sum_probs=37.3

Q ss_pred             ceeccccccccCC-hHHHHHHHHH-cC---CC------------------CceecccccccccChhhHHHHHhH
Q psy691           59 RFACHLCSKSFSL-QRLLNRHMKC-HS---DV------------------KRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        59 ~~~C~~C~~~f~~-~~~l~~H~~~-h~---~~------------------k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      ...|-.|...+.- ++.+..|+.. |.   |.                  ..+.|..|.+.|..+..|+.||+.
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrk  217 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRK  217 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHh
Confidence            4579899877653 4455556543 42   10                  258999999999999999999986


No 112
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=64.60  E-value=2.8  Score=19.18  Aligned_cols=11  Identities=18%  Similarity=0.715  Sum_probs=5.7

Q ss_pred             eeccccccccC
Q psy691           60 FACHLCSKSFS   70 (134)
Q Consensus        60 ~~C~~C~~~f~   70 (134)
                      |.|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            45666665554


No 113
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.06  E-value=3.8  Score=24.46  Aligned_cols=32  Identities=16%  Similarity=0.187  Sum_probs=22.4

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHH
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLK  104 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~  104 (134)
                      .|+.|++.|..   |        +..|..|++||++|.. +.|.
T Consensus        11 idPetg~KFYD---L--------NrdPiVsPytG~s~P~-s~fe   42 (129)
T COG4530          11 IDPETGKKFYD---L--------NRDPIVSPYTGKSYPR-SYFE   42 (129)
T ss_pred             cCccccchhhc---c--------CCCccccCcccccchH-HHHH
Confidence            67888888752   2        3578899999998843 4443


No 114
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=62.36  E-value=9.7  Score=18.35  Aligned_cols=24  Identities=25%  Similarity=0.372  Sum_probs=17.4

Q ss_pred             eeccccccccCC--hHHHHHHHHHcC
Q psy691           60 FACHLCSKSFSL--QRLLNRHMKCHS   83 (134)
Q Consensus        60 ~~C~~C~~~f~~--~~~l~~H~~~h~   83 (134)
                      -.|+.||..|..  ...-..|.+-|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            589999988874  456666776663


No 115
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=62.11  E-value=4.1  Score=25.85  Aligned_cols=31  Identities=19%  Similarity=0.460  Sum_probs=14.8

Q ss_pred             ceecccccccccChhhHHHHHhHhcCCCccccccCC
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGK  122 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~  122 (134)
                      +|.|. |+..|.+   .++|-..-.|+ .|.|..|+
T Consensus       117 ~Y~C~-C~q~~l~---~RRhn~~~~g~-~YrC~~C~  147 (156)
T COG3091         117 PYRCQ-CQQHYLR---IRRHNTVRRGE-VYRCGKCG  147 (156)
T ss_pred             eEEee-cCCccch---hhhcccccccc-eEEeccCC
Confidence            45666 6555433   23333344444 56664443


No 116
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=62.03  E-value=3.8  Score=17.71  Aligned_cols=11  Identities=27%  Similarity=0.618  Sum_probs=8.4

Q ss_pred             eeccccccccC
Q psy691           60 FACHLCSKSFS   70 (134)
Q Consensus        60 ~~C~~C~~~f~   70 (134)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            36888888875


No 117
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=61.06  E-value=2.4  Score=18.77  Aligned_cols=9  Identities=56%  Similarity=1.139  Sum_probs=4.2

Q ss_pred             ecccccccc
Q psy691           61 ACHLCSKSF   69 (134)
Q Consensus        61 ~C~~C~~~f   69 (134)
                      .|-.|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344444444


No 118
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=60.72  E-value=3.2  Score=21.46  Aligned_cols=40  Identities=15%  Similarity=0.490  Sum_probs=18.1

Q ss_pred             ceeccc--cccccCChHHHHHHHHHcCCCCceeccc----ccccccC
Q psy691           59 RFACHL--CSKSFSLQRLLNRHMKCHSDVKRYLCTF----CGKGFND   99 (134)
Q Consensus        59 ~~~C~~--C~~~f~~~~~l~~H~~~h~~~k~~~C~~----C~~~f~~   99 (134)
                      +-.|+.  |...+. +..|..|+...=..++..|.+    |...+..
T Consensus         9 ~v~C~~~cc~~~i~-r~~l~~H~~~~C~~~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    9 PVPCPNGCCNEMIP-RKELDDHLENECPKRPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             EEE-TT--S-BEEE-CCCHHHHHHTTSTTSEEE-SS----S--EEEH
T ss_pred             EeeCCCCCccccee-HHHHHHHHHccCCCCcEECCCCCCCCCCccch
Confidence            345655  434344 345666666443445566666    6655443


No 119
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=60.61  E-value=9  Score=19.39  Aligned_cols=38  Identities=16%  Similarity=0.335  Sum_probs=20.1

Q ss_pred             CCceeccccccccCChHHHHHHHHH-cCCCCceeccccc
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKC-HSDVKRYLCTFCG   94 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~k~~~C~~C~   94 (134)
                      ++.+.|..||..|.....=+..... -....|-.|..|-
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            3567888888877754333322222 1112455666664


No 120
>KOG2071|consensus
Probab=59.20  E-value=5.3  Score=30.86  Aligned_cols=29  Identities=24%  Similarity=0.449  Sum_probs=21.1

Q ss_pred             CCceecccccccccChhhHHHHHhHhcCC
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRTHTGK  113 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~  113 (134)
                      .+|-+|..||.+|........||..|..+
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~dw  444 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHDDW  444 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhhhh
Confidence            45678888888888877777777666543


No 121
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=58.32  E-value=6.1  Score=21.09  Aligned_cols=28  Identities=36%  Similarity=0.710  Sum_probs=13.4

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      -.|..|++.|..            -.+.+.|..||..|-.
T Consensus        10 ~~C~~C~~~F~~------------~~rrhhCr~CG~~vC~   37 (69)
T PF01363_consen   10 SNCMICGKKFSL------------FRRRHHCRNCGRVVCS   37 (69)
T ss_dssp             SB-TTT--B-BS------------SS-EEE-TTT--EEEC
T ss_pred             CcCcCcCCcCCC------------ceeeEccCCCCCEECC
Confidence            478889998853            1456778888877664


No 122
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=58.32  E-value=3.8  Score=21.20  Aligned_cols=30  Identities=23%  Similarity=0.548  Sum_probs=16.6

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGF   97 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f   97 (134)
                      |.|+.|+..+.-....       .++ ...|..||..+
T Consensus         3 ~~CP~CG~~iev~~~~-------~Ge-iV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPE-------LGE-LVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCc-------cCC-EEeCCCCCCEE
Confidence            5777777766433221       122 45777777544


No 123
>KOG2593|consensus
Probab=58.10  E-value=14  Score=27.57  Aligned_cols=39  Identities=18%  Similarity=0.512  Sum_probs=26.5

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCCCCceeccccccc
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKG   96 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~   96 (134)
                      ....-|.|+.|.+.|+.-..+   +..-...--|.|..|+-.
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~---~L~~~~~~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEAL---QLLDNETGEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHH---HhhcccCceEEEecCCCc
Confidence            344569999999999854443   344433456999999743


No 124
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=57.99  E-value=11  Score=27.48  Aligned_cols=22  Identities=27%  Similarity=0.493  Sum_probs=19.8

Q ss_pred             eccccccccCChHHHHHHHHHc
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCH   82 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h   82 (134)
                      .|.+|...|.....|..|+|..
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~~  243 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRLR  243 (493)
T ss_pred             hhhhccceecChHHHHHHHHhh
Confidence            6999999999999999999863


No 125
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=57.72  E-value=9.2  Score=28.92  Aligned_cols=27  Identities=33%  Similarity=0.437  Sum_probs=23.0

Q ss_pred             ceeccccccccCChHHHHHHHHH-cCCC
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC-HSDV   85 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~-h~~~   85 (134)
                      -|.|+.|.+.|.....+..|+.. |.+.
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            36899999999999999999985 7653


No 126
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=57.66  E-value=4.8  Score=23.17  Aligned_cols=14  Identities=36%  Similarity=0.755  Sum_probs=8.5

Q ss_pred             CceecccccccccC
Q psy691           86 KRYLCTFCGKGFND   99 (134)
Q Consensus        86 k~~~C~~C~~~f~~   99 (134)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            45566666666554


No 127
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=57.23  E-value=5.3  Score=18.79  Aligned_cols=29  Identities=21%  Similarity=0.596  Sum_probs=17.3

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      |.|..||..|......      .. .....|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKI------SD-DPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEec------CC-CCCCCCCCCCC
Confidence            6788888877633221      11 34456777775


No 128
>KOG4124|consensus
Probab=57.13  E-value=1.2  Score=32.04  Aligned_cols=53  Identities=28%  Similarity=0.593  Sum_probs=38.3

Q ss_pred             CCceeccc--cccccCChHHHHHHHHH-cC------------------CCCceecccccccccChhhHHHHHhH
Q psy691           57 NTRFACHL--CSKSFSLQRLLNRHMKC-HS------------------DVKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        57 ~~~~~C~~--C~~~f~~~~~l~~H~~~-h~------------------~~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      .++|.|.+  |.+.++....|..|-.. |-                  ..|+|+|++|.++++....|..|...
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h~s~i~~~s~~~~ph~~~~~~nk~~r~~i~~~~~k~~~~l~~~~~~  420 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGHCSPITTPTPAPIPHQGFVVENKPYRCEVCSKRYKNLNGLKYHRTH  420 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCcCCCCCCCCCCCCCcceeeeccCcccChhhhhhhccCCCCCceeeh
Confidence            55778876  88888877777776543 31                  14789999999998888887766544


No 129
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=57.04  E-value=3.5  Score=25.63  Aligned_cols=15  Identities=27%  Similarity=0.744  Sum_probs=11.1

Q ss_pred             CceeccccccccCCh
Q psy691           58 TRFACHLCSKSFSLQ   72 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~   72 (134)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            358898899887653


No 130
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=55.18  E-value=5  Score=18.81  Aligned_cols=11  Identities=18%  Similarity=0.667  Sum_probs=6.2

Q ss_pred             eeccccccccC
Q psy691           60 FACHLCSKSFS   70 (134)
Q Consensus        60 ~~C~~C~~~f~   70 (134)
                      +.|+.||+.|.
T Consensus         2 r~C~~Cg~~Yh   12 (36)
T PF05191_consen    2 RICPKCGRIYH   12 (36)
T ss_dssp             EEETTTTEEEE
T ss_pred             cCcCCCCCccc
Confidence            35666666654


No 131
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=54.06  E-value=9.1  Score=16.25  Aligned_cols=11  Identities=27%  Similarity=0.670  Sum_probs=7.5

Q ss_pred             CCceecccccc
Q psy691           57 NTRFACHLCSK   67 (134)
Q Consensus        57 ~~~~~C~~C~~   67 (134)
                      ...|.|+.||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            34588888874


No 132
>KOG3408|consensus
Probab=53.42  E-value=9.5  Score=23.25  Aligned_cols=26  Identities=31%  Similarity=0.538  Sum_probs=22.4

Q ss_pred             CCCceecccccccccChhhHHHHHhH
Q psy691           84 DVKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        84 ~~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      |.-.|-|..|.+-|.....|..|.++
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhc
Confidence            34458999999999999999999775


No 133
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=51.26  E-value=7.6  Score=18.74  Aligned_cols=29  Identities=21%  Similarity=0.589  Sum_probs=16.9

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      |.|..||..|.....      ... .....|+.|+.
T Consensus         6 y~C~~Cg~~fe~~~~------~~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS------ISE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEE------cCC-CCCCcCCCCCC
Confidence            677778777763322      122 34567777765


No 134
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=50.25  E-value=4.8  Score=23.63  Aligned_cols=40  Identities=18%  Similarity=0.370  Sum_probs=24.1

Q ss_pred             CCCceeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      -.+.|.|+.|+..-.....++    .-.+.--..|..||.+|.-
T Consensus        19 L~k~FtCp~Cghe~vs~ctvk----k~~~~g~~~Cg~CGls~e~   58 (104)
T COG4888          19 LPKTFTCPRCGHEKVSSCTVK----KTVNIGTAVCGNCGLSFEC   58 (104)
T ss_pred             CCceEecCccCCeeeeEEEEE----ecCceeEEEcccCcceEEE
Confidence            456799999997655433322    1111223578888877753


No 135
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=48.74  E-value=8.1  Score=23.18  Aligned_cols=25  Identities=20%  Similarity=0.525  Sum_probs=16.4

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      .+.|..|+..|....            ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC------------cCccCcCCCC
Confidence            478888887776432            2356888874


No 136
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=48.66  E-value=18  Score=25.64  Aligned_cols=22  Identities=32%  Similarity=0.631  Sum_probs=11.1

Q ss_pred             ceecccccccccChhhHHHHHh
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTR  108 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~  108 (134)
                      -|.|+.|-+-|.....|.+|+.
T Consensus        48 lyiCe~Clky~~~~~~l~~H~~   69 (290)
T PLN03238         48 LYICEYCLKYMRKKKSLLRHLA   69 (290)
T ss_pred             EEEcCCCcchhCCHHHHHHHHH
Confidence            3455555555555555555544


No 137
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.62  E-value=13  Score=19.82  Aligned_cols=14  Identities=21%  Similarity=0.655  Sum_probs=8.0

Q ss_pred             CCceeccccccccc
Q psy691           85 VKRYLCTFCGKGFN   98 (134)
Q Consensus        85 ~k~~~C~~C~~~f~   98 (134)
                      .+-|.|+.||..+.
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            34566666665543


No 138
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=48.56  E-value=23  Score=24.73  Aligned_cols=75  Identities=15%  Similarity=0.211  Sum_probs=41.5

Q ss_pred             CCCceeccccccccCChHHHHHHHHH--cCCCCceecccccccccChhhHH-------HHHhH----hcCCCccccccCC
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKC--HSDVKRYLCTFCGKGFNDTFDLK-------RHTRT----HTGKEEEEEEDGK  122 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~--h~~~k~~~C~~C~~~f~~~~~l~-------~H~~~----h~~~~~~~c~~~~  122 (134)
                      +-+.|.|.+|..-.--.. --.|+.+  -.....|+|..|++. .+-+-|+       .|.+.    ....+++.|+.|+
T Consensus       139 GGrif~CsfC~~flCEDD-QFEHQAsCQvLe~E~~KC~SCNrl-Gq~sCLRCK~cfCddHvrrKg~ky~k~k~~PCPKCg  216 (314)
T PF06524_consen  139 GGRIFKCSFCDNFLCEDD-QFEHQASCQVLESETFKCQSCNRL-GQYSCLRCKICFCDDHVRRKGFKYEKGKPIPCPKCG  216 (314)
T ss_pred             CCeEEEeecCCCeeeccc-hhhhhhhhhhhhcccccccccccc-cchhhhheeeeehhhhhhhcccccccCCCCCCCCCC
Confidence            456799999886544333 3345543  223345777777652 2222222       34332    3344788898888


Q ss_pred             CcccCcccee
Q psy691          123 TNVLTTEYLV  132 (134)
Q Consensus       123 ~~~~~~~~l~  132 (134)
                      .-..-...|+
T Consensus       217 ~et~eTkdLS  226 (314)
T PF06524_consen  217 YETQETKDLS  226 (314)
T ss_pred             Ccccccccce
Confidence            7666555554


No 139
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=48.30  E-value=12  Score=19.04  Aligned_cols=14  Identities=14%  Similarity=0.603  Sum_probs=10.3

Q ss_pred             ceeccccccccCCh
Q psy691           59 RFACHLCSKSFSLQ   72 (134)
Q Consensus        59 ~~~C~~C~~~f~~~   72 (134)
                      -+.|..|+..|...
T Consensus        28 ~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   28 WWKCPKCGHEWKAS   41 (55)
T ss_pred             EEECCCCCCeeEcc
Confidence            37888888777654


No 140
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=48.29  E-value=7.7  Score=23.35  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=16.7

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      ...|..|+..|.....            .+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~~------------~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEID------------LYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCc------------CccCcCCcC
Confidence            4788888877764321            356888874


No 141
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=47.36  E-value=9.7  Score=18.13  Aligned_cols=14  Identities=29%  Similarity=0.783  Sum_probs=11.7

Q ss_pred             ceecccccccccCh
Q psy691           87 RYLCTFCGKGFNDT  100 (134)
Q Consensus        87 ~~~C~~C~~~f~~~  100 (134)
                      ||.|..|++.|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            78899999888774


No 142
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=46.56  E-value=13  Score=18.82  Aligned_cols=27  Identities=37%  Similarity=0.819  Sum_probs=16.0

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      .|..|++.|..            ..+.+.|..||+.|-.
T Consensus         4 ~C~~C~~~F~~------------~~rk~~Cr~Cg~~~C~   30 (57)
T cd00065           4 SCMGCGKPFTL------------TRRRHHCRNCGRIFCS   30 (57)
T ss_pred             cCcccCccccC------------CccccccCcCcCCcCh
Confidence            46677777763            1234566666666554


No 143
>COG1773 Rubredoxin [Energy production and conversion]
Probab=46.48  E-value=9.9  Score=19.75  Aligned_cols=13  Identities=23%  Similarity=0.843  Sum_probs=9.2

Q ss_pred             ceeccccccccCC
Q psy691           59 RFACHLCSKSFSL   71 (134)
Q Consensus        59 ~~~C~~C~~~f~~   71 (134)
                      .|+|..||..|.-
T Consensus         3 ~~~C~~CG~vYd~   15 (55)
T COG1773           3 RWRCSVCGYVYDP   15 (55)
T ss_pred             ceEecCCceEecc
Confidence            4778888877653


No 144
>PF12907 zf-met2:  Zinc-binding
Probab=46.31  E-value=14  Score=17.85  Aligned_cols=20  Identities=25%  Similarity=0.747  Sum_probs=8.5

Q ss_pred             ecccccccc---CChHHHHHHHH
Q psy691           61 ACHLCSKSF---SLQRLLNRHMK   80 (134)
Q Consensus        61 ~C~~C~~~f---~~~~~l~~H~~   80 (134)
                      .|.+|-.+|   .+...|..|..
T Consensus         3 ~C~iC~qtF~~t~~~~~L~eH~e   25 (40)
T PF12907_consen    3 ICKICRQTFMQTTNEPQLKEHAE   25 (40)
T ss_pred             CcHHhhHHHHhcCCHHHHHHHHH
Confidence            455555332   22344555544


No 145
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=46.04  E-value=8.2  Score=18.70  Aligned_cols=15  Identities=33%  Similarity=0.767  Sum_probs=9.7

Q ss_pred             CceecccccccccCh
Q psy691           86 KRYLCTFCGKGFNDT  100 (134)
Q Consensus        86 k~~~C~~C~~~f~~~  100 (134)
                      .|+.|..|++.|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            478999999988874


No 146
>KOG2231|consensus
Probab=45.78  E-value=15  Score=29.20  Aligned_cols=23  Identities=35%  Similarity=0.834  Sum_probs=16.3

Q ss_pred             eecccccccc---------------CChHHHHHHHHH-c
Q psy691           60 FACHLCSKSF---------------SLQRLLNRHMKC-H   82 (134)
Q Consensus        60 ~~C~~C~~~f---------------~~~~~l~~H~~~-h   82 (134)
                      +.|.+|.+.|               .....|+.|+.. |
T Consensus       100 ~~C~~C~~~~~~~~~~~~~~~c~~~~s~~~Lk~H~~~~H  138 (669)
T KOG2231|consen  100 HSCHICDRRFRALYNKKECLHCTEFKSVENLKNHMRDQH  138 (669)
T ss_pred             hhcCccccchhhhcccCCCccccchhHHHHHHHHHHHhh
Confidence            5677777666               267888999854 5


No 147
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.62  E-value=5.6  Score=24.38  Aligned_cols=41  Identities=22%  Similarity=0.354  Sum_probs=21.2

Q ss_pred             eeccccccccCChHHHHHHHHH-cCCCCceecccccccccCh
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC-HSDVKRYLCTFCGKGFNDT  100 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~-h~~~k~~~C~~C~~~f~~~  100 (134)
                      ..|++|.....-......-+.. |.-+.|--|..||+.|.+.
T Consensus        40 ~qcp~csasirgd~~vegvlglg~dye~psfchncgs~fpwt   81 (160)
T COG4306          40 TQCPICSASIRGDYYVEGVLGLGGDYEPPSFCHNCGSRFPWT   81 (160)
T ss_pred             hcCCccCCcccccceeeeeeccCCCCCCcchhhcCCCCCCcH
Confidence            4566666554433222221111 3335566777788777763


No 148
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=45.42  E-value=7.5  Score=22.41  Aligned_cols=7  Identities=71%  Similarity=2.209  Sum_probs=3.5

Q ss_pred             eeccccc
Q psy691           88 YLCTFCG   94 (134)
Q Consensus        88 ~~C~~C~   94 (134)
                      |.|++|+
T Consensus        37 y~CpfCg   43 (90)
T PTZ00255         37 YFCPFCG   43 (90)
T ss_pred             ccCCCCC
Confidence            4555554


No 149
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=45.27  E-value=20  Score=17.55  Aligned_cols=8  Identities=38%  Similarity=1.522  Sum_probs=4.5

Q ss_pred             eecccccc
Q psy691           88 YLCTFCGK   95 (134)
Q Consensus        88 ~~C~~C~~   95 (134)
                      +.|+.|+.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            45666653


No 150
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=45.01  E-value=7.1  Score=21.70  Aligned_cols=33  Identities=24%  Similarity=0.614  Sum_probs=20.3

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceeccccccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      .|.|..|+..|.    +..||.   ...--.|+.|+-.+.
T Consensus        12 ~Y~c~~cg~~~d----vvq~~~---ddplt~ce~c~a~~k   44 (82)
T COG2331          12 SYECTECGNRFD----VVQAMT---DDPLTTCEECGARLK   44 (82)
T ss_pred             EEeecccchHHH----HHHhcc---cCccccChhhChHHH
Confidence            489999987753    444443   223347888876543


No 151
>KOG2636|consensus
Probab=44.77  E-value=17  Score=27.35  Aligned_cols=27  Identities=30%  Similarity=0.554  Sum_probs=18.1

Q ss_pred             HHcCCCCceeccccc-ccccChhhHHHH
Q psy691           80 KCHSDVKRYLCTFCG-KGFNDTFDLKRH  106 (134)
Q Consensus        80 ~~h~~~k~~~C~~C~-~~f~~~~~l~~H  106 (134)
                      +.|--.+-|.|.+|| ..+..+..+.+|
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RH  421 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRH  421 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHH
Confidence            345556667777777 666677777777


No 152
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=44.48  E-value=21  Score=16.39  Aligned_cols=22  Identities=14%  Similarity=0.415  Sum_probs=14.3

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      .+.|+.|++.+. ...+..|+..
T Consensus         4 ~~~C~nC~R~v~-a~RfA~HLek   25 (33)
T PF08209_consen    4 YVECPNCGRPVA-ASRFAPHLEK   25 (33)
T ss_dssp             EEE-TTTSSEEE-GGGHHHHHHH
T ss_pred             eEECCCCcCCcc-hhhhHHHHHH
Confidence            478888888765 4556667654


No 153
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=44.32  E-value=7.1  Score=19.83  Aligned_cols=14  Identities=36%  Similarity=1.065  Sum_probs=10.4

Q ss_pred             ceeccccccccCCh
Q psy691           59 RFACHLCSKSFSLQ   72 (134)
Q Consensus        59 ~~~C~~C~~~f~~~   72 (134)
                      .|.|+.|...+..+
T Consensus         7 ry~CDLCn~~~p~~   20 (57)
T PF14445_consen    7 RYSCDLCNSSHPIS   20 (57)
T ss_pred             hHhHHhhcccCcHH
Confidence            47888888887643


No 154
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=44.13  E-value=13  Score=19.68  Aligned_cols=40  Identities=15%  Similarity=0.412  Sum_probs=21.9

Q ss_pred             eeccccccccC-ChHHHHHHHHHcCCCCceecccccccccC
Q psy691           60 FACHLCSKSFS-LQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        60 ~~C~~C~~~f~-~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      -.|.+|.+.-. ....+..-.......+-|.|+.|..+...
T Consensus         3 vkCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva~   43 (68)
T COG4896           3 VKCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVAI   43 (68)
T ss_pred             ceEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhch
Confidence            36778876533 23334333333334456889988755443


No 155
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=44.08  E-value=9.4  Score=23.07  Aligned_cols=13  Identities=31%  Similarity=0.733  Sum_probs=9.7

Q ss_pred             ceeccccccccCC
Q psy691           59 RFACHLCSKSFSL   71 (134)
Q Consensus        59 ~~~C~~C~~~f~~   71 (134)
                      .+.|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            4788888877764


No 156
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=43.83  E-value=7  Score=24.51  Aligned_cols=31  Identities=29%  Similarity=0.742  Sum_probs=15.6

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGF   97 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f   97 (134)
                      .|.|..|+..+.+...      .  ....|.|..|+..+
T Consensus       123 ~~~C~~C~~~~~r~~~------~--~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  123 VYRCPSCGREYKRHRR------S--KRKRYRCGRCGGPL  153 (157)
T ss_pred             EEEcCCCCCEeeeecc------c--chhhEECCCCCCEE
Confidence            4667667666533222      1  12236666666444


No 157
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=43.46  E-value=9.6  Score=22.83  Aligned_cols=15  Identities=27%  Similarity=0.640  Sum_probs=9.4

Q ss_pred             ceeccccccccCChH
Q psy691           59 RFACHLCSKSFSLQR   73 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~   73 (134)
                      .+.|..|+..|....
T Consensus        70 ~~~C~~Cg~~~~~~~   84 (113)
T PF01155_consen   70 RARCRDCGHEFEPDE   84 (113)
T ss_dssp             EEEETTTS-EEECHH
T ss_pred             cEECCCCCCEEecCC
Confidence            367878887776543


No 158
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=42.69  E-value=8.2  Score=26.14  Aligned_cols=30  Identities=13%  Similarity=0.296  Sum_probs=0.0

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCce
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRY   88 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~   88 (134)
                      ....|++||+... ...|..|||+..-...|
T Consensus       167 ~~~~cPitGe~IP-~~e~~eHmRi~LlDP~w  196 (229)
T PF12230_consen  167 KMIICPITGEMIP-ADEMDEHMRIELLDPRW  196 (229)
T ss_dssp             -------------------------------
T ss_pred             ccccccccccccc-ccccccccccccccccc
Confidence            3467888887766 45677777776554433


No 160
>KOG1280|consensus
Probab=42.33  E-value=29  Score=25.30  Aligned_cols=37  Identities=22%  Similarity=0.594  Sum_probs=25.9

Q ss_pred             CceeccccccccCChHHHHHHHHH-cCCCCc-eeccccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKC-HSDVKR-YLCTFCG   94 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~-h~~~k~-~~C~~C~   94 (134)
                      ..|.|++|++.=.....|..|... |....+ ..|.+|.
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            379999999877778888899876 554331 3455554


No 161
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=42.29  E-value=14  Score=19.30  Aligned_cols=37  Identities=19%  Similarity=0.492  Sum_probs=19.8

Q ss_pred             eeccccccccCChHHHHHHHHH-cCCCCceeccccccc
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC-HSDVKRYLCTFCGKG   96 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~-h~~~k~~~C~~C~~~   96 (134)
                      -.|.+|++.+.....-..-.+. -.....|.|..|...
T Consensus         3 vkC~lCdk~~~Id~~~~~aKrLrnrPi~tYmC~eC~~R   40 (56)
T PF09963_consen    3 VKCILCDKKEEIDEDTPEAKRLRNRPIHTYMCDECKER   40 (56)
T ss_pred             eEEEecCCEEEeccCCHHHHHhhcCCCcceeChhHHHH
Confidence            3677888777643322222222 223445888888643


No 162
>KOG0978|consensus
Probab=41.94  E-value=8.8  Score=30.51  Aligned_cols=13  Identities=15%  Similarity=0.728  Sum_probs=9.1

Q ss_pred             CceeccccccccC
Q psy691           58 TRFACHLCSKSFS   70 (134)
Q Consensus        58 ~~~~C~~C~~~f~   70 (134)
                      ....|+.|...++
T Consensus       642 ~~LkCs~Cn~R~K  654 (698)
T KOG0978|consen  642 ELLKCSVCNTRWK  654 (698)
T ss_pred             hceeCCCccCchh
Confidence            4578999885554


No 163
>KOG4602|consensus
Probab=41.66  E-value=42  Score=23.44  Aligned_cols=45  Identities=18%  Similarity=0.453  Sum_probs=25.7

Q ss_pred             CCCCceeccccccccCChHHHHHHHHHcCC-------CCceecccccccccC
Q psy691           55 KDNTRFACHLCSKSFSLQRLLNRHMKCHSD-------VKRYLCTFCGKGFND   99 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------~k~~~C~~C~~~f~~   99 (134)
                      ...++..|.+|...-.....+..|......       -+.|.|++||..-.+
T Consensus       229 ~Q~r~l~CvFC~nN~E~~A~y~tH~lkd~dgRVLCPkLR~YVCPiCGATgDn  280 (318)
T KOG4602|consen  229 NQPRPLCCVFCFNNAEEFARYHTHPLKDKDGRVLCPKLRSYVCPICGATGDN  280 (318)
T ss_pred             CCCCceeEEeecCCCchhhheecccccCCCCcEechhHhhhcCccccccCCc
Confidence            344556888886554444444444332221       246999999876544


No 164
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=41.37  E-value=8.3  Score=22.27  Aligned_cols=7  Identities=71%  Similarity=2.199  Sum_probs=3.3

Q ss_pred             eeccccc
Q psy691           88 YLCTFCG   94 (134)
Q Consensus        88 ~~C~~C~   94 (134)
                      |.|++|+
T Consensus        36 y~CpfCg   42 (91)
T TIGR00280        36 YVCPFCG   42 (91)
T ss_pred             ccCCCCC
Confidence            4444444


No 165
>KOG2636|consensus
Probab=40.88  E-value=42  Score=25.40  Aligned_cols=27  Identities=15%  Similarity=0.580  Sum_probs=22.1

Q ss_pred             CCCCCceeccccc-cccCChHHHHHHHH
Q psy691           54 RKDNTRFACHLCS-KSFSLQRLLNRHMK   80 (134)
Q Consensus        54 ~~~~~~~~C~~C~-~~f~~~~~l~~H~~   80 (134)
                      +.-+.-|.|.+|| +++.-...+.+|..
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhH
Confidence            3445679999999 88888899999975


No 166
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=40.70  E-value=11  Score=19.13  Aligned_cols=12  Identities=25%  Similarity=0.869  Sum_probs=6.4

Q ss_pred             eccccccccCCh
Q psy691           61 ACHLCSKSFSLQ   72 (134)
Q Consensus        61 ~C~~C~~~f~~~   72 (134)
                      .|++|++.|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            899999998753


No 167
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=40.35  E-value=12  Score=16.83  Aligned_cols=8  Identities=38%  Similarity=1.057  Sum_probs=4.1

Q ss_pred             ceeccccc
Q psy691           87 RYLCTFCG   94 (134)
Q Consensus        87 ~~~C~~C~   94 (134)
                      .+.|+.|+
T Consensus        19 ~~vCp~C~   26 (30)
T PF08274_consen   19 LLVCPECG   26 (30)
T ss_dssp             SEEETTTT
T ss_pred             EEeCCccc
Confidence            35555554


No 168
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=40.16  E-value=21  Score=26.97  Aligned_cols=25  Identities=36%  Similarity=0.679  Sum_probs=21.6

Q ss_pred             CCceecccccccccChhhHHHHHhH
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      ..-|.|++|-+-|.....|.+|+..
T Consensus       196 ~~lyiCe~Cl~y~~~~~~~~~H~~~  220 (450)
T PLN00104        196 SKLYFCEFCLKFMKRKEQLQRHMKK  220 (450)
T ss_pred             CeEEEchhhhhhhcCHHHHHHHHhc
Confidence            3468999999999999999999864


No 169
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=40.14  E-value=46  Score=24.43  Aligned_cols=26  Identities=19%  Similarity=0.551  Sum_probs=17.9

Q ss_pred             CCCCceeccccc-cccCChHHHHHHHH
Q psy691           55 KDNTRFACHLCS-KSFSLQRLLNRHMK   80 (134)
Q Consensus        55 ~~~~~~~C~~C~-~~f~~~~~l~~H~~   80 (134)
                      .-..-|.|.+|| +.+.-...+.+|..
T Consensus       370 gLd~ef~CEICgNyvy~GR~~FdrHF~  396 (470)
T COG5188         370 GLDIEFECEICGNYVYYGRDRFDRHFE  396 (470)
T ss_pred             CCCcceeeeecccccccchHHHHhhhh
Confidence            344568888888 66666677777754


No 170
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=39.76  E-value=19  Score=17.32  Aligned_cols=12  Identities=17%  Similarity=0.708  Sum_probs=9.3

Q ss_pred             Cceecccccccc
Q psy691           58 TRFACHLCSKSF   69 (134)
Q Consensus        58 ~~~~C~~C~~~f   69 (134)
                      +.-.|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            357899998876


No 171
>KOG0717|consensus
Probab=38.74  E-value=23  Score=26.87  Aligned_cols=22  Identities=32%  Similarity=0.708  Sum_probs=20.1

Q ss_pred             eeccccccccCChHHHHHHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      +.|.+|.+.|.+...|..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            8999999999999999999765


No 172
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=38.26  E-value=15  Score=18.33  Aligned_cols=12  Identities=17%  Similarity=0.811  Sum_probs=7.6

Q ss_pred             eeccccccccCC
Q psy691           60 FACHLCSKSFSL   71 (134)
Q Consensus        60 ~~C~~C~~~f~~   71 (134)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            567777766543


No 173
>PTZ00064 histone acetyltransferase; Provisional
Probab=38.06  E-value=26  Score=26.92  Aligned_cols=25  Identities=24%  Similarity=0.313  Sum_probs=21.6

Q ss_pred             CCceecccccccccChhhHHHHHhH
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      ..-|.|++|-+-|.....|.+|+..
T Consensus       278 d~LYICEfCLkY~~s~~~l~rH~~~  302 (552)
T PTZ00064        278 DTLHFCEYCLDFFCFEDELIRHLSR  302 (552)
T ss_pred             CeEEEccchhhhhCCHHHHHHHHhc
Confidence            3568999999999999999999774


No 174
>KOG0717|consensus
Probab=37.94  E-value=21  Score=27.10  Aligned_cols=22  Identities=32%  Similarity=0.729  Sum_probs=19.9

Q ss_pred             eecccccccccChhhHHHHHhH
Q psy691           88 YLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        88 ~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      +-|.+|.|.|.+...|..|...
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999665


No 175
>KOG4727|consensus
Probab=37.78  E-value=33  Score=22.33  Aligned_cols=27  Identities=15%  Similarity=0.349  Sum_probs=21.7

Q ss_pred             CCCCCceeccccccccCChHHHHHHHH
Q psy691           54 RKDNTRFACHLCSKSFSLQRLLNRHMK   80 (134)
Q Consensus        54 ~~~~~~~~C~~C~~~f~~~~~l~~H~~   80 (134)
                      .....-|-|.+|.-++...-++..|+.
T Consensus        70 ~sq~~GyyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   70 RSQKGGYYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             ccccCceeeeecceeehhhHHHHHHhc
Confidence            344556999999999999888888875


No 176
>KOG2923|consensus
Probab=37.69  E-value=7.8  Score=20.73  Aligned_cols=16  Identities=25%  Similarity=0.027  Sum_probs=12.2

Q ss_pred             cccccCCCcccCccce
Q psy691          116 EEEEDGKTNVLTTEYL  131 (134)
Q Consensus       116 ~~c~~~~~~~~~~~~l  131 (134)
                      |.|+||..+-++.+.|
T Consensus        23 yPCpCGDrf~It~edL   38 (67)
T KOG2923|consen   23 YPCPCGDRFQITLEDL   38 (67)
T ss_pred             cCCCCCCeeeecHHHH
Confidence            6788888887777655


No 177
>PTZ00448 hypothetical protein; Provisional
Probab=37.43  E-value=27  Score=25.61  Aligned_cols=23  Identities=13%  Similarity=0.427  Sum_probs=20.1

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      .|.|..|+-.|......+.|+++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888886


No 178
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=37.25  E-value=6.1  Score=31.63  Aligned_cols=11  Identities=18%  Similarity=0.449  Sum_probs=7.1

Q ss_pred             eeccccccccC
Q psy691           60 FACHLCSKSFS   70 (134)
Q Consensus        60 ~~C~~C~~~f~   70 (134)
                      ..|..||..+.
T Consensus       436 l~C~~Cg~v~~  446 (730)
T COG1198         436 LLCRDCGYIAE  446 (730)
T ss_pred             eecccCCCccc
Confidence            45777776654


No 179
>PLN02748 tRNA dimethylallyltransferase
Probab=37.13  E-value=29  Score=26.43  Aligned_cols=25  Identities=16%  Similarity=0.385  Sum_probs=19.8

Q ss_pred             CCceecccccc-ccCChHHHHHHHHH
Q psy691           57 NTRFACHLCSK-SFSLQRLLNRHMKC   81 (134)
Q Consensus        57 ~~~~~C~~C~~-~f~~~~~l~~H~~~   81 (134)
                      -+.|.|.+|++ .+.....+..|++.
T Consensus       416 ~~~~~Ce~C~~~~~~G~~eW~~Hlks  441 (468)
T PLN02748        416 WTQYVCEACGNKVLRGAHEWEQHKQG  441 (468)
T ss_pred             cccccccCCCCcccCCHHHHHHHhcc
Confidence            45688999997 78888888888764


No 180
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=37.11  E-value=18  Score=21.20  Aligned_cols=24  Identities=25%  Similarity=0.271  Sum_probs=17.8

Q ss_pred             HHHHHHcCCCCceecccccccccCh
Q psy691           76 NRHMKCHSDVKRYLCTFCGKGFNDT  100 (134)
Q Consensus        76 ~~H~~~h~~~k~~~C~~C~~~f~~~  100 (134)
                      ..++..+.+ ++++|..||.-|...
T Consensus        69 v~W~~l~~g-~~~rC~eCG~~fkL~   92 (97)
T cd00924          69 VIWMWLEKG-KPKRCPECGHVFKLV   92 (97)
T ss_pred             EEEEEEeCC-CceeCCCCCcEEEEE
Confidence            344566776 799999999888653


No 181
>PRK04351 hypothetical protein; Provisional
Probab=36.51  E-value=18  Score=22.92  Aligned_cols=9  Identities=44%  Similarity=0.992  Sum_probs=4.0

Q ss_pred             ceecccccc
Q psy691           87 RYLCTFCGK   95 (134)
Q Consensus        87 ~~~C~~C~~   95 (134)
                      .|.|..|+.
T Consensus       132 ~yrCg~C~g  140 (149)
T PRK04351        132 RYRCGKCRG  140 (149)
T ss_pred             cEEeCCCCc
Confidence            344444443


No 182
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=36.36  E-value=5.2  Score=20.43  Aligned_cols=26  Identities=23%  Similarity=0.534  Sum_probs=13.2

Q ss_pred             CCceeccccccccCChHHHHHHHHHc
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCH   82 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h   82 (134)
                      ...|.|+.|...|-..-.+-.|...|
T Consensus        19 ~~~y~C~~C~~~FC~dCD~fiHE~LH   44 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVFIHETLH   44 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHTTTTTS-
T ss_pred             CCeEECCCCCCccccCcChhhhcccc
Confidence            45799999999998766665554333


No 183
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=36.22  E-value=12  Score=18.76  Aligned_cols=12  Identities=25%  Similarity=0.794  Sum_probs=6.8

Q ss_pred             ecccccccccCh
Q psy691           89 LCTFCGKGFNDT  100 (134)
Q Consensus        89 ~C~~C~~~f~~~  100 (134)
                      .|+.|++.|..+
T Consensus        14 ICpvCqRPFsWR   25 (54)
T COG4338          14 ICPVCQRPFSWR   25 (54)
T ss_pred             hhhhhcCchHHH
Confidence            456666665554


No 184
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=36.09  E-value=24  Score=17.24  Aligned_cols=15  Identities=20%  Similarity=0.791  Sum_probs=11.5

Q ss_pred             eccccccccCChHHH
Q psy691           61 ACHLCSKSFSLQRLL   75 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l   75 (134)
                      .|..|++.|+...-.
T Consensus        10 ~C~~C~rpf~WRKKW   24 (42)
T PF10013_consen   10 ICPVCGRPFTWRKKW   24 (42)
T ss_pred             cCcccCCcchHHHHH
Confidence            688999999865544


No 185
>PLN02294 cytochrome c oxidase subunit Vb
Probab=35.74  E-value=19  Score=23.39  Aligned_cols=13  Identities=31%  Similarity=0.996  Sum_probs=8.1

Q ss_pred             CceeccccccccC
Q psy691           58 TRFACHLCSKSFS   70 (134)
Q Consensus        58 ~~~~C~~C~~~f~   70 (134)
                      ++..|++||..|+
T Consensus       140 kp~RCpeCG~~fk  152 (174)
T PLN02294        140 KSFECPVCTQYFE  152 (174)
T ss_pred             CceeCCCCCCEEE
Confidence            4566666666665


No 186
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=35.12  E-value=17  Score=18.46  Aligned_cols=12  Identities=17%  Similarity=0.869  Sum_probs=8.8

Q ss_pred             eeccccccccCC
Q psy691           60 FACHLCSKSFSL   71 (134)
Q Consensus        60 ~~C~~C~~~f~~   71 (134)
                      |.|..||..+..
T Consensus         2 y~C~~CgyiYd~   13 (50)
T cd00730           2 YECRICGYIYDP   13 (50)
T ss_pred             cCCCCCCeEECC
Confidence            678888877764


No 187
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=34.98  E-value=12  Score=22.42  Aligned_cols=26  Identities=19%  Similarity=0.447  Sum_probs=16.0

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      .+.|..|+..|.....           ..+.|+.|+.
T Consensus        70 ~~~C~~Cg~~~~~~~~-----------~~~~CP~Cgs   95 (114)
T PRK03681         70 ECWCETCQQYVTLLTQ-----------RVRRCPQCHG   95 (114)
T ss_pred             EEEcccCCCeeecCCc-----------cCCcCcCcCC
Confidence            4788888876653211           1156888874


No 188
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=34.88  E-value=30  Score=26.35  Aligned_cols=27  Identities=26%  Similarity=0.583  Sum_probs=22.8

Q ss_pred             CceecccccccccChhhHHHHHhH-hcC
Q psy691           86 KRYLCTFCGKGFNDTFDLKRHTRT-HTG  112 (134)
Q Consensus        86 k~~~C~~C~~~f~~~~~l~~H~~~-h~~  112 (134)
                      +=+.|+.|.+.|.....+..|+.. |.+
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            346899999999999999999885 655


No 189
>KOG2071|consensus
Probab=34.38  E-value=28  Score=27.12  Aligned_cols=27  Identities=22%  Similarity=0.470  Sum_probs=21.7

Q ss_pred             CCceeccccccccCChHHHHHHHHHcC
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHS   83 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~   83 (134)
                      +.+..|..||..|........||..|.
T Consensus       416 ~~pnqC~~CG~R~~~~ee~sk~md~H~  442 (579)
T KOG2071|consen  416 DSPNQCKSCGLRFDDSEERSKHMDIHD  442 (579)
T ss_pred             CCcchhcccccccccchhhhhHhhhhh
Confidence            456789999999998877777777664


No 190
>KOG2747|consensus
Probab=34.29  E-value=26  Score=25.96  Aligned_cols=26  Identities=35%  Similarity=0.651  Sum_probs=22.0

Q ss_pred             CCceecccccccccChhhHHHHHhHh
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      ..-|.|++|-+-+.....|.+|+...
T Consensus       156 ~~lYiCEfCLkY~~s~~~l~rH~~kC  181 (396)
T KOG2747|consen  156 DKLYICEFCLKYMKSRTSLQRHLKKC  181 (396)
T ss_pred             CeEEEehHHHhHhchHHHHHHHHHhc
Confidence            35689999999999999999998764


No 191
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=34.13  E-value=7  Score=18.36  Aligned_cols=7  Identities=43%  Similarity=0.899  Sum_probs=2.8

Q ss_pred             Cceeccc
Q psy691           86 KRYLCTF   92 (134)
Q Consensus        86 k~~~C~~   92 (134)
                      ..|.|..
T Consensus        28 qryrC~~   34 (36)
T PF03811_consen   28 QRYRCKD   34 (36)
T ss_pred             EeEecCc
Confidence            3344433


No 192
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=34.10  E-value=7.8  Score=26.44  Aligned_cols=26  Identities=12%  Similarity=0.443  Sum_probs=18.4

Q ss_pred             CCceeccccccccCChHHHHHHHHHc
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCH   82 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h   82 (134)
                      ++...|++|+-.|.....+..-.|+-
T Consensus        17 kk~ieCPvC~tkFkkeev~tgsiRii   42 (267)
T COG1655          17 KKTIECPVCNTKFKKEEVKTGSIRII   42 (267)
T ss_pred             hceeccCcccchhhhhheeccceeEe
Confidence            45689999999998766555444443


No 193
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=34.06  E-value=11  Score=21.70  Aligned_cols=7  Identities=43%  Similarity=1.397  Sum_probs=3.5

Q ss_pred             eeccccc
Q psy691           88 YLCTFCG   94 (134)
Q Consensus        88 ~~C~~C~   94 (134)
                      |.|++|+
T Consensus        37 y~CpfCg   43 (90)
T PRK03976         37 HVCPVCG   43 (90)
T ss_pred             ccCCCCC
Confidence            4555554


No 194
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=33.86  E-value=32  Score=16.25  Aligned_cols=11  Identities=45%  Similarity=1.231  Sum_probs=3.6

Q ss_pred             ceecccccccc
Q psy691           87 RYLCTFCGKGF   97 (134)
Q Consensus        87 ~~~C~~C~~~f   97 (134)
                      .|-|+.|...|
T Consensus         3 ryyCdyC~~~~   13 (38)
T PF06220_consen    3 RYYCDYCKKYL   13 (38)
T ss_dssp             S-B-TTT--B-
T ss_pred             Ceeccccccee
Confidence            35666666655


No 195
>PRK05978 hypothetical protein; Provisional
Probab=33.38  E-value=19  Score=22.89  Aligned_cols=32  Identities=22%  Similarity=0.529  Sum_probs=20.6

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccCh
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDT  100 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~  100 (134)
                      .+|+.|++.--.+..|+         -.-.|..|+..|...
T Consensus        34 grCP~CG~G~LF~g~Lk---------v~~~C~~CG~~~~~~   65 (148)
T PRK05978         34 GRCPACGEGKLFRAFLK---------PVDHCAACGEDFTHH   65 (148)
T ss_pred             CcCCCCCCCcccccccc---------cCCCccccCCccccC
Confidence            57999987744333332         234799998877653


No 196
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=33.23  E-value=18  Score=22.43  Aligned_cols=15  Identities=40%  Similarity=0.716  Sum_probs=11.1

Q ss_pred             ceecccccccccChh
Q psy691           87 RYLCTFCGKGFNDTF  101 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~  101 (134)
                      |++|..|++.|..-+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            567888888887644


No 197
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=32.88  E-value=14  Score=24.52  Aligned_cols=9  Identities=22%  Similarity=1.202  Sum_probs=0.0

Q ss_pred             ceecccccc
Q psy691           59 RFACHLCSK   67 (134)
Q Consensus        59 ~~~C~~C~~   67 (134)
                      .|.|.+||.
T Consensus       101 ey~CEICGN  109 (196)
T PF11931_consen  101 EYKCEICGN  109 (196)
T ss_dssp             ---------
T ss_pred             eeeeEeCCC
Confidence            355666653


No 198
>KOG2807|consensus
Probab=32.29  E-value=73  Score=23.19  Aligned_cols=20  Identities=25%  Similarity=0.516  Sum_probs=15.2

Q ss_pred             ceeccccccccCChHHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNRH   78 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H   78 (134)
                      |-.|++|+-+.....+|.+-
T Consensus       290 P~eCpiC~ltLVss~hLARS  309 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLARS  309 (378)
T ss_pred             CccCCccceeEecchHHHHH
Confidence            45788888888888888754


No 199
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=31.57  E-value=14  Score=23.51  Aligned_cols=16  Identities=31%  Similarity=0.600  Sum_probs=11.4

Q ss_pred             CceecccccccccChh
Q psy691           86 KRYLCTFCGKGFNDTF  101 (134)
Q Consensus        86 k~~~C~~C~~~f~~~~  101 (134)
                      +.-.|..|++.|.+..
T Consensus        27 RRReC~~C~~RFTTfE   42 (156)
T COG1327          27 RRRECLECGERFTTFE   42 (156)
T ss_pred             hhhcccccccccchhh
Confidence            3457888888887743


No 200
>PLN03239 histone acetyltransferase; Provisional
Probab=30.81  E-value=33  Score=25.07  Aligned_cols=25  Identities=24%  Similarity=0.297  Sum_probs=21.5

Q ss_pred             CCceecccccccccChhhHHHHHhH
Q psy691           85 VKRYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      ..-|.|++|-+-|.....|.+|+..
T Consensus       104 ~~lYiCE~Clky~~~~~~l~~H~~~  128 (351)
T PLN03239        104 DVLYVCEFSFGFFARKSELLRFQAK  128 (351)
T ss_pred             ceEEEeccchhhhcCHHHHHHHHHh
Confidence            4579999999999999999999753


No 201
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=30.73  E-value=27  Score=21.52  Aligned_cols=16  Identities=25%  Similarity=0.960  Sum_probs=12.9

Q ss_pred             CCceeccccccccCCh
Q psy691           57 NTRFACHLCSKSFSLQ   72 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~   72 (134)
                      ...|.|..|++.|...
T Consensus        51 ~qRyrC~~C~~tf~~~   66 (129)
T COG3677          51 HQRYKCKSCGSTFTVE   66 (129)
T ss_pred             ccccccCCcCcceeee
Confidence            5579999999998754


No 202
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=30.05  E-value=1.6e+02  Score=19.07  Aligned_cols=56  Identities=20%  Similarity=0.438  Sum_probs=34.2

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceeccc--ccccccChhhHHHHHhH-hcCCCc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTF--CGKGFNDTFDLKRHTRT-HTGKEE  115 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~--C~~~f~~~~~l~~H~~~-h~~~~~  115 (134)
                      ....|+.|.....-.... .--|.+.+.|+-.|..  |... .+-..|++|.+. |-.-+|
T Consensus        79 ~~L~CPLCRG~V~GWtvv-e~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen   79 PELACPLCRGEVKGWTVV-EPARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARP  137 (162)
T ss_pred             ccccCccccCceeceEEc-hHHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCC
Confidence            347899987544433222 2355666777766765  6543 345678899876 655555


No 203
>KOG1994|consensus
Probab=29.98  E-value=37  Score=23.24  Aligned_cols=22  Identities=18%  Similarity=0.545  Sum_probs=18.9

Q ss_pred             CCceeccccccccCChHHHHHH
Q psy691           57 NTRFACHLCSKSFSLQRLLNRH   78 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H   78 (134)
                      ..-|-|-+||-.|.+...|..|
T Consensus       237 ~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  237 SEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             ccceEEEEeccccCCHHHHHHh
Confidence            3459999999999999998877


No 204
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=29.97  E-value=24  Score=22.05  Aligned_cols=10  Identities=50%  Similarity=1.069  Sum_probs=4.7

Q ss_pred             ceeccccccc
Q psy691           87 RYLCTFCGKG   96 (134)
Q Consensus        87 ~~~C~~C~~~   96 (134)
                      .|.|..|+..
T Consensus       112 ~y~C~~C~~~  121 (146)
T smart00731      112 PYRCTGCGQR  121 (146)
T ss_pred             EEECCCCCCC
Confidence            3455545443


No 205
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=29.92  E-value=29  Score=25.99  Aligned_cols=29  Identities=21%  Similarity=0.550  Sum_probs=18.2

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCceecccccccccCh
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDT  100 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~  100 (134)
                      .|+.||....++           |..-|+|..|+..+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            677777665433           23367888887766554


No 206
>KOG1842|consensus
Probab=29.56  E-value=30  Score=26.11  Aligned_cols=23  Identities=26%  Similarity=0.566  Sum_probs=19.5

Q ss_pred             ceeccccccccCChHHHHHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      -|.|++|..-|.....|..|.-.
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHhh
Confidence            48899999999888888888775


No 207
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.22  E-value=46  Score=19.83  Aligned_cols=26  Identities=23%  Similarity=0.388  Sum_probs=21.2

Q ss_pred             CCCceeccccccccCChHHHHHHHHH
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      +-..|-|-+|.+-|.+...|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            34568899999999999999888764


No 208
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=28.71  E-value=9  Score=18.98  Aligned_cols=16  Identities=0%  Similarity=-0.128  Sum_probs=7.5

Q ss_pred             CCcccc--ccCCCcccCc
Q psy691          113 KEEEEE--EDGKTNVLTT  128 (134)
Q Consensus       113 ~~~~~c--~~~~~~~~~~  128 (134)
                      +.-+.|  ..|+..|+..
T Consensus        23 ~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   23 ELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             EEEEEECCCcCCCEEEEE
Confidence            344555  2355555443


No 209
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=28.58  E-value=13  Score=26.13  Aligned_cols=36  Identities=17%  Similarity=0.325  Sum_probs=13.4

Q ss_pred             ceecccccccccChhhHHHHHhHhcCCCccccccCCC
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKT  123 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~  123 (134)
                      +..|..||..-...-.+.. ..--.+.+-+.|..|+.
T Consensus       211 R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~~  246 (290)
T PF04216_consen  211 RIKCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCGS  246 (290)
T ss_dssp             TTS-TTT---SS-EEE---------SEEEEEETTTTE
T ss_pred             CCCCcCCCCCCCcceeeEe-cCCCCcEEEEECCcccc
Confidence            3578888765433322211 11222445577876664


No 210
>KOG1280|consensus
Probab=28.40  E-value=57  Score=23.85  Aligned_cols=38  Identities=11%  Similarity=0.197  Sum_probs=29.0

Q ss_pred             CceecccccccccChhhHHHHHhHhcCCCcccc--ccCCC
Q psy691           86 KRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEE--EDGKT  123 (134)
Q Consensus        86 k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c--~~~~~  123 (134)
                      .-|.|++|++.-.....|..|...-+-+-++.+  +.|..
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            469999999988889999999887666666544  44544


No 211
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=28.18  E-value=23  Score=22.97  Aligned_cols=20  Identities=20%  Similarity=0.519  Sum_probs=15.1

Q ss_pred             CCceecccccccccChhhHH
Q psy691           85 VKRYLCTFCGKGFNDTFDLK  104 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~~~~l~  104 (134)
                      ...+.|..||+.|.....+.
T Consensus       112 ~~~~~C~~CG~~f~~~~~i~  131 (180)
T PRK12387        112 FALCNCRVCGRPFAVQKEID  131 (180)
T ss_pred             eCcccchhhCCccccHHHHH
Confidence            35679999999998765544


No 212
>KOG1842|consensus
Probab=28.05  E-value=37  Score=25.69  Aligned_cols=24  Identities=21%  Similarity=0.340  Sum_probs=18.6

Q ss_pred             ecccccccccChhhHHHHHhHhcC
Q psy691           89 LCTFCGKGFNDTFDLKRHTRTHTG  112 (134)
Q Consensus        89 ~C~~C~~~f~~~~~l~~H~~~h~~  112 (134)
                      .|++|...|...+.|..|.-..|+
T Consensus        17 lCPiC~~dl~~~~~L~~H~d~eH~   40 (505)
T KOG1842|consen   17 LCPICLLDLPNLSALNDHLDVEHF   40 (505)
T ss_pred             cCchHhhhhhhHHHHHHHHhhhcc
Confidence            688888888888888888776433


No 213
>KOG3002|consensus
Probab=27.97  E-value=32  Score=24.55  Aligned_cols=61  Identities=16%  Similarity=0.176  Sum_probs=36.0

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCCceeccc----ccccccChhhHHHHHhHhcCCCccccccC
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTF----CGKGFNDTFDLKRHTRTHTGKEEEEEEDG  121 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~----C~~~f~~~~~l~~H~~~h~~~~~~~c~~~  121 (134)
                      +....|+.|...+.....  ++|..-.....+.|..    |.+.|..... ..|.+.-.. ++|.|++-
T Consensus        78 ~~~~~CP~Cr~~~g~~R~--~amEkV~e~~~vpC~~~~~GC~~~~~Y~~~-~~HE~~C~f-~~~~CP~p  142 (299)
T KOG3002|consen   78 KVSNKCPTCRLPIGNIRC--RAMEKVAEAVLVPCKNAKLGCTKSFPYGEK-SKHEKVCEF-RPCSCPVP  142 (299)
T ss_pred             hhcccCCccccccccHHH--HHHHHHHHhceecccccccCCceeeccccc-ccccccccc-CCcCCCCC
Confidence            345677788777764333  2333323344566664    7778777666 456666555 77887543


No 214
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=27.88  E-value=76  Score=22.58  Aligned_cols=26  Identities=23%  Similarity=0.447  Sum_probs=23.1

Q ss_pred             CCCceeccccccccCChHHHHHHHHH
Q psy691           56 DNTRFACHLCSKSFSLQRLLNRHMKC   81 (134)
Q Consensus        56 ~~~~~~C~~C~~~f~~~~~l~~H~~~   81 (134)
                      ....|.|..|-+-|.+...|.+|+..
T Consensus        45 ~~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         45 CTKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CCeEEEcCCCcchhCCHHHHHHHHHh
Confidence            35679999999999999999999873


No 215
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.56  E-value=26  Score=20.74  Aligned_cols=10  Identities=20%  Similarity=0.697  Sum_probs=5.7

Q ss_pred             ceeccccccc
Q psy691           59 RFACHLCSKS   68 (134)
Q Consensus        59 ~~~C~~C~~~   68 (134)
                      +-.|+.||..
T Consensus         2 p~~CpYCg~~   11 (102)
T PF11672_consen    2 PIICPYCGGP   11 (102)
T ss_pred             CcccCCCCCe
Confidence            3456666644


No 216
>KOG0782|consensus
Probab=27.26  E-value=18  Score=28.34  Aligned_cols=26  Identities=35%  Similarity=0.602  Sum_probs=10.1

Q ss_pred             HHHHHHHHcCCCCceecccccccccC
Q psy691           74 LLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        74 ~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      .|.+|-..|....-=+|..|+|.|.+
T Consensus       240 ~fvrHHWVHrrRqeGkC~~CgKgFQQ  265 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNTCGKGFQQ  265 (1004)
T ss_pred             cchHHhHhhHhhhccccchhhhhhhh
Confidence            33444333333222344444444433


No 217
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=26.26  E-value=22  Score=21.71  Aligned_cols=13  Identities=15%  Similarity=0.427  Sum_probs=9.1

Q ss_pred             ceeccccccccCCh
Q psy691           59 RFACHLCSKSFSLQ   72 (134)
Q Consensus        59 ~~~C~~C~~~f~~~   72 (134)
                      .+.| .|+..|...
T Consensus        70 ~~~C-~Cg~~~~~~   82 (124)
T PRK00762         70 EIEC-ECGYEGVVD   82 (124)
T ss_pred             eEEe-eCcCccccc
Confidence            4788 888776643


No 218
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=26.26  E-value=31  Score=16.22  Aligned_cols=12  Identities=17%  Similarity=0.623  Sum_probs=6.4

Q ss_pred             Cceecccccccc
Q psy691           58 TRFACHLCSKSF   69 (134)
Q Consensus        58 ~~~~C~~C~~~f   69 (134)
                      +.|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            458888888654


No 219
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=26.17  E-value=9.2  Score=19.75  Aligned_cols=17  Identities=18%  Similarity=0.014  Sum_probs=11.4

Q ss_pred             ccccccCCCcccCccce
Q psy691          115 EEEEEDGKTNVLTTEYL  131 (134)
Q Consensus       115 ~~~c~~~~~~~~~~~~l  131 (134)
                      .|.|+||+.+.++.+.|
T Consensus        18 ~y~CRCG~~f~i~e~~l   34 (55)
T PF05207_consen   18 SYPCRCGGEFEISEEDL   34 (55)
T ss_dssp             EEEETTSSEEEEEHHHH
T ss_pred             EEcCCCCCEEEEcchhc
Confidence            36788888766665544


No 220
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=26.07  E-value=1.3e+02  Score=17.76  Aligned_cols=38  Identities=16%  Similarity=0.226  Sum_probs=27.4

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceeccccccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKG   96 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~   96 (134)
                      ..|.|+.-+..|.....+...+... ..+.|.|...|+.
T Consensus         2 eVf~i~~T~EiF~dYe~Y~~R~~~y-~~~vwtC~~TGk~   39 (102)
T PF10537_consen    2 EVFYIPFTGEIFRDYEEYLKRMILY-NQRVWTCEITGKS   39 (102)
T ss_pred             ceEEeCCCCcccCCHHHHHHHHHHH-hCCeeEEecCCCC
Confidence            3578888888898887776655543 3467899888764


No 221
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=26.03  E-value=5  Score=18.71  Aligned_cols=10  Identities=40%  Similarity=0.989  Sum_probs=3.6

Q ss_pred             eecccccccc
Q psy691           88 YLCTFCGKGF   97 (134)
Q Consensus        88 ~~C~~C~~~f   97 (134)
                      ..|..||-.+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            3455555443


No 222
>KOG2461|consensus
Probab=25.80  E-value=1.2e+02  Score=22.76  Aligned_cols=56  Identities=9%  Similarity=-0.164  Sum_probs=24.5

Q ss_pred             cccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHhcCCCcccc
Q psy691           63 HLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGKEEEEE  118 (134)
Q Consensus        63 ~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c  118 (134)
                      .++.+.+.....+..|...+..+..+.+..+...+.....+..+..+|+..+.+.+
T Consensus       335 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  390 (396)
T KOG2461|consen  335 TIPVRTPAGQLIYTQSHSMEVAEPTDMAPNQIWKIYHTGVLGFLIITTDESECNNM  390 (396)
T ss_pred             cccccccccccchhhhhhcccCCCCcccccccccceeccccceeeeeccccccccc
Confidence            33333444444444454445444444444433333333344444444554444444


No 223
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=25.39  E-value=99  Score=15.99  Aligned_cols=13  Identities=23%  Similarity=0.483  Sum_probs=4.9

Q ss_pred             ceecccccccccC
Q psy691           87 RYLCTFCGKGFND   99 (134)
Q Consensus        87 ~~~C~~C~~~f~~   99 (134)
                      |+....|+..|..
T Consensus        24 PV~s~~C~H~fek   36 (57)
T PF11789_consen   24 PVKSKKCGHTFEK   36 (57)
T ss_dssp             EEEESSS--EEEH
T ss_pred             CcCcCCCCCeecH
Confidence            4444444444444


No 224
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=25.18  E-value=28  Score=24.93  Aligned_cols=9  Identities=33%  Similarity=0.874  Sum_probs=6.4

Q ss_pred             ceecccccc
Q psy691           87 RYLCTFCGK   95 (134)
Q Consensus        87 ~~~C~~C~~   95 (134)
                      +.+|..|+.
T Consensus       226 R~~C~~Cg~  234 (309)
T PRK03564        226 RVKCSNCEQ  234 (309)
T ss_pred             CccCCCCCC
Confidence            457888875


No 225
>COG2879 Uncharacterized small protein [Function unknown]
Probab=25.04  E-value=95  Score=16.64  Aligned_cols=18  Identities=17%  Similarity=-0.018  Sum_probs=11.7

Q ss_pred             CChHHHHHHHHHcCCCCc
Q psy691           70 SLQRLLNRHMKCHSDVKR   87 (134)
Q Consensus        70 ~~~~~l~~H~~~h~~~k~   87 (134)
                      ...+++..||+.++..+|
T Consensus        23 pdYdnYVehmr~~hPd~p   40 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKP   40 (65)
T ss_pred             CcHHHHHHHHHHhCcCCC
Confidence            456677788887555554


No 226
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=24.96  E-value=40  Score=23.68  Aligned_cols=15  Identities=20%  Similarity=0.487  Sum_probs=10.1

Q ss_pred             CCceecccccccccC
Q psy691           85 VKRYLCTFCGKGFND   99 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~   99 (134)
                      .+-|.|+.||..+.+
T Consensus       320 ~r~~~C~~cg~~~~r  334 (364)
T COG0675         320 GRLFKCPRCGFVHDR  334 (364)
T ss_pred             ceeEECCCCCCeehh
Confidence            456788888765544


No 227
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=24.58  E-value=28  Score=24.90  Aligned_cols=10  Identities=30%  Similarity=0.889  Sum_probs=6.8

Q ss_pred             ceeccccccc
Q psy691           87 RYLCTFCGKG   96 (134)
Q Consensus        87 ~~~C~~C~~~   96 (134)
                      +.+|..|+..
T Consensus       224 R~~C~~Cg~~  233 (305)
T TIGR01562       224 RVKCSHCEES  233 (305)
T ss_pred             CccCCCCCCC
Confidence            4578888753


No 228
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=24.54  E-value=48  Score=17.22  Aligned_cols=12  Identities=25%  Similarity=0.603  Sum_probs=7.1

Q ss_pred             Cceecccccccc
Q psy691           58 TRFACHLCSKSF   69 (134)
Q Consensus        58 ~~~~C~~C~~~f   69 (134)
                      ..|.|+.||..+
T Consensus        13 v~~~Cp~cGipt   24 (55)
T PF13824_consen   13 VNFECPDCGIPT   24 (55)
T ss_pred             cCCcCCCCCCcC
Confidence            346677776544


No 229
>PF08576 DUF1764:  Eukaryotic protein of unknown function (DUF1764);  InterPro: IPR013885  This entry consists of eukaryotic proteins of unknown function, including many hypothetical proteins. 
Probab=24.34  E-value=38  Score=19.82  Aligned_cols=11  Identities=9%  Similarity=-0.342  Sum_probs=7.6

Q ss_pred             cCCCccccccC
Q psy691          111 TGKEEEEEEDG  121 (134)
Q Consensus       111 ~~~~~~~c~~~  121 (134)
                      |..-||.|.||
T Consensus        91 T~~CPFDC~CC  101 (102)
T PF08576_consen   91 TPLCPFDCDCC  101 (102)
T ss_pred             CCCCCCcCCCC
Confidence            34567888877


No 230
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=24.21  E-value=44  Score=17.03  Aligned_cols=17  Identities=24%  Similarity=0.751  Sum_probs=11.1

Q ss_pred             CCCCceeccccccccCC
Q psy691           55 KDNTRFACHLCSKSFSL   71 (134)
Q Consensus        55 ~~~~~~~C~~C~~~f~~   71 (134)
                      .....+.|.+|++.+..
T Consensus        31 ~~~~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   31 KEPIKLRCHYCERIITE   47 (52)
T ss_dssp             TTTCEEEETTT--EEEH
T ss_pred             CCCCEEEeeCCCCEecc
Confidence            44567999999988764


No 231
>PF14353 CpXC:  CpXC protein
Probab=24.08  E-value=37  Score=20.59  Aligned_cols=23  Identities=30%  Similarity=0.524  Sum_probs=17.0

Q ss_pred             CceeccccccccCChHHHHHHHH
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMK   80 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~   80 (134)
                      ..|.|+.||..|.-...+..|..
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~   59 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDP   59 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcC
Confidence            35899999999987666555543


No 232
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=23.76  E-value=1e+02  Score=22.34  Aligned_cols=48  Identities=23%  Similarity=0.488  Sum_probs=27.2

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCceecccccccccChhhHHHHHhHh
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      .|-.|.-.|.....-..-  .-+....|+|+.|...|...-..-.|...|
T Consensus       364 ~Cf~CQ~~fp~~~~~~~~--~~~ss~rY~Ce~CK~~FC~dCdvfiHe~Lh  411 (421)
T COG5151         364 HCFVCQGPFPKPPVSPFD--ESTSSGRYQCELCKSTFCSDCDVFIHETLH  411 (421)
T ss_pred             cceeccCCCCCCCCCccc--ccccccceechhhhhhhhhhhHHHHHHHHh
Confidence            466666666643321100  112234588888888887776666666555


No 233
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=23.71  E-value=45  Score=27.44  Aligned_cols=33  Identities=18%  Similarity=0.359  Sum_probs=18.5

Q ss_pred             eeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      -.|..|++.|....-       -...+.+-|..||..|..
T Consensus       461 dtC~~C~kkFfSlsK-------~L~~RKHHCRkCGrVFC~  493 (1374)
T PTZ00303        461 DSCPSCGRAFISLSR-------PLGTRAHHCRSCGIRLCV  493 (1374)
T ss_pred             CcccCcCCccccccc-------ccccccccccCCccccCc
Confidence            569999999864311       012234456666665544


No 234
>PTZ00448 hypothetical protein; Provisional
Probab=23.63  E-value=53  Score=24.22  Aligned_cols=23  Identities=30%  Similarity=0.535  Sum_probs=20.3

Q ss_pred             ceecccccccccChhhHHHHHhH
Q psy691           87 RYLCTFCGKGFNDTFDLKRHTRT  109 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~~l~~H~~~  109 (134)
                      .|.|..|+-.|......+.|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            58899999999888888888876


No 235
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.88  E-value=52  Score=15.01  Aligned_cols=12  Identities=33%  Similarity=0.758  Sum_probs=7.1

Q ss_pred             ceeccccccccC
Q psy691           59 RFACHLCSKSFS   70 (134)
Q Consensus        59 ~~~C~~C~~~f~   70 (134)
                      -+.|..|+..|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            356666666553


No 236
>PRK04023 DNA polymerase II large subunit; Validated
Probab=22.55  E-value=68  Score=27.12  Aligned_cols=10  Identities=40%  Similarity=0.823  Sum_probs=7.2

Q ss_pred             ceeccccccc
Q psy691           59 RFACHLCSKS   68 (134)
Q Consensus        59 ~~~C~~C~~~   68 (134)
                      ...|+.||..
T Consensus       626 ~RfCpsCG~~  635 (1121)
T PRK04023        626 RRKCPSCGKE  635 (1121)
T ss_pred             CccCCCCCCc
Confidence            4578888866


No 237
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=22.33  E-value=13  Score=29.67  Aligned_cols=56  Identities=20%  Similarity=0.519  Sum_probs=35.8

Q ss_pred             eccccccccCChHHHHHHHHHcCCCCce-ecccccccccChhhHHHHHhHhcCCCccccccCCC
Q psy691           61 ACHLCSKSFSLQRLLNRHMKCHSDVKRY-LCTFCGKGFNDTFDLKRHTRTHTGKEEEEEEDGKT  123 (134)
Q Consensus        61 ~C~~C~~~f~~~~~l~~H~~~h~~~k~~-~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~  123 (134)
                      .|..||-.|+.-..|-.. |.++..+.| .|+.|.+.|....+.+    .|.  .|..|+.|+-
T Consensus       125 ~CT~CGPRfTIi~alPYD-R~nTsM~~F~lC~~C~~EY~dP~nRR----fHA--Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYD-RENTSMADFPLCPFCDKEYKDPLNRR----FHA--QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCC-cccCccccCcCCHHHHHHhcCccccc----ccc--ccccCcccCC
Confidence            488899988876665533 334444444 6888988777765543    342  4778875554


No 238
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.06  E-value=53  Score=17.48  Aligned_cols=14  Identities=21%  Similarity=0.698  Sum_probs=10.6

Q ss_pred             CCceeccccccccC
Q psy691           57 NTRFACHLCSKSFS   70 (134)
Q Consensus        57 ~~~~~C~~C~~~f~   70 (134)
                      ++--.|++|+..|.
T Consensus        46 ~gev~CPYC~t~y~   59 (62)
T COG4391          46 EGEVVCPYCSTRYR   59 (62)
T ss_pred             CCcEecCccccEEE
Confidence            34468999998875


No 239
>KOG2907|consensus
Probab=22.03  E-value=36  Score=20.54  Aligned_cols=11  Identities=9%  Similarity=-0.206  Sum_probs=5.7

Q ss_pred             cccccCCCccc
Q psy691          116 EEEEDGKTNVL  126 (134)
Q Consensus       116 ~~c~~~~~~~~  126 (134)
                      |.|..|++.|.
T Consensus       103 YTC~kC~~k~~  113 (116)
T KOG2907|consen  103 YTCPKCKYKFT  113 (116)
T ss_pred             EEcCccceeee
Confidence            55555555443


No 240
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=21.86  E-value=71  Score=20.00  Aligned_cols=47  Identities=15%  Similarity=0.233  Sum_probs=25.7

Q ss_pred             eeccccccccCChHHHHHHHHHc-----CCCCceecccccccccChhhHHHH
Q psy691           60 FACHLCSKSFSLQRLLNRHMKCH-----SDVKRYLCTFCGKGFNDTFDLKRH  106 (134)
Q Consensus        60 ~~C~~C~~~f~~~~~l~~H~~~h-----~~~k~~~C~~C~~~f~~~~~l~~H  106 (134)
                      -.|..|+.....-..-..--...     ....=+.|..|++.|-.-+++.+-
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW~GsH~~~~  143 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYWEGSHWRRM  143 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEecccccHHHH
Confidence            47888887654322110000011     112347899999988877766543


No 241
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=21.70  E-value=42  Score=19.87  Aligned_cols=15  Identities=40%  Similarity=0.713  Sum_probs=12.0

Q ss_pred             ceecccccccccChh
Q psy691           87 RYLCTFCGKGFNDTF  101 (134)
Q Consensus        87 ~~~C~~C~~~f~~~~  101 (134)
                      |++|..||..|..-+
T Consensus         2 pH~CtrCG~vf~~g~   16 (112)
T COG3364           2 PHQCTRCGEVFDDGS   16 (112)
T ss_pred             Cceeccccccccccc
Confidence            678999999888743


No 242
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.69  E-value=61  Score=22.93  Aligned_cols=12  Identities=17%  Similarity=0.695  Sum_probs=7.4

Q ss_pred             eecccccccccC
Q psy691           88 YLCTFCGKGFND   99 (134)
Q Consensus        88 ~~C~~C~~~f~~   99 (134)
                      |.|..|.-.|..
T Consensus       256 yvCs~Clsi~C~  267 (279)
T TIGR00627       256 FVCSVCLSVLCQ  267 (279)
T ss_pred             EECCCccCCcCC
Confidence            666666665553


No 243
>COG5216 Uncharacterized conserved protein [Function unknown]
Probab=21.61  E-value=21  Score=18.81  Aligned_cols=16  Identities=19%  Similarity=-0.002  Sum_probs=10.5

Q ss_pred             cccccCCCcccCccce
Q psy691          116 EEEEDGKTNVLTTEYL  131 (134)
Q Consensus       116 ~~c~~~~~~~~~~~~l  131 (134)
                      |.|+||.++-++-+.|
T Consensus        23 yPCPCGDRFeIsLeDl   38 (67)
T COG5216          23 YPCPCGDRFEISLEDL   38 (67)
T ss_pred             ecCCCCCEeEEEHHHh
Confidence            6788887776655443


No 244
>KOG4215|consensus
Probab=21.60  E-value=39  Score=24.92  Aligned_cols=18  Identities=39%  Similarity=0.565  Sum_probs=8.9

Q ss_pred             ecccccccccChhhHHHHH
Q psy691           89 LCTFCGKGFNDTFDLKRHT  107 (134)
Q Consensus        89 ~C~~C~~~f~~~~~l~~H~  107 (134)
                      .|.-| |.|-+++..++|+
T Consensus        38 SCdGC-KGFFRRSVrk~~~   55 (432)
T KOG4215|consen   38 SCDGC-KGFFRRSVRKNHQ   55 (432)
T ss_pred             ecCcc-hHHHHHHHHhcce
Confidence            45555 3455555555443


No 245
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics]
Probab=21.22  E-value=59  Score=23.86  Aligned_cols=25  Identities=32%  Similarity=0.664  Sum_probs=21.4

Q ss_pred             CceecccccccccChhhHHHHHhHh
Q psy691           86 KRYLCTFCGKGFNDTFDLKRHTRTH  110 (134)
Q Consensus        86 k~~~C~~C~~~f~~~~~l~~H~~~h  110 (134)
                      .-|.|++|-+-|.....|.+|++..
T Consensus       157 ~vyICefClkY~~s~~~~~rH~~kC  181 (395)
T COG5027         157 IVYICEFCLKYYGSQTSLVRHRKKC  181 (395)
T ss_pred             eEEEhhhhHHHhcchhHHHHHHhcC
Confidence            3589999999999999999998753


No 246
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=21.20  E-value=16  Score=17.36  Aligned_cols=13  Identities=23%  Similarity=0.549  Sum_probs=4.7

Q ss_pred             eeccccccccCCh
Q psy691           60 FACHLCSKSFSLQ   72 (134)
Q Consensus        60 ~~C~~C~~~f~~~   72 (134)
                      ..|..|++.+...
T Consensus         7 ~~C~~C~~~~~~~   19 (43)
T PF06467_consen    7 KTCSYCKKYIPNK   19 (43)
T ss_dssp             EE-TTT--EEECC
T ss_pred             CcCcccCCcccCC
Confidence            3455555555433


No 247
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=21.13  E-value=54  Score=23.23  Aligned_cols=32  Identities=16%  Similarity=0.374  Sum_probs=20.1

Q ss_pred             ceeccccccccCChHHHHHHHHHcCCCCceecccccccccC
Q psy691           59 RFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGKGFND   99 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~   99 (134)
                      ..+|+.|+.....+. |.        ..-+.|+.|+..|..
T Consensus        26 ~~~c~~c~~~~~~~~-l~--------~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        26 WTKCPKCGQVLYTKE-LE--------RNLEVCPKCDHHMRM   57 (285)
T ss_pred             eeECCCCcchhhHHH-HH--------hhCCCCCCCCCcCcC
Confidence            347888887755332 32        123688888877664


No 248
>PRK12860 transcriptional activator FlhC; Provisional
Probab=20.76  E-value=49  Score=21.94  Aligned_cols=30  Identities=20%  Similarity=0.318  Sum_probs=13.2

Q ss_pred             ccCChHHHHHHHHHcCCCCceeccccccccc
Q psy691           68 SFSLQRLLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        68 ~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      .|.+.-.|.+.+... .-....|..|+-.|.
T Consensus       116 s~tRAw~LvRf~~s~-~L~l~~C~~Cgg~fv  145 (189)
T PRK12860        116 DLTRAWTLVRFFDAG-MLQLARCCRCGGKFV  145 (189)
T ss_pred             cHHHHHHHHHHhcCC-CeeeccCCCCCCCee
Confidence            344444444444432 122345555555554


No 249
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=20.75  E-value=65  Score=16.63  Aligned_cols=19  Identities=21%  Similarity=0.482  Sum_probs=14.6

Q ss_pred             ceeccccccccCChHHHHH
Q psy691           59 RFACHLCSKSFSLQRLLNR   77 (134)
Q Consensus        59 ~~~C~~C~~~f~~~~~l~~   77 (134)
                      -+-|-+||..|.+...|..
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLER   45 (55)
T ss_pred             CceeeeeCCccCCHHHHHh
Confidence            3578889999888877753


No 250
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=20.73  E-value=42  Score=21.01  Aligned_cols=14  Identities=29%  Similarity=0.646  Sum_probs=11.0

Q ss_pred             CceeccccccccCC
Q psy691           58 TRFACHLCSKSFSL   71 (134)
Q Consensus        58 ~~~~C~~C~~~f~~   71 (134)
                      ++..|..||..|+-
T Consensus       111 ~~~RCpeCG~~fkL  124 (136)
T PF01215_consen  111 KPQRCPECGQVFKL  124 (136)
T ss_dssp             SEEEETTTEEEEEE
T ss_pred             CccCCCCCCeEEEE
Confidence            46889999988864


No 251
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=20.65  E-value=1.3e+02  Score=19.76  Aligned_cols=15  Identities=20%  Similarity=0.527  Sum_probs=7.7

Q ss_pred             CCceecccccccccC
Q psy691           85 VKRYLCTFCGKGFND   99 (134)
Q Consensus        85 ~k~~~C~~C~~~f~~   99 (134)
                      ..-|.|+.|.-.|+.
T Consensus       111 ~~~y~C~~~~~r~sf  125 (176)
T COG1675         111 NNYYVCPNCHVKYSF  125 (176)
T ss_pred             CCceeCCCCCCcccH
Confidence            344666555544443


No 252
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.58  E-value=50  Score=21.89  Aligned_cols=30  Identities=23%  Similarity=0.389  Sum_probs=13.4

Q ss_pred             ccCChHHHHHHHHHcCCCCceeccccccccc
Q psy691           68 SFSLQRLLNRHMKCHSDVKRYLCTFCGKGFN   98 (134)
Q Consensus        68 ~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~   98 (134)
                      .|.+.-.|.+.+.... -....|..|+-.|.
T Consensus       116 s~tRAw~LvRf~~s~~-L~l~~C~~Cgg~fv  145 (187)
T PRK12722        116 SLTRAWTLVRFVDSGM-LQLSSCNCCGGHFV  145 (187)
T ss_pred             cHHHHHHHHHHHhcCc-EeeccCCCCCCCee
Confidence            3444444554444321 12234555555554


No 253
>PRK11823 DNA repair protein RadA; Provisional
Probab=20.25  E-value=82  Score=23.81  Aligned_cols=25  Identities=24%  Similarity=0.514  Sum_probs=17.1

Q ss_pred             CCceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           57 NTRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        57 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      +..|.|..||..+..              --.+|+.|+.
T Consensus         5 ~~~y~C~~Cg~~~~~--------------~~g~Cp~C~~   29 (446)
T PRK11823          5 KTAYVCQECGAESPK--------------WLGRCPECGA   29 (446)
T ss_pred             CCeEECCcCCCCCcc--------------cCeeCcCCCC
Confidence            346999999977542              1257888864


No 254
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=20.24  E-value=82  Score=23.90  Aligned_cols=24  Identities=21%  Similarity=0.563  Sum_probs=16.9

Q ss_pred             CceeccccccccCChHHHHHHHHHcCCCCceecccccc
Q psy691           58 TRFACHLCSKSFSLQRLLNRHMKCHSDVKRYLCTFCGK   95 (134)
Q Consensus        58 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~   95 (134)
                      ..|.|..||..+..              --.+|+.|+.
T Consensus         6 ~~y~C~~Cg~~~~~--------------~~g~Cp~C~~   29 (454)
T TIGR00416         6 SKFVCQHCGADSPK--------------WQGKCPACHA   29 (454)
T ss_pred             CeEECCcCCCCCcc--------------ccEECcCCCC
Confidence            45999999977542              2257888874


Done!