Diaphorina citri psyllid: psy6918

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MKSKLPTSNVFHFAERFHRMKASQDYLVTVIEDTRTKQVIGTGSLILEQKFIHECALKGKIEEVVVDDTYRGKELGKLLIAVLVKLAKHFQCYKLTLDCADHMIPFYETFGFQKKNNFMQIYF
cccccccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEEEEEEEEccccccccEEcEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccEEcccccEEcc
***K*PTSNVFHFAERFHRMKASQDYLVTVIEDTRTKQVIGTGSLILEQKFIHECALKGKIEEVVVDDTYRGKELGKLLIAVLVKLAKHFQCYKLTLDCADHMIPFYETFGFQKKNNFMQIYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSKLPTSNVFHFAERFHRMKASQDYLVTVIEDTRTKQVIGTGSLILEQKFIHECALKGKIEEVVVDDTYRGKELGKLLIAVLVKLAKHFQCYKLTLDCADHMIPFYETFGFQKKNNFMQIYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucosamine 6-phosphate N-acetyltransferase confidentO13738
Probable glucosamine 6-phosphate N-acetyltransferase confidentQ9VAI0
Glucosamine 6-phosphate N-acetyltransferase Acetyltransferase involved in UDP-N-acetylglucosamine (UDP-GlcNAc) biosynthesis. UDP-GlcNAc is an essential metabolite that serves as an initial sugar donor of N-glycan synthesis and thus plays an important role in protein and lipid glycosylation.confidentQ9LFU9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006045 [BP]N-acetylglucosamine biosynthetic processprobableGO:1901576, GO:0071704, GO:1901137, GO:1901135, GO:0006044, GO:0046349, GO:0006040, GO:0009058, GO:0008150, GO:0008152, GO:1901073, GO:1901071
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0004343 [MF]glucosamine 6-phosphate N-acetyltransferase activityprobableGO:0008080, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable
2.3.1.4Glucosamine-phosphate N-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I12, chain A
Confidence level:very confident
Coverage over the Query: 36-122
View the alignment between query and template
View the model in PyMOL
Template: 3T90, chain A
Confidence level:very confident
Coverage over the Query: 6-123
View the alignment between query and template
View the model in PyMOL