Diaphorina citri psyllid: psy6916


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MVGLVANGSMLITYNSGKLKVDQGNTLTPSDLKQAPEVTWNADSSSYYTLVMTDPDAPSRQNPKAREWRHWLVVNIPGSQISRGQTITPYAGPTPPKGTGTYIQE
cccccccEEEEEEEccccEEECcccEEcccccccccEEEECccccccEEEEEEcccccccccccccCEEEEEEEEcccccccccEEEECcccccccccccccccc
MVGLVANGSMLITYNSGKLKVDQGNTLTPSDLKQAPEVTWNADSSSYYTLVMTDPDAPSRQNPKAREWRHWLVVNIPGSQISRGQTITPYAGPTPPKG**T****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGLVANGSMLITYNSGKLKVDQGNTLTPSDLKQAPEVTWNADSSSYYTLVMTDPDAPSRQNPKAREWRHWLVVNIPGSQISRGQTITPYAGPTPPKGTGTYIQE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylethanolamine-binding protein 1 HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.confidentQ3YIX4
Phosphatidylethanolamine-binding protein 1 HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.confidentP13696
Putative odorant-binding protein A5 confidentP54185

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008150 [BP]biological_processprobable
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IQY, chain A
Confidence level:very confident
Coverage over the Query: 4-104
View the alignment between query and template
View the model in PyMOL