Query         psy6931
Match_columns 81
No_of_seqs    101 out of 359
Neff          6.0 
Searched_HMMs 46136
Date          Fri Aug 16 22:11:10 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6931.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6931hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04857 CAF1:  CAF1 family rib  99.9   1E-24 2.2E-29  157.2   4.5   69    5-73      2-70  (262)
  2 KOG0304|consensus               99.7 1.5E-17 3.2E-22  119.5   5.8   70    7-76      6-75  (239)
  3 COG5228 POP2 mRNA deadenylase   99.4   4E-13 8.8E-18   97.7   5.3   65    8-73     25-90  (299)
  4 KOG1990|consensus               99.1 1.8E-11 3.9E-16   97.1  -0.4   69    8-77      1-71  (564)
  5 PRK09145 DNA polymerase III su  95.3   0.037   8E-07   38.2   4.4   23   17-39     21-43  (202)
  6 PRK05168 ribonuclease T; Provi  94.3   0.095 2.1E-06   36.7   4.6   41   15-76      7-47  (211)
  7 PRK07247 DNA polymerase III su  94.3   0.051 1.1E-06   38.0   3.2   27   26-74      6-32  (195)
  8 smart00479 EXOIII exonuclease   94.0   0.086 1.9E-06   34.2   3.6   14   26-39      1-14  (169)
  9 PRK07748 sporulation inhibitor  93.4    0.14 3.1E-06   35.5   4.1   17   24-40      3-19  (207)
 10 PRK09146 DNA polymerase III su  93.4    0.12 2.6E-06   37.2   3.8   20   21-40     43-62  (239)
 11 TIGR00573 dnaq exonuclease, DN  93.3    0.12 2.6E-06   36.2   3.6   19   21-39      3-21  (217)
 12 cd06133 ERI-1_3'hExo_like DEDD  93.3    0.13 2.8E-06   33.8   3.6   34   27-76      1-34  (176)
 13 PRK06310 DNA polymerase III su  92.9    0.14   3E-06   36.9   3.5   19   21-39      3-21  (250)
 14 PF00929 RNase_T:  Exonuclease;  92.9    0.12 2.6E-06   32.5   2.8   12   28-39      1-12  (164)
 15 PRK07883 hypothetical protein;  92.6    0.12 2.5E-06   41.5   3.0   23   17-39      7-29  (557)
 16 COG0349 Rnd Ribonuclease D [Tr  92.6    0.12 2.7E-06   39.8   3.0   28   13-40      5-32  (361)
 17 PF01612 DNA_pol_A_exo1:  3'-5'  92.0    0.17 3.8E-06   32.8   2.8   28   12-39      7-34  (176)
 18 PRK07942 DNA polymerase III su  91.5    0.32   7E-06   34.6   4.0   17   23-39      4-20  (232)
 19 PRK09182 DNA polymerase III su  91.5    0.31 6.8E-06   36.2   4.0   30   26-76     38-67  (294)
 20 TIGR01298 RNaseT ribonuclease   91.4    0.39 8.5E-06   33.4   4.2   19   22-40      5-23  (200)
 21 PRK06807 DNA polymerase III su  91.2    0.26 5.5E-06   36.9   3.3   28   25-73      8-35  (313)
 22 PRK06063 DNA polymerase III su  91.1    0.29 6.3E-06   36.5   3.5   31   24-75     14-44  (313)
 23 cd06127 DEDDh DEDDh 3'-5' exon  91.0    0.25 5.4E-06   31.0   2.7   28   28-76      1-28  (159)
 24 PRK05359 oligoribonuclease; Pr  90.9    0.15 3.2E-06   35.1   1.7   18   24-41      2-19  (181)
 25 cd06130 DNA_pol_III_epsilon_li  90.8    0.31 6.8E-06   31.4   3.1   11   27-37      1-11  (156)
 26 cd06134 RNaseT DEDDh 3'-5' exo  90.6    0.52 1.1E-05   32.3   4.2   19   23-41      3-21  (189)
 27 cd06149 ISG20 DEDDh 3'-5' exon  89.7    0.14 3.1E-06   34.2   0.8   13   28-40      1-13  (157)
 28 PRK07740 hypothetical protein;  89.7    0.24 5.2E-06   35.6   1.9   23   18-40     52-74  (244)
 29 cd06131 DNA_pol_III_epsilon_Ec  88.9    0.62 1.4E-05   30.6   3.4   13   27-39      1-13  (167)
 30 TIGR01388 rnd ribonuclease D.   88.8    0.57 1.2E-05   35.6   3.6   26   13-38      6-31  (367)
 31 cd06135 Orn DEDDh 3'-5' exonuc  88.2    0.64 1.4E-05   31.4   3.1   14   27-40      1-14  (173)
 32 PRK08517 DNA polymerase III su  87.7    0.83 1.8E-05   33.2   3.7   33   21-74     64-96  (257)
 33 PRK05601 DNA polymerase III su  86.8    0.46   1E-05   36.9   2.0   21   21-41     42-62  (377)
 34 cd06137 DEDDh_RNase DEDDh 3'-5  86.5    0.25 5.3E-06   33.0   0.3   13   28-40      1-13  (161)
 35 cd06141 WRN_exo DEDDy 3'-5' ex  86.3     1.2 2.6E-05   29.4   3.6   27   13-39      5-32  (170)
 36 cd06144 REX4_like DEDDh 3'-5'   85.5    0.33 7.1E-06   32.1   0.5   13   28-40      1-13  (152)
 37 KOG2249|consensus               85.4    0.46 9.9E-06   35.6   1.3   16   26-41    106-121 (280)
 38 PRK10829 ribonuclease D; Provi  85.2     1.2 2.6E-05   34.3   3.5   27   12-38      9-35  (373)
 39 TIGR01407 dinG_rel DnaQ family  83.5     1.4 3.1E-05   36.7   3.5   28   26-74      1-28  (850)
 40 cd06146 mut-7_like_exo DEDDy 3  81.8     2.2 4.9E-05   29.3   3.5   27   13-39      8-36  (193)
 41 PRK05755 DNA polymerase I; Pro  81.2     1.9   4E-05   36.3   3.4   27   13-39    303-329 (880)
 42 PRK07246 bifunctional ATP-depe  80.9     2.1 4.5E-05   36.0   3.6   15   24-38      6-20  (820)
 43 PRK08074 bifunctional ATP-depe  80.6     2.1 4.6E-05   36.2   3.6   30   25-74      3-32  (928)
 44 TIGR01405 polC_Gram_pos DNA po  78.9     2.4 5.2E-05   37.3   3.5   18   23-40    188-205 (1213)
 45 COG0847 DnaQ DNA polymerase II  78.4     3.1 6.6E-05   29.0   3.4   15   25-39     13-27  (243)
 46 cd06145 REX1_like DEDDh 3'-5'   77.3     0.9 1.9E-05   30.1   0.4   13   28-40      1-13  (150)
 47 cd06129 RNaseD_like DEDDy 3'-5  77.1     2.8   6E-05   27.7   2.7   25   15-39      2-27  (161)
 48 PRK06195 DNA polymerase III su  76.5     3.5 7.6E-05   30.5   3.3   12   26-37      2-13  (309)
 49 cd06136 TREX1_2 DEDDh 3'-5' ex  74.3     1.8   4E-05   29.3   1.3   12   27-38      1-12  (177)
 50 cd06148 Egl_like_exo DEDDy 3'-  74.2     3.1 6.6E-05   28.6   2.4   23   19-41      4-26  (197)
 51 COG1949 Orn Oligoribonuclease   73.2     2.3   5E-05   30.0   1.6   17   25-41      6-22  (184)
 52 COG3325 ChiA Chitinase [Carboh  72.5     6.1 0.00013   31.4   3.9   60    1-61    145-204 (441)
 53 PRK05711 DNA polymerase III su  71.7     2.6 5.6E-05   30.4   1.6   17   24-40      3-19  (240)
 54 TIGR01406 dnaQ_proteo DNA poly  71.4     2.8 6.1E-05   29.7   1.7   15   26-40      1-15  (225)
 55 PTZ00315 2'-phosphotransferase  70.1     6.5 0.00014   32.3   3.7   32   25-74     56-87  (582)
 56 cd06143 PAN2_exo DEDDh 3'-5' e  68.3    0.54 1.2E-05   32.8  -2.4   14   28-41      1-14  (174)
 57 KOG3242|consensus               66.5     3.6 7.9E-05   29.5   1.4   15   26-40     27-41  (208)
 58 cd06125 DnaQ_like_exo DnaQ-lik  66.3       3 6.4E-05   25.6   0.9   14   28-41      1-14  (96)
 59 PRK06309 DNA polymerase III su  64.4     5.2 0.00011   28.3   1.9   15   26-40      3-17  (232)
 60 PF14943 MRP-S26:  Mitochondria  63.1     6.2 0.00013   27.4   2.0   31    2-33    136-166 (170)
 61 PF08947 BPS:  BPS (Between PH   61.9       5 0.00011   22.7   1.2   25   21-51      2-26  (49)
 62 PRK11779 sbcB exonuclease I; P  61.5     5.7 0.00012   31.6   1.9   18   23-40      4-21  (476)
 63 PF12617 LdpA_C:  Iron-Sulfur b  51.7      24 0.00052   25.0   3.5   52    9-68     21-72  (183)
 64 TIGR02841 spore_YyaC putative   49.0      24 0.00052   24.0   3.0   27    9-35     47-73  (140)
 65 PRK07983 exodeoxyribonuclease   48.8      12 0.00025   26.6   1.6   12   27-38      2-13  (219)
 66 PF05470 eIF-3c_N:  Eukaryotic   47.0     1.9 4.1E-05   35.2  -3.0   12   64-75    502-513 (595)
 67 COG3172 NadR Predicted ATPase/  39.4      42 0.00092   23.9   3.2   45    4-63    137-181 (187)
 68 cd06395 PB1_Map2k5 PB1 domain   38.8      34 0.00073   21.6   2.3   27    8-34     22-48  (91)
 69 KOG1990|consensus               37.3      25 0.00053   28.6   1.9   60   10-71    113-172 (564)
 70 PRK13772 formimidoylglutamase;  37.2 1.7E+02  0.0037   21.6   8.0   65    9-75    222-294 (314)
 71 PF09587 PGA_cap:  Bacterial ca  36.5 1.2E+02  0.0026   21.3   5.2   48   10-57     22-72  (250)
 72 KOG1076|consensus               34.0     4.4 9.6E-05   34.3  -2.8   13   64-76    532-544 (843)
 73 cd07381 MPP_CapA CapA and rela  33.7      53  0.0011   22.8   3.0   31    7-37     20-50  (239)
 74 PRK00448 polC DNA polymerase I  32.2      30 0.00065   31.4   1.8   20   21-40    415-434 (1437)
 75 PF06866 DUF1256:  Protein of u  30.5      65  0.0014   22.3   2.9   28    9-36     71-98  (163)
 76 KOG0967|consensus               30.4      41 0.00088   28.4   2.2   61   11-76    402-465 (714)
 77 COG2176 PolC DNA polymerase II  30.2      33  0.0007   31.1   1.7   22   20-41    416-437 (1444)
 78 COG4152 ABC-type uncharacteriz  30.2      73  0.0016   24.2   3.3   28   13-40    137-164 (300)
 79 smart00854 PGA_cap Bacterial c  29.7      65  0.0014   22.5   2.9   30    8-37     16-45  (239)
 80 PRK06722 exonuclease; Provisio  29.0      32  0.0007   25.6   1.3   13   24-36      4-16  (281)
 81 PRK14975 bifunctional 3'-5' ex  26.7      42 0.00091   26.9   1.6   25   14-38     11-35  (553)
 82 PF00491 Arginase:  Arginase fa  26.6 2.2E+02  0.0047   20.2   5.2   65   10-76    183-256 (277)
 83 cd06138 ExoI_N N-terminal DEDD  25.0      41 0.00089   22.6   1.2   12   29-40      2-13  (183)
 84 cd06139 DNA_polA_I_Ecoli_like_  24.6      53  0.0012   21.4   1.6   17   22-38      2-18  (193)
 85 PF13486 Dehalogenase:  Reducti  23.5      70  0.0015   23.8   2.2   36   43-80    134-169 (308)
 86 COG1618 Predicted nucleotide k  23.0      99  0.0021   21.9   2.7   23    9-31     84-107 (179)
 87 cd03114 ArgK-like The function  22.4 1.4E+02   0.003   19.5   3.3   16   23-40     90-105 (148)
 88 PF06938 DUF1285:  Protein of u  22.1      44 0.00095   22.7   0.8   17   21-37     49-65  (148)
 89 PF14305 ATPgrasp_TupA:  TupA-l  22.0 1.1E+02  0.0025   21.8   3.0   24    9-32    179-202 (239)
 90 COG1099 Predicted metal-depend  22.0 1.1E+02  0.0023   22.9   2.8   28    4-31     71-101 (254)
 91 PF00113 Enolase_C:  Enolase, C  21.8 1.2E+02  0.0026   22.7   3.2   32    7-38     75-111 (295)
 92 TIGR01229 rocF_arginase argina  20.1 3.6E+02  0.0078   19.7   7.4   63   11-75    202-273 (300)

No 1  
>PF04857 CAF1:  CAF1 family ribonuclease;  InterPro: IPR006941 CAF1 is an RNase of the DEDD superfamily, and a subunit of the Ccr4-Not complex that mediates 3' to 5' mRNA deadenylation. The major pathways of mRNA turnover in eukaryotes initiate with shortening of the poly(A) tail. CAF1 P39008 from SWISSPROT encodes a critical component of the major cytoplasmic deadenylase in yeast. Caf1p is required for normal mRNA deadenylation in vivo and localises to the cytoplasm. Caf1p copurifies with a Ccr4p-dependent poly(A)-specific exonuclease activity. Some members of this family contain a single-stranded nucleic acid binding domain, R3H.; GO: 0005634 nucleus; PDB: 3D45_B 1UG8_A 2D5R_A 2A1S_C 2A1R_A 2FC6_A 1UOC_A 3G10_A 2P51_A 3G0Z_A.
Probab=99.90  E-value=1e-24  Score=157.16  Aligned_cols=69  Identities=38%  Similarity=0.561  Sum_probs=62.2

Q ss_pred             cCccccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeee
Q psy6931           5 QHPMILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAF   73 (81)
Q Consensus         5 ~~~~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F   73 (81)
                      +|+++||+++||.|+++|++|+|||||+||||+..++.....+|+++||+++|++|+.|.++|+|||+|
T Consensus         2 ~Vt~~Nf~~~l~~i~~~i~~~~fvaiD~EftGl~~~~~~~~~~t~~~rY~~~r~~v~~~~iiQ~Glt~f   70 (262)
T PF04857_consen    2 EVTRSNFEEELPEILQAISKADFVAIDTEFTGLVSKPPRSRFDTPEERYEKLRANVETFQIIQFGLTLF   70 (262)
T ss_dssp             EE-CCCHHHHHHHHHHHHHHSSEEEEEEEES-S-SSS-SHCSSHHHHHHHHHHHHHTTBEEEEEEEEEE
T ss_pred             cccHHHHHHHHHHHHHHHhhCCEEEEEeeccccccCCCccccccHHHHHHHHHHhhcccccceeeEEEe
Confidence            689999999999999999999999999999999988753389999999999999999999999999999


No 2  
>KOG0304|consensus
Probab=99.71  E-value=1.5e-17  Score=119.48  Aligned_cols=70  Identities=19%  Similarity=0.200  Sum_probs=62.3

Q ss_pred             ccccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931           7 PMILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus         7 ~~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      =+.|+++++..|+++|++|+||||||||||+..++......+.+.+|+.+|.||+..++||+|||.+-..
T Consensus         6 W~~Nl~~Em~~Ir~~v~~y~~IamDTEFPGvv~rp~~~f~s~~d~~Y~~lk~NVd~lklIQlGlTlsd~~   75 (239)
T KOG0304|consen    6 WRSNLEEEMALIRECVKDYPYIAMDTEFPGVVARPIGTFRSSDDYHYQTLKCNVDNLKLIQLGLTLSDEK   75 (239)
T ss_pred             HHHhHHHHHHHHHHHHHhCCeeEecCcCCceeeecCccccCChHHHHHHHHhchhhhhhhheeeeeeccC
Confidence            3689999999999999999999999999999988853333688889999999999999999999998654


No 3  
>COG5228 POP2 mRNA deadenylase subunit [RNA processing and modification]
Probab=99.40  E-value=4e-13  Score=97.68  Aligned_cols=65  Identities=20%  Similarity=0.225  Sum_probs=57.4

Q ss_pred             cccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCH-HHHHHHHHhccccccceeeeeeee
Q psy6931           8 MILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTP-AQYYDKIRQGSMDFLLIQFGLCAF   73 (81)
Q Consensus         8 ~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~-eerY~~~k~~v~~f~iiQ~Gl~~F   73 (81)
                      +.|+..++..|+++|.++.+|+|||||+|+..+|. ..+.+. +=.|+.+|.||+..+|||+||+.-
T Consensus        25 k~NL~~Em~~I~qLi~rYn~vSmdTEFpGvvArPi-G~FkSs~dyhYQtlraNVD~LkiIQlGlsLS   90 (299)
T COG5228          25 KSNLYSEMAVIRQLISRYNHVSMDTEFPGVVARPI-GTFKSSVDYHYQTLRANVDFLKIIQLGLSLS   90 (299)
T ss_pred             HhhHHHHHHHHHHHHHhCCceeeccccCceeeccc-ccccccchHHHHHHhcccchhhhhheeeeec
Confidence            48999999999999999999999999999999885 444444 445999999999999999999873


No 4  
>KOG1990|consensus
Probab=99.07  E-value=1.8e-11  Score=97.13  Aligned_cols=69  Identities=22%  Similarity=0.279  Sum_probs=64.3

Q ss_pred             cccHHHHHHHHHHHhccCCeEEEeccCCCCccCCC--CCCCCCHHHHHHHHHhccccccceeeeeeeeeecC
Q psy6931           8 MILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPN--TTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYDN   77 (81)
Q Consensus         8 ~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~--~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~~   77 (81)
                      |.||+. +..+...|.+++|+++|.|++|+...+.  .+.+|+++.+|++.|.++..|.++|+|+|.|.++.
T Consensus         1 ~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~y~k~k~~~~~~~~~q~~~~~~~~~~   71 (564)
T KOG1990|consen    1 RSNFES-LSLAELTVDEADLRRLRLVATGMTSAPWKAGSTFDTVEAIYLKWKDNEEVYLKFQFGLCLFMKRS   71 (564)
T ss_pred             CCcccc-hhHHHhhcCHHHHHHHhhhhccceecccccccchhhhHHHHHHHHhhhhhheeeccccchhHHHh
Confidence            579999 9999999999999999999999987664  68899999999999999999999999999999874


No 5  
>PRK09145 DNA polymerase III subunit epsilon; Validated
Probab=95.26  E-value=0.037  Score=38.23  Aligned_cols=23  Identities=26%  Similarity=0.277  Sum_probs=17.5

Q ss_pred             HHHHHhccCCeEEEeccCCCCcc
Q psy6931          17 RYAKAIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        17 ~i~~~I~~a~FVAiD~EFtGl~~   39 (81)
                      .+.+......||+||+|.||+.+
T Consensus        21 ~~~~~~~~~~~vviD~ETTGl~~   43 (202)
T PRK09145         21 FLFEPPPPDEWVALDCETTGLDP   43 (202)
T ss_pred             HHhcCCCCCCEEEEEeECCCCCC
Confidence            34444566799999999999854


No 6  
>PRK05168 ribonuclease T; Provisional
Probab=94.33  E-value=0.095  Score=36.74  Aligned_cols=41  Identities=24%  Similarity=0.341  Sum_probs=31.6

Q ss_pred             HHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          15 TTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        15 l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      +.-|...++...||++|+|-||+.....                     .|||+|...++.+
T Consensus         7 ~~~~~~~~~~~~~vv~D~ETTGl~~~~d---------------------~IieIgaV~v~~d   47 (211)
T PRK05168          7 LNPLKDRFRGFLPVVIDVETAGFNAKTD---------------------ALLEIAAVTLKMD   47 (211)
T ss_pred             cchHHHHhcCCceEEEEeeCCCCCCCCC---------------------EEEEEeEEEEEec
Confidence            4457888999999999999999976431                     2888887776643


No 7  
>PRK07247 DNA polymerase III subunit epsilon; Validated
Probab=94.31  E-value=0.051  Score=38.02  Aligned_cols=27  Identities=22%  Similarity=0.395  Sum_probs=20.8

Q ss_pred             CeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeee
Q psy6931          26 LFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFK   74 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~   74 (81)
                      .||++|+|.||+..  .                    -.|||+|...+.
T Consensus         6 ~~vvlD~EtTGl~~--~--------------------~eIIeIgaV~v~   32 (195)
T PRK07247          6 TYIAFDLEFNTVNG--V--------------------SHIIQVSAVKYD   32 (195)
T ss_pred             eEEEEEeeCCCCCC--C--------------------CeEEEEEEEEEE
Confidence            79999999999842  1                    158999987664


No 8  
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases.
Probab=93.96  E-value=0.086  Score=34.20  Aligned_cols=14  Identities=50%  Similarity=0.634  Sum_probs=12.2

Q ss_pred             CeEEEeccCCCCcc
Q psy6931          26 LFVTIDGEFTGLNN   39 (81)
Q Consensus        26 ~FVAiD~EFtGl~~   39 (81)
                      .||++|+|+||+.+
T Consensus         1 ~~v~~D~Ettg~~~   14 (169)
T smart00479        1 TLVVIDCETTGLDP   14 (169)
T ss_pred             CEEEEEeeCCCCCC
Confidence            48999999999865


No 9  
>PRK07748 sporulation inhibitor KapD; Provisional
Probab=93.43  E-value=0.14  Score=35.51  Aligned_cols=17  Identities=29%  Similarity=0.303  Sum_probs=14.2

Q ss_pred             cCCeEEEeccCCCCccC
Q psy6931          24 SALFVTIDGEFTGLNNG   40 (81)
Q Consensus        24 ~a~FVAiD~EFtGl~~~   40 (81)
                      +..||++|+|.||+...
T Consensus         3 ~~~~vvlD~EtTg~~~~   19 (207)
T PRK07748          3 EQQFLFLDFEFTMPQHK   19 (207)
T ss_pred             cceEEEEEeecCCcCCC
Confidence            46799999999998654


No 10 
>PRK09146 DNA polymerase III subunit epsilon; Validated
Probab=93.38  E-value=0.12  Score=37.17  Aligned_cols=20  Identities=35%  Similarity=0.502  Sum_probs=17.4

Q ss_pred             HhccCCeEEEeccCCCCccC
Q psy6931          21 AIKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~~   40 (81)
                      -+.+.+||++|+|-||+.+.
T Consensus        43 ~~~~~~~vviD~ETTGl~p~   62 (239)
T PRK09146         43 PLSEVPFVALDFETTGLDAE   62 (239)
T ss_pred             CcccCCEEEEEeECCCCCCC
Confidence            57789999999999999753


No 11 
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family. All proteins in this family for which functions are known are components of the DNA polymerase III complex (epsilon subunit). There is, however, an outgroup that includes paralogs in some gamma-proteobacteria and the n-terminal region of DinG from some low GC gram positive bacteria. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.34  E-value=0.12  Score=36.22  Aligned_cols=19  Identities=32%  Similarity=0.163  Sum_probs=16.4

Q ss_pred             HhccCCeEEEeccCCCCcc
Q psy6931          21 AIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~   39 (81)
                      .++...||++|+|-||+.+
T Consensus         3 ~l~~~~fvv~D~ETTGl~~   21 (217)
T TIGR00573         3 QLVLDTETTGDNETTGLYA   21 (217)
T ss_pred             eEEecCEEEEEecCCCCCC
Confidence            4678899999999999864


No 12 
>cd06133 ERI-1_3'hExo_like DEDDh 3'-5' exonuclease domain of Caenorhabditis elegans ERI-1, human 3' exonuclease, and similar proteins. This subfamily is composed of Caenorhabditis elegans ERI-1, human 3' exonuclease (3'hExo), Drosophila exonuclease snipper (snp), and similar proteins from eukaryotes and bacteria. These are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ERI-1 has been implicated in the degradation of small interfering RNAs (RNAi). 3'hExo participates in the degradation of histone mRNAs. Snp is a non-essential exonuclease that efficiently degrades structured RNA and DNA substrates as long as there is a minimum of 2 nucleotides in the 3' overhang to initiate degradation. Snp is not a functional ho
Probab=93.29  E-value=0.13  Score=33.79  Aligned_cols=34  Identities=18%  Similarity=0.200  Sum_probs=23.3

Q ss_pred             eEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          27 FVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        27 FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      ||.+|+|.||+.....                .-..-.|+|+|...+..+
T Consensus         1 ~vv~D~Ettg~~~~~~----------------~~~~~~IieIgav~v~~~   34 (176)
T cd06133           1 YLVIDFEATCWEGNSK----------------PDYPNEIIEIGAVLVDVK   34 (176)
T ss_pred             CEEEEeeccccCCCCC----------------CCCCcceEEEEEEEEEcC
Confidence            7999999999976431                111235899998766543


No 13 
>PRK06310 DNA polymerase III subunit epsilon; Validated
Probab=92.91  E-value=0.14  Score=36.91  Aligned_cols=19  Identities=42%  Similarity=0.580  Sum_probs=16.6

Q ss_pred             HhccCCeEEEeccCCCCcc
Q psy6931          21 AIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~   39 (81)
                      +|++..||.+|+|-||+..
T Consensus         3 ~l~~~~~v~~D~ETTGl~~   21 (250)
T PRK06310          3 LLKDTEFVCLDCETTGLDV   21 (250)
T ss_pred             cccCCcEEEEEEeCCCCCC
Confidence            5677899999999999865


No 14 
>PF00929 RNase_T:  Exonuclease;  InterPro: IPR013520 This entry includes a variety of exonuclease proteins, such as ribonuclease T [] and the epsilon subunit of DNA polymerase III. Ribonuclease T is responsible for the end-turnover of tRNA,and removes the terminal AMP residue from uncharged tRNA. DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria, and also exhibits 3' to 5' exonuclease activity.; PDB: 3CM6_A 3CM5_A 3CG7_A 1ZBU_B 1ZBH_A 1W0H_A 3NGY_C 2IS3_B 3NH1_C 3NH2_F ....
Probab=92.91  E-value=0.12  Score=32.51  Aligned_cols=12  Identities=50%  Similarity=0.661  Sum_probs=10.7

Q ss_pred             EEEeccCCCCcc
Q psy6931          28 VTIDGEFTGLNN   39 (81)
Q Consensus        28 VAiD~EFtGl~~   39 (81)
                      |.||+|+||+..
T Consensus         1 v~~D~Ettg~~~   12 (164)
T PF00929_consen    1 VVFDTETTGLDP   12 (164)
T ss_dssp             EEEEEEESSSTT
T ss_pred             cEEEeEcCCCCC
Confidence            689999999976


No 15 
>PRK07883 hypothetical protein; Validated
Probab=92.64  E-value=0.12  Score=41.50  Aligned_cols=23  Identities=26%  Similarity=0.368  Sum_probs=19.3

Q ss_pred             HHHHHhccCCeEEEeccCCCCcc
Q psy6931          17 RYAKAIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        17 ~i~~~I~~a~FVAiD~EFtGl~~   39 (81)
                      .+..-|++..||+||+|.||+.+
T Consensus         7 ~~~~~~~~~~~Vv~D~ETTGl~p   29 (557)
T PRK07883          7 DLGTPLRDVTFVVVDLETTGGSP   29 (557)
T ss_pred             hhCCCCcCCCEEEEEEecCCCCC
Confidence            44567889999999999999954


No 16 
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis]
Probab=92.62  E-value=0.12  Score=39.80  Aligned_cols=28  Identities=18%  Similarity=0.288  Sum_probs=23.5

Q ss_pred             HHHHHHHHHhccCCeEEEeccCCCCccC
Q psy6931          13 NITTRYAKAIKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        13 ~~l~~i~~~I~~a~FVAiD~EFtGl~~~   40 (81)
                      +.+..+...+..|.+|||||||.|+...
T Consensus         5 ~~l~~~~~~~~~~~~iAiDTEf~r~~t~   32 (361)
T COG0349           5 DLLAAACALLRGSKAIAIDTEFMRLRTY   32 (361)
T ss_pred             hHHHHHHHHhcCCCceEEeccccccccc
Confidence            4567778889999999999999998653


No 17 
>PF01612 DNA_pol_A_exo1:  3'-5' exonuclease;  InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides. This domain consists of the amino-terminal half of the Klenow fragment in E. coli polI it is also found in the Werner syndrome helicase (WRN), focus forming activity 1 protein (FFA-1) and ribonuclease D (RNase D) [].; GO: 0003676 nucleic acid binding, 0008408 3'-5' exonuclease activity, 0006139 nucleobase-containing compound metabolic process, 0005622 intracellular; PDB: 2HBK_A 2HBJ_A 2HBM_A 2HBL_A 2FC0_A 2FBY_A 2FBX_A 2FBT_A 2FBV_A 1YT3_A ....
Probab=91.98  E-value=0.17  Score=32.77  Aligned_cols=28  Identities=29%  Similarity=0.329  Sum_probs=24.5

Q ss_pred             HHHHHHHHHHhccCCeEEEeccCCCCcc
Q psy6931          12 HNITTRYAKAIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        12 ~~~l~~i~~~I~~a~FVAiD~EFtGl~~   39 (81)
                      .+.+..+.+.+.++..||+|+|.+|+..
T Consensus         7 ~~~l~~~~~~l~~~~~~a~D~E~~~~~~   34 (176)
T PF01612_consen    7 EEELEEAIKKLKNAKVLAFDTETTGLDP   34 (176)
T ss_dssp             HHHHHHHHHHHTTTSEEEEEEEEETSTS
T ss_pred             HHHHHHHHHHHcCCCeEEEEEEECCCCc
Confidence            4667788889999999999999999876


No 18 
>PRK07942 DNA polymerase III subunit epsilon; Provisional
Probab=91.54  E-value=0.32  Score=34.55  Aligned_cols=17  Identities=24%  Similarity=0.331  Sum_probs=14.8

Q ss_pred             ccCCeEEEeccCCCCcc
Q psy6931          23 KSALFVTIDGEFTGLNN   39 (81)
Q Consensus        23 ~~a~FVAiD~EFtGl~~   39 (81)
                      .+..||++|+|-||+.+
T Consensus         4 ~~~~~vv~D~ETTGl~p   20 (232)
T PRK07942          4 HPGPLAAFDLETTGVDP   20 (232)
T ss_pred             ccCcEEEEEeccCCCCC
Confidence            46789999999999964


No 19 
>PRK09182 DNA polymerase III subunit epsilon; Validated
Probab=91.49  E-value=0.31  Score=36.18  Aligned_cols=30  Identities=43%  Similarity=0.633  Sum_probs=23.2

Q ss_pred             CeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          26 LFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      .+|++|+|-||+....                     =.|||+|+..|..+
T Consensus        38 ~~vvlD~ETTGLd~~~---------------------d~IIEIg~V~v~~~   67 (294)
T PRK09182         38 LGVILDTETTGLDPRK---------------------DEIIEIGMVAFEYD   67 (294)
T ss_pred             eEEEEEeeCCCCCCCC---------------------CeEEEEEEEEEEec
Confidence            5899999999997543                     24888888887754


No 20 
>TIGR01298 RNaseT ribonuclease T. in gamma-subdivision Proteobacteria such as Escherichia coli and Xylella fastidiosa. Ribonuclease T is homologous to the DNA polymerase III alpha chain. It can liberate AMP from the common C-C-A terminus of uncharged tRNA. It appears also to be involved in RNA maturation. It also acts as a 3' to 5' single-strand DNA-specific exonuclease; it is distinctive for its ability to remove residues near a double-stranded stem. Ribonuclease T is a high copy suppressor in E. coli of a uv-repair defect caused by deletion of three other single-stranded DNA exonucleases.
Probab=91.37  E-value=0.39  Score=33.35  Aligned_cols=19  Identities=32%  Similarity=0.375  Sum_probs=16.0

Q ss_pred             hccCCeEEEeccCCCCccC
Q psy6931          22 IKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        22 I~~a~FVAiD~EFtGl~~~   40 (81)
                      -..+.||++|+|-||+.+.
T Consensus         5 ~~~~~~vv~D~ETTGl~~~   23 (200)
T TIGR01298         5 FRGYLPVVVDVETGGFNAK   23 (200)
T ss_pred             hcCCeeEEEEeeCCCCCCC
Confidence            3568899999999999764


No 21 
>PRK06807 DNA polymerase III subunit epsilon; Validated
Probab=91.22  E-value=0.26  Score=36.92  Aligned_cols=28  Identities=32%  Similarity=0.328  Sum_probs=21.5

Q ss_pred             CCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeee
Q psy6931          25 ALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAF   73 (81)
Q Consensus        25 a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F   73 (81)
                      .+||++|+|.||+.+.                     .-.|||+|...+
T Consensus         8 ~~~Vv~DlETTGl~p~---------------------~~eIIEIgaV~v   35 (313)
T PRK06807          8 LDYVVIDFETTGFNPY---------------------NDKIIQVAAVKY   35 (313)
T ss_pred             CCEEEEEEECCCCCCC---------------------CCeEEEEEEEEE
Confidence            3799999999998642                     136899997665


No 22 
>PRK06063 DNA polymerase III subunit epsilon; Provisional
Probab=91.12  E-value=0.29  Score=36.50  Aligned_cols=31  Identities=16%  Similarity=0.292  Sum_probs=22.7

Q ss_pred             cCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeee
Q psy6931          24 SALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKY   75 (81)
Q Consensus        24 ~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~   75 (81)
                      .-+||++|+|-||+....                     -.|||+|+..+..
T Consensus        14 ~~~fvvlD~ETTGl~p~~---------------------d~IIeIgav~v~~   44 (313)
T PRK06063         14 PRGWAVVDVETSGFRPGQ---------------------ARIISLAVLGLDA   44 (313)
T ss_pred             CCCEEEEEEECCCCCCCC---------------------CEEEEEEEEEEEC
Confidence            357999999999986431                     2578888776653


No 23 
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.
Probab=91.01  E-value=0.25  Score=31.02  Aligned_cols=28  Identities=29%  Similarity=0.331  Sum_probs=19.7

Q ss_pred             EEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          28 VTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        28 VAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      |.+|+|.||+.+.                     .-.|+|+|.+.+..+
T Consensus         1 v~~D~Ettg~~~~---------------------~~~iiei~~v~~~~~   28 (159)
T cd06127           1 VVFDTETTGLDPK---------------------KDRIIEIGAVKVDGG   28 (159)
T ss_pred             CeEEeeCCCcCCC---------------------CCeEEEEEEEEEECC
Confidence            5799999998642                     234777777776543


No 24 
>PRK05359 oligoribonuclease; Provisional
Probab=90.92  E-value=0.15  Score=35.10  Aligned_cols=18  Identities=33%  Similarity=0.385  Sum_probs=14.7

Q ss_pred             cCCeEEEeccCCCCccCC
Q psy6931          24 SALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        24 ~a~FVAiD~EFtGl~~~~   41 (81)
                      .-.||++|+|.|||.+..
T Consensus         2 ~~~~vvlD~ETTGLdp~~   19 (181)
T PRK05359          2 EDNLIWIDLEMTGLDPER   19 (181)
T ss_pred             CCcEEEEEeecCCCCCCC
Confidence            347999999999998643


No 25 
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III. This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (Pol III), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. The Pol III holoenzyme is a complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that ser
Probab=90.83  E-value=0.31  Score=31.40  Aligned_cols=11  Identities=45%  Similarity=0.477  Sum_probs=10.0

Q ss_pred             eEEEeccCCCC
Q psy6931          27 FVTIDGEFTGL   37 (81)
Q Consensus        27 FVAiD~EFtGl   37 (81)
                      ||++|+|.||.
T Consensus         1 ~v~~D~Ettg~   11 (156)
T cd06130           1 FVAIDFETANA   11 (156)
T ss_pred             CEEEEEeCCCC
Confidence            79999999984


No 26 
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. RNase T is a DEDDh-type DnaQ-like 3'-5' exoribonuclease E implicated in the 3' maturation of small stable RNAs and 23srRNA, and in the end turnover of tRNA. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. RNase T is related to the proofreading domain of DNA polymerase III. Despite its important role, RNase T is mainly found only in gammaproteobacteria. It is speculated that it might have originated from DNA polymerase III at the time the gamma division of proteobacteria diverged from other bacteria. RNase T is a homodimer with the catalytic residues of one monomer contacting a large basic patch on the other monomer to form a functional active site.
Probab=90.62  E-value=0.52  Score=32.34  Aligned_cols=19  Identities=32%  Similarity=0.349  Sum_probs=15.3

Q ss_pred             ccCCeEEEeccCCCCccCC
Q psy6931          23 KSALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        23 ~~a~FVAiD~EFtGl~~~~   41 (81)
                      +...+|++|+|-||+.+..
T Consensus         3 ~~~~~vv~D~ETTGl~~~~   21 (189)
T cd06134           3 RGFLPVVVDVETGGFNPQT   21 (189)
T ss_pred             ccceeEEEEecCCCCCCCC
Confidence            4567899999999997643


No 27 
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins. Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20) is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA. It was also independently identified by its response to estrogen and was called HEM45 (human estrogen regulated transcript). ISG20 is a DEDDh-type DnaQ-like 3'-5' exonuclease containing three conserved sequence motifs termed ExoI, ExoII and ExoIII with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. ISG20 may be a major effector of innate immunity against pathogens including viruses, bacteria, and parasites. It is located in promyelocytic leukemia (PML) nuclear bodies, sites for oncogenic DNA viral transcription and repli
Probab=89.70  E-value=0.14  Score=34.21  Aligned_cols=13  Identities=46%  Similarity=0.700  Sum_probs=11.4

Q ss_pred             EEEeccCCCCccC
Q psy6931          28 VTIDGEFTGLNNG   40 (81)
Q Consensus        28 VAiD~EFtGl~~~   40 (81)
                      ||||+|+||+.+.
T Consensus         1 v~~D~EttGl~~~   13 (157)
T cd06149           1 VAIDCEMVGTGPG   13 (157)
T ss_pred             CEEEeEeccccCC
Confidence            6899999999864


No 28 
>PRK07740 hypothetical protein; Provisional
Probab=89.66  E-value=0.24  Score=35.59  Aligned_cols=23  Identities=26%  Similarity=0.306  Sum_probs=18.0

Q ss_pred             HHHHhccCCeEEEeccCCCCccC
Q psy6931          18 YAKAIKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        18 i~~~I~~a~FVAiD~EFtGl~~~   40 (81)
                      +..-+++.+||.+|+|.||+.+.
T Consensus        52 ~~~~~~~~~~vv~D~ETTGl~p~   74 (244)
T PRK07740         52 LDIPLTDLPFVVFDLETTGFSPQ   74 (244)
T ss_pred             cCCCccCCCEEEEEEeCCCCCCC
Confidence            33446778999999999998753


No 29 
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins. This subfamily is composed of the epsilon subunit of Escherichia coli DNA polymerase III (Pol III) and similar proteins. Pol III is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. It is a holoenzyme complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon 
Probab=88.87  E-value=0.62  Score=30.58  Aligned_cols=13  Identities=38%  Similarity=0.583  Sum_probs=11.5

Q ss_pred             eEEEeccCCCCcc
Q psy6931          27 FVTIDGEFTGLNN   39 (81)
Q Consensus        27 FVAiD~EFtGl~~   39 (81)
                      ||++|+|-||+.+
T Consensus         1 ~v~~D~ETTGl~~   13 (167)
T cd06131           1 QIVLDTETTGLDP   13 (167)
T ss_pred             CEEEEeeCCCCCC
Confidence            6899999999864


No 30 
>TIGR01388 rnd ribonuclease D. This model describes ribonuclease D, a 3'-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo. Trusted members of this family are restricted to the Proteobacteria; Aquifex, Mycobacterial, and eukaryotic homologs are not full-length homologs. Ribonuclease D is not essential in E. coli and is deleterious when overexpressed. Its precise biological role is still unknown.
Probab=88.84  E-value=0.57  Score=35.63  Aligned_cols=26  Identities=23%  Similarity=0.370  Sum_probs=21.7

Q ss_pred             HHHHHHHHHhccCCeEEEeccCCCCc
Q psy6931          13 NITTRYAKAIKSALFVTIDGEFTGLN   38 (81)
Q Consensus        13 ~~l~~i~~~I~~a~FVAiD~EFtGl~   38 (81)
                      +.|..+.+.+..++.|||||||.+..
T Consensus         6 ~~l~~~~~~l~~~~~ia~DtE~~~~~   31 (367)
T TIGR01388         6 DELATVCEAVRTFPFVALDTEFVRER   31 (367)
T ss_pred             HHHHHHHHHHhcCCEEEEeccccCCC
Confidence            56777778888999999999998763


No 31 
>cd06135 Orn DEDDh 3'-5' exonuclease domain of oligoribonuclease and similar proteins. Oligoribonuclease (Orn) is a DEDDh-type DnaQ-like 3'-5' exoribonuclease that is responsible for degrading small oligoribonucleotides to mononucleotides. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. Orn is essential for Escherichia coli survival. The human homolog, also called Sfn (small fragment nuclease), is able to hydrolyze short single-stranded RNA and DNA oligomers. It plays a role in cellular nucleotide recycling.
Probab=88.17  E-value=0.64  Score=31.42  Aligned_cols=14  Identities=50%  Similarity=0.596  Sum_probs=12.0

Q ss_pred             eEEEeccCCCCccC
Q psy6931          27 FVTIDGEFTGLNNG   40 (81)
Q Consensus        27 FVAiD~EFtGl~~~   40 (81)
                      ||.+|+|-||+.+.
T Consensus         1 lv~iD~ETTGl~p~   14 (173)
T cd06135           1 LVWIDLEMTGLDPE   14 (173)
T ss_pred             CEEEEEecCCCCCC
Confidence            68899999999763


No 32 
>PRK08517 DNA polymerase III subunit epsilon; Provisional
Probab=87.69  E-value=0.83  Score=33.24  Aligned_cols=33  Identities=27%  Similarity=0.389  Sum_probs=25.3

Q ss_pred             HhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeee
Q psy6931          21 AIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFK   74 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~   74 (81)
                      -+.+..||++|+|-||+....                     -.|||+|...+.
T Consensus        64 ~~~~~~~vv~DiETTG~~~~~---------------------~~IIEIGAv~v~   96 (257)
T PRK08517         64 PIKDQVFCFVDIETNGSKPKK---------------------HQIIEIGAVKVK   96 (257)
T ss_pred             CCCCCCEEEEEEeCCCCCCCC---------------------CeEEEEEEEEEE
Confidence            357889999999999975432                     258888887764


No 33 
>PRK05601 DNA polymerase III subunit epsilon; Validated
Probab=86.82  E-value=0.46  Score=36.89  Aligned_cols=21  Identities=29%  Similarity=0.479  Sum_probs=18.1

Q ss_pred             HhccCCeEEEeccCCCCccCC
Q psy6931          21 AIKSALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~~~   41 (81)
                      .++++.||+||+|-|||.+..
T Consensus        42 ~~~~~~fVvlDiETTGLdp~~   62 (377)
T PRK05601         42 AIEAAPFVAVSIQTSGIHPST   62 (377)
T ss_pred             CCCCCCEEEEEEECCCCCCCC
Confidence            578899999999999997643


No 34 
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins. This group is composed of eukaryotic exoribonucleases that include PAN2, RNA exonuclease 1 (REX1 or Rex1p), REX3 (Rex3p), REX4 (or Rex4p), ISG20, and similar proteins. They are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. PAN2 is the catalytic subunit of poly(A) nuclease (PAN), a Pab1p-dependent 3'-5' exoribonuclease which plays an important role in the posttranscriptional maturation of pre-mRNAs. REX proteins are required for the processing and maturation of many RNA species, and ISG20 is an interferon-induced antiviral exonuclease with a strong prefere
Probab=86.50  E-value=0.25  Score=33.04  Aligned_cols=13  Identities=46%  Similarity=0.866  Sum_probs=11.3

Q ss_pred             EEEeccCCCCccC
Q psy6931          28 VTIDGEFTGLNNG   40 (81)
Q Consensus        28 VAiD~EFtGl~~~   40 (81)
                      |++|+|+||+.+.
T Consensus         1 v~lD~EttGl~~~   13 (161)
T cd06137           1 VALDCEMVGLADG   13 (161)
T ss_pred             CEEEeeeeeEcCC
Confidence            6899999999764


No 35 
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins. WRN is a unique RecQ DNA helicase exhibiting an exonuclease activity. It contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. Mutations in the WRN gene cause Werner syndrome, an autosomal recessive disorder associated with premature aging and increased susceptibility to cancer and type II diabetes. WRN interacts with key proteins involved in DNA replication, recombination, and repair. It is believed to maintain genomic stability and life span by participating in DNA processes. WRN is stimulated by Ku70/80, an important regulator of genomic stability.
Probab=86.26  E-value=1.2  Score=29.37  Aligned_cols=27  Identities=15%  Similarity=0.065  Sum_probs=20.2

Q ss_pred             HHHHHHHHHhc-cCCeEEEeccCCCCcc
Q psy6931          13 NITTRYAKAIK-SALFVTIDGEFTGLNN   39 (81)
Q Consensus        13 ~~l~~i~~~I~-~a~FVAiD~EFtGl~~   39 (81)
                      +.+..+.+.+. ++..|++|+|+++...
T Consensus         5 ~~~~~~~~~~~~~~~~ig~D~E~~~~~~   32 (170)
T cd06141           5 QDAEEAVKELLGKEKVVGFDTEWRPSFR   32 (170)
T ss_pred             HHHHHHHHHHhcCCCEEEEeCccCCccC
Confidence            34455555555 9999999999999754


No 36 
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins. This subfamily is composed of RNA exonuclease 4 (REX4 or Rex4p), XPMC2, Interferon (IFN) Stimulated Gene product of 20 kDa (ISG20), and similar proteins. REX4 is involved in pre-rRNA processing. It controls the ratio between the two forms of 5.8S rRNA in yeast. XPMC2 is a Xenopus gene which was identified through its ability to correct a mitotic defect in fission yeast. The human homolog of XPMC2 (hPMC2) may be involved in angiotensin II-induced adrenal cell cycle progression and cell proliferation. ISG20 is an IFN-induced antiviral exonuclease with a strong preference for single-stranded RNA and minor activity towards single-stranded DNA. These proteins are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clus
Probab=85.49  E-value=0.33  Score=32.09  Aligned_cols=13  Identities=31%  Similarity=0.583  Sum_probs=11.1

Q ss_pred             EEEeccCCCCccC
Q psy6931          28 VTIDGEFTGLNNG   40 (81)
Q Consensus        28 VAiD~EFtGl~~~   40 (81)
                      |+||+|.||+..+
T Consensus         1 v~lD~EttGl~~~   13 (152)
T cd06144           1 VALDCEMVGVGPD   13 (152)
T ss_pred             CEEEEEeecccCC
Confidence            6899999999754


No 37 
>KOG2249|consensus
Probab=85.38  E-value=0.46  Score=35.60  Aligned_cols=16  Identities=25%  Similarity=0.391  Sum_probs=14.2

Q ss_pred             CeEEEeccCCCCccCC
Q psy6931          26 LFVTIDGEFTGLNNGP   41 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~~   41 (81)
                      .+|||||||-|++++.
T Consensus       106 r~vAmDCEMVG~Gp~G  121 (280)
T KOG2249|consen  106 RVVAMDCEMVGVGPDG  121 (280)
T ss_pred             eEEEEeeeEeccCCCc
Confidence            4999999999998864


No 38 
>PRK10829 ribonuclease D; Provisional
Probab=85.16  E-value=1.2  Score=34.28  Aligned_cols=27  Identities=15%  Similarity=0.233  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHhccCCeEEEeccCCCCc
Q psy6931          12 HNITTRYAKAIKSALFVTIDGEFTGLN   38 (81)
Q Consensus        12 ~~~l~~i~~~I~~a~FVAiD~EFtGl~   38 (81)
                      .+.|..+.+.+..++.||+||||.+..
T Consensus         9 ~~~L~~~~~~l~~~~~lalDtEf~~~~   35 (373)
T PRK10829          9 DDALASVCEAARAFPAIALDTEFVRTR   35 (373)
T ss_pred             HHHHHHHHHHHhcCCeEEEecccccCc
Confidence            355666666789999999999998754


No 39 
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative. This model represents a family of proteins in Gram-positive bacteria. The N-terminal region of about 200 amino acids resembles the epsilon subunit of E. coli DNA polymerase III and the homologous region of the Gram-positive type DNA polymerase III alpha subunit. The epsilon subunit contains an exonuclease domain. The remainder of this protein family resembles a predicted ATP-dependent helicase, the DNA damage-inducible protein DinG of E. coli.
Probab=83.45  E-value=1.4  Score=36.75  Aligned_cols=28  Identities=25%  Similarity=0.294  Sum_probs=20.9

Q ss_pred             CeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeee
Q psy6931          26 LFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFK   74 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~   74 (81)
                      .||++|+|-||+.+..                     =.|||+|...+.
T Consensus         1 ~~vvvD~ETTG~~~~~---------------------~~IIeig~v~v~   28 (850)
T TIGR01407         1 RYAVVDLETTGTQLSF---------------------DKIIQIGIVVVE   28 (850)
T ss_pred             CEEEEEEECCCCCCCC---------------------CeEEEEEEEEEE
Confidence            4999999999986422                     238888887763


No 40 
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins. The mut-7 subfamily is composed of Caenorhabditis elegans mut-7 and similar proteins found in plants and metazoans. Mut-7 is implicated in posttranscriptional gene silencing. It contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs, termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis.
Probab=81.79  E-value=2.2  Score=29.33  Aligned_cols=27  Identities=19%  Similarity=0.097  Sum_probs=20.3

Q ss_pred             HHHHHHHHH--hccCCeEEEeccCCCCcc
Q psy6931          13 NITTRYAKA--IKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        13 ~~l~~i~~~--I~~a~FVAiD~EFtGl~~   39 (81)
                      +++..+...  +.++.-||+|+|+.+...
T Consensus         8 ~el~~~~~~~~l~~~~vig~D~Ew~~~~~   36 (193)
T cd06146           8 EELEALLLALSLEAGRVVGIDSEWKPSFL   36 (193)
T ss_pred             HHHHHHHHHHhhccCCEEEEECccCCCcc
Confidence            445555555  999999999999986543


No 41 
>PRK05755 DNA polymerase I; Provisional
Probab=81.18  E-value=1.9  Score=36.30  Aligned_cols=27  Identities=22%  Similarity=0.252  Sum_probs=21.2

Q ss_pred             HHHHHHHHHhccCCeEEEeccCCCCcc
Q psy6931          13 NITTRYAKAIKSALFVTIDGEFTGLNN   39 (81)
Q Consensus        13 ~~l~~i~~~I~~a~FVAiD~EFtGl~~   39 (81)
                      +.+..+...+.++.++|+|+|++|+..
T Consensus       303 ~~L~~~l~~l~~~~~~a~DtEt~~l~~  329 (880)
T PRK05755        303 EELEAWLAKLKAAGLFAFDTETTSLDP  329 (880)
T ss_pred             HHHHHHHHHhhccCeEEEEeccCCCCc
Confidence            445555666788999999999999853


No 42 
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated
Probab=80.88  E-value=2.1  Score=35.96  Aligned_cols=15  Identities=27%  Similarity=0.299  Sum_probs=13.1

Q ss_pred             cCCeEEEeccCCCCc
Q psy6931          24 SALFVTIDGEFTGLN   38 (81)
Q Consensus        24 ~a~FVAiD~EFtGl~   38 (81)
                      ...||++|+|-||+.
T Consensus         6 ~~~~vvvD~ETTGl~   20 (820)
T PRK07246          6 LRKYAVVDLEATGAG   20 (820)
T ss_pred             CCCEEEEEEecCCcC
Confidence            467999999999984


No 43 
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated
Probab=80.55  E-value=2.1  Score=36.21  Aligned_cols=30  Identities=27%  Similarity=0.246  Sum_probs=22.7

Q ss_pred             CCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeee
Q psy6931          25 ALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFK   74 (81)
Q Consensus        25 a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~   74 (81)
                      -.||++|+|.||+.+...                    -.|||+|.+.+.
T Consensus         3 ~~~vvvD~ETTG~~p~~~--------------------d~IIeigav~v~   32 (928)
T PRK08074          3 KRFVVVDLETTGNSPKKG--------------------DKIIQIAAVVVE   32 (928)
T ss_pred             CCEEEEEEeCCCCCCCCC--------------------CcEEEEEEEEEE
Confidence            369999999999754320                    269999998874


No 44 
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=78.87  E-value=2.4  Score=37.30  Aligned_cols=18  Identities=39%  Similarity=0.469  Sum_probs=15.9

Q ss_pred             ccCCeEEEeccCCCCccC
Q psy6931          23 KSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        23 ~~a~FVAiD~EFtGl~~~   40 (81)
                      +++.||++|+|-||+.+.
T Consensus       188 ~~~~~VVfDiETTGL~~~  205 (1213)
T TIGR01405       188 DDATYVVFDIETTGLSPQ  205 (1213)
T ss_pred             cCCcEEEEEeEecCCCCC
Confidence            788999999999998653


No 45 
>COG0847 DnaQ DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]
Probab=78.43  E-value=3.1  Score=29.02  Aligned_cols=15  Identities=60%  Similarity=0.678  Sum_probs=13.8

Q ss_pred             CCeEEEeccCCCCcc
Q psy6931          25 ALFVTIDGEFTGLNN   39 (81)
Q Consensus        25 a~FVAiD~EFtGl~~   39 (81)
                      ..||++|+|-||+..
T Consensus        13 ~~~vv~D~ETtg~~~   27 (243)
T COG0847          13 TRFVVIDLETTGLNP   27 (243)
T ss_pred             CcEEEEecccCCCCC
Confidence            789999999999876


No 46 
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins. This subfamily is composed of RNA exonuclease 1 (REX1 or Rex1p), REX3 (or Rex3p), and similar eukaryotic proteins. In yeast, REX1 and REX3 are required for 5S rRNA and MRP (mitochondrial RNA processing) RNA maturation, respectively. They are DEDDh-type DnaQ-like 3'-5' exonucleases containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. REX1 is the major exonuclease responsible for pre-tRNA trail trimming and may also be involved in nuclear CCA turnover. REX proteins function in the processing and maturation of many RNA species, similar to the function of Escherichia coli RNase T.
Probab=77.25  E-value=0.9  Score=30.06  Aligned_cols=13  Identities=23%  Similarity=0.383  Sum_probs=10.5

Q ss_pred             EEEeccCCCCccC
Q psy6931          28 VTIDGEFTGLNNG   40 (81)
Q Consensus        28 VAiD~EFtGl~~~   40 (81)
                      ||||||++|+...
T Consensus         1 ~~iD~E~~g~~~g   13 (150)
T cd06145           1 FALDCEMCYTTDG   13 (150)
T ss_pred             CEEeeeeeeecCC
Confidence            6899999998653


No 47 
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins. The RNase D-like group is composed of RNase D, WRN, and similar proteins. They contain a DEDDy-type, DnaQ-like, 3'-5' exonuclease domain that contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. RNase D is involved in the 3'-end processing of tRNA precursors. RNase D-like proteins in eukaryotes include yeast Rrp6p, human PM/Scl-100 and Drosophila melanogaster egalitarian (Egl) protein. WRN is a unique DNA helicase possessing exonuclease activity. Mutation in the WRN gene is implicated in Werner syndrome, a disease associated with premature aging and increased predisposition to cancer. Yeast Rrp6p and the human Polymyositis/scleroderma autoantigen 100kDa (PM/Scl-100) are exosome-
Probab=77.12  E-value=2.8  Score=27.75  Aligned_cols=25  Identities=8%  Similarity=0.125  Sum_probs=19.8

Q ss_pred             HHHHHHHhc-cCCeEEEeccCCCCcc
Q psy6931          15 TTRYAKAIK-SALFVTIDGEFTGLNN   39 (81)
Q Consensus        15 l~~i~~~I~-~a~FVAiD~EFtGl~~   39 (81)
                      |..+.+.++ ++.-|++|+|+.....
T Consensus         2 l~~~~~~l~~~~~~ig~D~E~~~~~~   27 (161)
T cd06129           2 LSSLCEDLSMDGDVIAFDMEWPPGRR   27 (161)
T ss_pred             HHHHHHHHhcCCCEEEEECCccCCCC
Confidence            445666777 9999999999998653


No 48 
>PRK06195 DNA polymerase III subunit epsilon; Validated
Probab=76.51  E-value=3.5  Score=30.49  Aligned_cols=12  Identities=42%  Similarity=0.310  Sum_probs=10.8

Q ss_pred             CeEEEeccCCCC
Q psy6931          26 LFVTIDGEFTGL   37 (81)
Q Consensus        26 ~FVAiD~EFtGl   37 (81)
                      +||+||+|-||.
T Consensus         2 ~~vviD~ETTg~   13 (309)
T PRK06195          2 NFVAIDFETANE   13 (309)
T ss_pred             cEEEEEEeCCCC
Confidence            799999999974


No 49 
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins. Three prime repair exonuclease (TREX)1 and TREX2 are closely related DEDDh-type DnaQ-like 3'-5' exonucleases. They contain three conserved sequence motifs known as ExoI, II, and III, with a specific Hx(4)D conserved pattern at ExoIII. These motifs contain four conserved acidic residues that participate in coordination of divalent metal ions required for catalysis. Both proteins play a role in the metabolism and clearance of DNA. TREX1 is the major 3'-5' exonuclease activity detected in mammalian cells. Mutations in the human TREX1 gene can cause Aicardi-Goutieres syndrome (AGS), which is characterized by perturbed innate immunity and presents itself as a severe neurological disease. TREX1 degrades ssDNA generated by aberrant replication intermediates to prevent checkpoint activation and autoimmune disease. There are distinct structural differences between TREX1 and TRE
Probab=74.32  E-value=1.8  Score=29.26  Aligned_cols=12  Identities=58%  Similarity=0.692  Sum_probs=11.3

Q ss_pred             eEEEeccCCCCc
Q psy6931          27 FVTIDGEFTGLN   38 (81)
Q Consensus        27 FVAiD~EFtGl~   38 (81)
                      ||++|+|=||+.
T Consensus         1 ~vv~D~ETTGl~   12 (177)
T cd06136           1 FVFLDLETTGLP   12 (177)
T ss_pred             CeEEeeecCCCC
Confidence            799999999997


No 50 
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins. The Egalitarian (Egl) protein subfamily is composed of Drosophila Egl and similar proteins. Egl is a component of an mRNA-binding complex which is required for oocyte specification. Egl contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation of this subfamily throughout eukaryotes suggests that its members may be part of ancient RNA processing complexes that are likely to participate in the regulated processing of specific mRNAs. Some members of this subfamily do not have a completely conserved YX(3)D pattern at the ExoIII motif.
Probab=74.19  E-value=3.1  Score=28.64  Aligned_cols=23  Identities=17%  Similarity=0.125  Sum_probs=18.5

Q ss_pred             HHHhccCCeEEEeccCCCCccCC
Q psy6931          19 AKAIKSALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        19 ~~~I~~a~FVAiD~EFtGl~~~~   41 (81)
                      .+.|+++.-||+|+|+.+++..+
T Consensus         4 ~~~l~~~~~i~~D~E~~~~~~~~   26 (197)
T cd06148           4 IIHLKKQKVIGLDCEGVNLGRKG   26 (197)
T ss_pred             hhhhhhCCEEEEEcccccCCCCC
Confidence            35678899999999998876643


No 51 
>COG1949 Orn Oligoribonuclease (3'-5' exoribonuclease) [RNA processing and modification]
Probab=73.25  E-value=2.3  Score=30.05  Aligned_cols=17  Identities=35%  Similarity=0.403  Sum_probs=13.9

Q ss_pred             CCeEEEeccCCCCccCC
Q psy6931          25 ALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        25 a~FVAiD~EFtGl~~~~   41 (81)
                      =..|=||+|||||.+..
T Consensus         6 ~nLiWIDlEMTGLd~~~   22 (184)
T COG1949           6 NNLIWIDLEMTGLDPER   22 (184)
T ss_pred             CceEEEeeeeccCCcCc
Confidence            35688999999998764


No 52 
>COG3325 ChiA Chitinase [Carbohydrate transport and metabolism]
Probab=72.50  E-value=6.1  Score=31.44  Aligned_cols=60  Identities=15%  Similarity=0.052  Sum_probs=40.0

Q ss_pred             CCCCcCccccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccc
Q psy6931           1 MAPTQHPMILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSM   61 (81)
Q Consensus         1 ~~~~~~~~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~   61 (81)
                      ||-.+-.|+||...--++.+-.. .|.|=||-|+||-..........-.-+.|..+.+.++
T Consensus       145 ~aad~a~re~Fa~saVe~~r~~~-FDGVDIDWEYP~~~~~~~~~~~~~d~~ny~~Ll~eLR  204 (441)
T COG3325         145 MAADDASRENFAKSAVEFMRTYG-FDGVDIDWEYPGSGGDAGNCGRPKDKANYVLLLQELR  204 (441)
T ss_pred             hhcCHHHHHHHHHHHHHHHHhcC-CCceeeccccCCCCCCCCCCCCcccHHHHHHHHHHHH
Confidence            45566778999987777766666 7889999999996554422222233345766655554


No 53 
>PRK05711 DNA polymerase III subunit epsilon; Provisional
Probab=71.70  E-value=2.6  Score=30.42  Aligned_cols=17  Identities=35%  Similarity=0.397  Sum_probs=14.0

Q ss_pred             cCCeEEEeccCCCCccC
Q psy6931          24 SALFVTIDGEFTGLNNG   40 (81)
Q Consensus        24 ~a~FVAiD~EFtGl~~~   40 (81)
                      .-.||++|+|-||+.+.
T Consensus         3 ~~r~vvlDtETTGldp~   19 (240)
T PRK05711          3 IMRQIVLDTETTGLNQR   19 (240)
T ss_pred             CCeEEEEEeeCCCcCCC
Confidence            34799999999999753


No 54 
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial. This model represents DnaQ, the DNA polymerase III epsilon subunit, as found in most Proteobacteria. It consists largely of an exonuclease domain as described in pfam model pfam00929. In Gram-positive bacteria, closely related regions are found both in the Gram-positive type DNA polymerase III alpha subunit and as an additional N-terminal domain of a DinG-family helicase. Both are excluded from this model, as are smaller proteins, also outside the Proteobacteria, that are similar in size to the epsilon subunit but as different in sequence as are the epsilon-like regions found in Gram-positive bacteria.
Probab=71.43  E-value=2.8  Score=29.68  Aligned_cols=15  Identities=33%  Similarity=0.419  Sum_probs=12.7

Q ss_pred             CeEEEeccCCCCccC
Q psy6931          26 LFVTIDGEFTGLNNG   40 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~   40 (81)
                      .||.+|+|-||+.+.
T Consensus         1 r~vvlD~ETTGl~p~   15 (225)
T TIGR01406         1 RQIILDTETTGLDPK   15 (225)
T ss_pred             CEEEEEeeCCCcCCC
Confidence            489999999999754


No 55 
>PTZ00315 2'-phosphotransferase; Provisional
Probab=70.14  E-value=6.5  Score=32.25  Aligned_cols=32  Identities=22%  Similarity=0.191  Sum_probs=22.9

Q ss_pred             CCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeee
Q psy6931          25 ALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFK   74 (81)
Q Consensus        25 a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~   74 (81)
                      -.||++|+|.||+.....                  +.-.||+||...+.
T Consensus        56 d~~IV~DlETTgl~~~~~------------------~~dEIIEIGaV~Vd   87 (582)
T PTZ00315         56 DAYVVLDFEATCEADRRI------------------EDAEVIEFPMVLVD   87 (582)
T ss_pred             CeEEEEEEecCCCCCCCC------------------CCCceEEEEEEEEE
Confidence            358999999999743221                  12359999998875


No 56 
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2. PAN2 is the catalytic subunit of poly(A) nuclease (PAN), a Pab1p-dependent 3'-5' exoribonuclease which plays an important role in the posttranscriptional maturation of pre-mRNAs. PAN catalyzes the deadenylation of poly(A) tails, which are initially synthesized to default lengths of 70 to 90, to mRNA-specific lengths of 55 to 71. Pab1p and PAN also play a role in the export and decay of mRNA. PAN2 contains a DEDDh-type DnaQ-like 3'-5' exonuclease domain with three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis.
Probab=68.31  E-value=0.54  Score=32.84  Aligned_cols=14  Identities=43%  Similarity=0.603  Sum_probs=9.5

Q ss_pred             EEEeccCCCCccCC
Q psy6931          28 VTIDGEFTGLNNGP   41 (81)
Q Consensus        28 VAiD~EFtGl~~~~   41 (81)
                      ||+|+||-|+....
T Consensus         1 ~a~d~e~v~~~~~~   14 (174)
T cd06143           1 VAIDAEFVKLKPEE   14 (174)
T ss_pred             CceeeeEEEecchh
Confidence            57777777776653


No 57 
>KOG3242|consensus
Probab=66.54  E-value=3.6  Score=29.45  Aligned_cols=15  Identities=47%  Similarity=0.530  Sum_probs=12.8

Q ss_pred             CeEEEeccCCCCccC
Q psy6931          26 LFVTIDGEFTGLNNG   40 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~   40 (81)
                      +.|=||+|||||...
T Consensus        27 ~lVWiD~EMTGLdve   41 (208)
T KOG3242|consen   27 PLVWIDCEMTGLDVE   41 (208)
T ss_pred             ceEEEeeeccccccc
Confidence            578999999999764


No 58 
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily. The DnaQ-like exonuclease superfamily is a structurally conserved group of 3'-5' exonucleases, which catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. It is also called the DEDD superfamily, after the four invariant acidic residues present in the catalytic site of its members. The superfamily consists of DNA- and RNA-processing enzymes such as the proofreading domains of DNA polymerases, other DNA exonucleases, RNase D, RNase T, Oligoribonuclease and RNA exonucleases (REX). The DnaQ-like exonuclease domain contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, which are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The conservation patterns of the three motifs may vary among different subfamilies. DnaQ-like exonucleases are classified as DEDDy
Probab=66.25  E-value=3  Score=25.60  Aligned_cols=14  Identities=43%  Similarity=0.643  Sum_probs=11.1

Q ss_pred             EEEeccCCCCccCC
Q psy6931          28 VTIDGEFTGLNNGP   41 (81)
Q Consensus        28 VAiD~EFtGl~~~~   41 (81)
                      +++|+|++|+....
T Consensus         1 ~~~DiEt~~~~~~~   14 (96)
T cd06125           1 IAIDTEATGLDGAV   14 (96)
T ss_pred             CEEEEECCCCCCCC
Confidence            58999999986543


No 59 
>PRK06309 DNA polymerase III subunit epsilon; Validated
Probab=64.37  E-value=5.2  Score=28.29  Aligned_cols=15  Identities=27%  Similarity=0.264  Sum_probs=12.8

Q ss_pred             CeEEEeccCCCCccC
Q psy6931          26 LFVTIDGEFTGLNNG   40 (81)
Q Consensus        26 ~FVAiD~EFtGl~~~   40 (81)
                      .||.+|+|-||+...
T Consensus         3 ~~vv~D~ETTGl~~~   17 (232)
T PRK06309          3 ALIFYDTETTGTQID   17 (232)
T ss_pred             cEEEEEeeCCCCCCC
Confidence            589999999999753


No 60 
>PF14943 MRP-S26:  Mitochondrial ribosome subunit S26
Probab=63.08  E-value=6.2  Score=27.41  Aligned_cols=31  Identities=13%  Similarity=-0.109  Sum_probs=26.2

Q ss_pred             CCCcCccccHHHHHHHHHHHhccCCeEEEecc
Q psy6931           2 APTQHPMILQHNITTRYAKAIKSALFVTIDGE   33 (81)
Q Consensus         2 ~~~~~~~~NF~~~l~~i~~~I~~a~FVAiD~E   33 (81)
                      +.+-.|+.|+++.+........++.| |||.+
T Consensus       136 sk~FIT~ENLd~~IeeALdnp~~YNf-aID~~  166 (170)
T PF14943_consen  136 SKNFITRENLDAAIEEALDNPVDYNF-AIDLE  166 (170)
T ss_pred             hcCcCCHHhHHHHHHHHHcCCcccce-eeCCC
Confidence            45778999999999999999889998 68754


No 61 
>PF08947 BPS:  BPS (Between PH and SH2) ;  InterPro: IPR015042 The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor []. ; PDB: 2AUH_B.
Probab=61.88  E-value=5  Score=22.72  Aligned_cols=25  Identities=20%  Similarity=0.511  Sum_probs=8.5

Q ss_pred             HhccCCeEEEeccCCCCccCCCCCCCCCHHH
Q psy6931          21 AIKSALFVTIDGEFTGLNNGPNTTPYDTPAQ   51 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~~~~~~~~dt~ee   51 (81)
                      .+++..+||||  |||-..+    ..++|.|
T Consensus         2 SvSe~slVaMD--FsG~~GR----vIenP~E   26 (49)
T PF08947_consen    2 SVSENSLVAMD--FSGQTGR----VIENPKE   26 (49)
T ss_dssp             -------EEEE---SSSS------B---HHH
T ss_pred             cccccceEEee--ecCCccc----ccCCHHH
Confidence            46778899999  8885432    3445544


No 62 
>PRK11779 sbcB exonuclease I; Provisional
Probab=61.53  E-value=5.7  Score=31.61  Aligned_cols=18  Identities=28%  Similarity=0.180  Sum_probs=15.2

Q ss_pred             ccCCeEEEeccCCCCccC
Q psy6931          23 KSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        23 ~~a~FVAiD~EFtGl~~~   40 (81)
                      ....||.+|+|-||+.+.
T Consensus         4 ~~~~fvv~D~ETTGLdP~   21 (476)
T PRK11779          4 MQPTFLWHDYETFGANPA   21 (476)
T ss_pred             CCCcEEEEEEECCCCCCC
Confidence            356799999999999864


No 63 
>PF12617 LdpA_C:  Iron-Sulfur binding protein C terminal;  InterPro: IPR021039  This entry represents the C-terminal region of the iron-sulphur protein LdpA (Light dependent period), which is found in phototropic organisms. LdpA was originally identified in cyanobacteria where it is involved in light-dependent modulation of the circadian clock. The presence of iron-sulphur clusters on LdpA suggests that it may modulate the circadian clock as an indirect function of light intensity by sensing changes in cellular physiology []. 
Probab=51.74  E-value=24  Score=25.01  Aligned_cols=52  Identities=17%  Similarity=0.098  Sum_probs=40.6

Q ss_pred             ccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceee
Q psy6931           9 ILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQF   68 (81)
Q Consensus         9 ~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~   68 (81)
                      +-|++.|..|...+..=..|||.|-- |      ..+.+-..++|+.++. -....|.|.
T Consensus        21 ~~F~~lw~~l~~~~~~Lk~lAiSc~~-~------~~li~~L~~~~~~l~~-l~~~~iWQ~   72 (183)
T PF12617_consen   21 AAFERLWQALAPSVPQLKLLAISCPD-G------EGLIDYLWQLYEILRP-LPCPLIWQL   72 (183)
T ss_pred             HHHHHHHHHHHhhhhhccEEEEECCC-C------HHHHHHHHHHHHHHhc-cCCCeeEee
Confidence            78999999999999999999999755 3      2355566778888886 444667775


No 64 
>TIGR02841 spore_YyaC putative sporulation protein YyaC. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, also called YyaC, is a member of that panel and is otherwise uncharacterized. The second round of PSI-BLAST shows many similarities to the germination protease GPR, which is found in exactly the same set of organisms and has a known role in the sporulation/germination process.
Probab=48.98  E-value=24  Score=24.03  Aligned_cols=27  Identities=11%  Similarity=0.037  Sum_probs=24.4

Q ss_pred             ccHHHHHHHHHHHhccCCeEEEeccCC
Q psy6931           9 ILQHNITTRYAKAIKSALFVTIDGEFT   35 (81)
Q Consensus         9 ~NF~~~l~~i~~~I~~a~FVAiD~EFt   35 (81)
                      .|+++.+..|.+.-.++-.||||.=..
T Consensus        47 ~NL~e~l~~I~~~~~~~~iIAIDAcLG   73 (140)
T TIGR02841        47 KNLEEKLKIIKKKHPNPFIIAIDACLG   73 (140)
T ss_pred             ccHHHHHHHHHHhCCCCeEEEEECccC
Confidence            799999999999999999999997543


No 65 
>PRK07983 exodeoxyribonuclease X; Provisional
Probab=48.80  E-value=12  Score=26.58  Aligned_cols=12  Identities=42%  Similarity=0.551  Sum_probs=10.8

Q ss_pred             eEEEeccCCCCc
Q psy6931          27 FVTIDGEFTGLN   38 (81)
Q Consensus        27 FVAiD~EFtGl~   38 (81)
                      |+.+|+|-||+.
T Consensus         2 ~~vlD~ETTGl~   13 (219)
T PRK07983          2 LRVIDTETCGLQ   13 (219)
T ss_pred             eEEEEEECCCCC
Confidence            789999999984


No 66 
>PF05470 eIF-3c_N:  Eukaryotic translation initiation factor 3 subunit 8 N-terminus;  InterPro: IPR008905 The largest of the mammalian translation initiation factors, eIF3, consists of at least eight subunits ranging in mass from 35 to 170 kDa. eIF3 binds to the 40 S ribosome in an early step of translation initiation and promotes the binding of methionyl-tRNAi and mRNA [].; GO: 0003743 translation initiation factor activity, 0006413 translational initiation, 0005852 eukaryotic translation initiation factor 3 complex
Probab=46.96  E-value=1.9  Score=35.22  Aligned_cols=12  Identities=50%  Similarity=1.148  Sum_probs=8.8

Q ss_pred             cceeeeeeeeee
Q psy6931          64 LLIQFGLCAFKY   75 (81)
Q Consensus        64 ~iiQ~Gl~~F~~   75 (81)
                      .+.|+|||+|+.
T Consensus       502 ~~vQLGLcAFR~  513 (595)
T PF05470_consen  502 AMVQLGLCAFRA  513 (595)
T ss_pred             HHHHHHHHHHHc
Confidence            567888888765


No 67 
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]
Probab=39.42  E-value=42  Score=23.85  Aligned_cols=45  Identities=16%  Similarity=0.169  Sum_probs=34.3

Q ss_pred             CcCccccHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccc
Q psy6931           4 TQHPMILQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDF   63 (81)
Q Consensus         4 ~~~~~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f   63 (81)
                      ....|.-|..++....+.- +-+||.|+-|              +-.+||....++|+.+
T Consensus       137 ~~~~R~~F~~~l~~~L~~~-~~~~v~i~~~--------------~y~eR~~~~~~aV~el  181 (187)
T COG3172         137 SSVQRQEFQNLLEQMLEEN-NIPFVVIEGE--------------DYLERYLQAVEAVEEL  181 (187)
T ss_pred             cHhHHHHHHHHHHHHHHHh-CCcEEEEcCC--------------CHHHHHHHHHHHHHHH
Confidence            3445677888887766665 7789999866              5678999999988765


No 68 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=38.84  E-value=34  Score=21.58  Aligned_cols=27  Identities=11%  Similarity=0.100  Sum_probs=24.0

Q ss_pred             cccHHHHHHHHHHHhccCCeEEEeccC
Q psy6931           8 MILQHNITTRYAKAIKSALFVTIDGEF   34 (81)
Q Consensus         8 ~~NF~~~l~~i~~~I~~a~FVAiD~EF   34 (81)
                      --||.+.|..|.+.+.++.=-|++-|=
T Consensus        22 ~L~F~DvL~~I~~vlp~aT~tAFeYED   48 (91)
T cd06395          22 QLLFRDVLDVIGQVLPEATTTAFEYED   48 (91)
T ss_pred             cccHHHHHHHHHHhcccccccceeecc
Confidence            379999999999999999999988663


No 69 
>KOG1990|consensus
Probab=37.26  E-value=25  Score=28.60  Aligned_cols=60  Identities=13%  Similarity=0.019  Sum_probs=45.1

Q ss_pred             cHHHHHHHHHHHhccCCeEEEeccCCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeee
Q psy6931          10 LQHNITTRYAKAIKSALFVTIDGEFTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLC   71 (81)
Q Consensus        10 NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~   71 (81)
                      |+...++.....+.+..+.+++.|++|+.....  .....+..++++......+..+-+|+.
T Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~dl~~~~i~~~~~p~r~l~~~~~  172 (564)
T KOG1990|consen  113 NQAGKWPSELEKEKNELLDSLGPELSDWGGSDR--LSVDADLLPEKIPDYMRPFRTLPVGSP  172 (564)
T ss_pred             hhhhhhHHHHHHHHHHHhhccCcccccCCCCCC--ccchhhhchhhhhcccChhccCCCCCh
Confidence            788999999999999999999999999976543  333444566777666666666665553


No 70 
>PRK13772 formimidoylglutamase; Provisional
Probab=37.17  E-value=1.7e+02  Score=21.64  Aligned_cols=65  Identities=11%  Similarity=0.002  Sum_probs=42.3

Q ss_pred             ccHHHHHHHHHHHhccCC--eEEEecc------CCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeee
Q psy6931           9 ILQHNITTRYAKAIKSAL--FVTIDGE------FTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKY   75 (81)
Q Consensus         9 ~NF~~~l~~i~~~I~~a~--FVAiD~E------FtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~   75 (81)
                      .++...+..+...++.++  ||+||..      .+|.+... +..+ |..|...-++..++.-+++=+.|+-+..
T Consensus       222 ~g~~~~~~~i~~~l~~~~~vylS~DiD~lDps~aPGvgtP~-pgGl-t~~e~~~il~~l~~~~~v~g~DvvEv~P  294 (314)
T PRK13772        222 RHLDARLAELDALLDAADHVYLTIDLDVLPAAVAPGVSAPA-AYGV-PLPVVEEIVLHVRASGKLRVADLAEYNP  294 (314)
T ss_pred             cCHHHHHHHHHHHHhcCCeEEEEEEecCcCcccCCCCCCCC-CCCC-CHHHHHHHHHHHHhcCCeeEEEEEEECC
Confidence            346677788888887555  8899965      56654443 3444 6777777777766665677666655443


No 71 
>PF09587 PGA_cap:  Bacterial capsule synthesis protein PGA_cap;  InterPro: IPR019079  CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein []. 
Probab=36.45  E-value=1.2e+02  Score=21.33  Aligned_cols=48  Identities=17%  Similarity=0.187  Sum_probs=34.4

Q ss_pred             cHHHHHHHHHHHhccCCeEEEeccCCCCccCCC---CCCCCCHHHHHHHHH
Q psy6931          10 LQHNITTRYAKAIKSALFVTIDGEFTGLNNGPN---TTPYDTPAQYYDKIR   57 (81)
Q Consensus        10 NF~~~l~~i~~~I~~a~FVAiD~EFtGl~~~~~---~~~~dt~eerY~~~k   57 (81)
                      ++...+..|...++++|++-..+|.+=......   ...+.++.+.-..++
T Consensus        22 ~~~~~~~~v~~~l~~aD~~~~NlE~~v~~~~~~~~~~~~f~~~~~~~~~L~   72 (250)
T PF09587_consen   22 GFDYIFEDVKPLLQSADLVVANLETPVTDSGQPASGYPHFNAPPEILDALK   72 (250)
T ss_pred             ChHHHHHHHHHHHhhCCEEEEEeeecCcCCCCcCCCcceecCCHHHHHHHH
Confidence            899999999999999999999999886544331   124444444444443


No 72 
>KOG1076|consensus
Probab=33.98  E-value=4.4  Score=34.30  Aligned_cols=13  Identities=46%  Similarity=1.073  Sum_probs=10.0

Q ss_pred             cceeeeeeeeeec
Q psy6931          64 LLIQFGLCAFKYD   76 (81)
Q Consensus        64 ~iiQ~Gl~~F~~~   76 (81)
                      .+.|+|||+|+..
T Consensus       532 tmvQLGLCAFR~G  544 (843)
T KOG1076|consen  532 TMVQLGLCAFRQG  544 (843)
T ss_pred             HHHHHHHHHHHcc
Confidence            5678888888753


No 73 
>cd07381 MPP_CapA CapA and related proteins, metallophosphatase domain. CapA is one of three membrane-associated enzymes in Bacillus anthracis that is required for synthesis of gamma-polyglutamic acid (PGA), a major component of the bacterial capsule.  The YwtB and PgsA proteins of Bacillus subtilis are closely related to CapA and are also included in this alignment model.  CapA belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal
Probab=33.72  E-value=53  Score=22.81  Aligned_cols=31  Identities=6%  Similarity=-0.186  Sum_probs=27.5

Q ss_pred             ccccHHHHHHHHHHHhccCCeEEEeccCCCC
Q psy6931           7 PMILQHNITTRYAKAIKSALFVTIDGEFTGL   37 (81)
Q Consensus         7 ~~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl   37 (81)
                      ...++...+..+...++++|++...+|.+=.
T Consensus        20 ~~~~~~~~~~~v~~~~~~~D~~~~NlE~~~~   50 (239)
T cd07381          20 RKYDFDPLFEDVKPLLRAADLAIGNLETPLT   50 (239)
T ss_pred             CCCCchhHHHHHHHHHhcCCEEEEEeecCcc
Confidence            3478999999999999999999999998744


No 74 
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=32.23  E-value=30  Score=31.36  Aligned_cols=20  Identities=40%  Similarity=0.501  Sum_probs=16.6

Q ss_pred             HhccCCeEEEeccCCCCccC
Q psy6931          21 AIKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl~~~   40 (81)
                      .++++.||++|+|.||+...
T Consensus       415 ~L~~~~~VVfDLETTGL~~~  434 (1437)
T PRK00448        415 DLKDATYVVFDVETTGLSAV  434 (1437)
T ss_pred             hhccCcEEEEEhhhcCCCCc
Confidence            45678999999999998653


No 75 
>PF06866 DUF1256:  Protein of unknown function (DUF1256);  InterPro: IPR009665 This family consists of several uncharacterised bacterial proteins, which seem to be specific to the orders Clostridia and Bacillales. Family members are typically around 180 residues in length. The function of this family is unknown.
Probab=30.49  E-value=65  Score=22.34  Aligned_cols=28  Identities=11%  Similarity=0.138  Sum_probs=24.6

Q ss_pred             ccHHHHHHHHHHHhccCCeEEEeccCCC
Q psy6931           9 ILQHNITTRYAKAIKSALFVTIDGEFTG   36 (81)
Q Consensus         9 ~NF~~~l~~i~~~I~~a~FVAiD~EFtG   36 (81)
                      .|+++.+..|.+.-.+.-.||||.=+.-
T Consensus        71 ~NL~e~l~~I~~~~~~~~IIAIDAcLG~   98 (163)
T PF06866_consen   71 LNLEETLNEIKKKHPNPFIIAIDACLGR   98 (163)
T ss_pred             hhHHHHHHHHHHHCCCCeEEEEECCCCC
Confidence            7999999999999999999999976543


No 76 
>KOG0967|consensus
Probab=30.41  E-value=41  Score=28.40  Aligned_cols=61  Identities=20%  Similarity=0.331  Sum_probs=38.3

Q ss_pred             HHHHHHHHHHHhcc--CCeEEEeccCCCCccCCC-CCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          11 QHNITTRYAKAIKS--ALFVTIDGEFTGLNNGPN-TTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        11 F~~~l~~i~~~I~~--a~FVAiD~EFtGl~~~~~-~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      |.+....+....+.  .+|| +|+|--+...... ...|.   ..=.+-|.+|+ -.=|++++|.|-+|
T Consensus       402 YPDi~~~~~~~~kp~v~sFI-lD~EvVA~Dr~~~~IlpFQ---vLSTRkRk~v~-v~dikV~Vcvf~FD  465 (714)
T KOG0967|consen  402 YPDIIEVISKLKKPSVKSFI-LDCEVVAWDREKGKILPFQ---VLSTRKRKNVD-VNDIKVKVCVFVFD  465 (714)
T ss_pred             CccHHHHHHHhhCCccceeE-EeeeEEEEeccCCccCchh---hhhhhhccccc-hhhceEEEEEEEEe
Confidence            44555555555555  5676 8888888766542 23333   22334556665 56789999999887


No 77 
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=30.22  E-value=33  Score=31.07  Aligned_cols=22  Identities=32%  Similarity=0.362  Sum_probs=18.9

Q ss_pred             HHhccCCeEEEeccCCCCccCC
Q psy6931          20 KAIKSALFVTIDGEFTGLNNGP   41 (81)
Q Consensus        20 ~~I~~a~FVAiD~EFtGl~~~~   41 (81)
                      ..|.++.||.+|.|=|||.+.-
T Consensus       416 ~~l~datyVVfDiETTGLs~~~  437 (1444)
T COG2176         416 QKLDDATYVVFDIETTGLSPVY  437 (1444)
T ss_pred             cccccccEEEEEeecCCcCccc
Confidence            3588999999999999997753


No 78 
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=30.16  E-value=73  Score=24.23  Aligned_cols=28  Identities=18%  Similarity=0.284  Sum_probs=24.6

Q ss_pred             HHHHHHHHHhccCCeEEEeccCCCCccC
Q psy6931          13 NITTRYAKAIKSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        13 ~~l~~i~~~I~~a~FVAiD~EFtGl~~~   40 (81)
                      +....|...|-+-++|-+|--||||.+-
T Consensus       137 QKIQfisaviHePeLlILDEPFSGLDPV  164 (300)
T COG4152         137 QKIQFISAVIHEPELLILDEPFSGLDPV  164 (300)
T ss_pred             HHHHHHHHHhcCCCEEEecCCccCCChh
Confidence            4567888899999999999999999764


No 79 
>smart00854 PGA_cap Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.
Probab=29.71  E-value=65  Score=22.49  Aligned_cols=30  Identities=7%  Similarity=-0.251  Sum_probs=26.7

Q ss_pred             cccHHHHHHHHHHHhccCCeEEEeccCCCC
Q psy6931           8 MILQHNITTRYAKAIKSALFVTIDGEFTGL   37 (81)
Q Consensus         8 ~~NF~~~l~~i~~~I~~a~FVAiD~EFtGl   37 (81)
                      +.+|...+..++..+++||++-+.+|.+=.
T Consensus        16 ~~~~~~~~~~v~~~~~~aD~~~~NlE~~~~   45 (239)
T smart00854       16 KADFSPPFAGVKPLLRAADLAIGNLETPIT   45 (239)
T ss_pred             ccCcchHHHHHHHHHhcCCEeEEEeecccc
Confidence            368999999999999999999999998743


No 80 
>PRK06722 exonuclease; Provisional
Probab=28.98  E-value=32  Score=25.56  Aligned_cols=13  Identities=23%  Similarity=0.176  Sum_probs=11.2

Q ss_pred             cCCeEEEeccCCC
Q psy6931          24 SALFVTIDGEFTG   36 (81)
Q Consensus        24 ~a~FVAiD~EFtG   36 (81)
                      ...||++|+|.||
T Consensus         4 ~~~~vViD~ETT~   16 (281)
T PRK06722          4 ATHFIVFDIERNF   16 (281)
T ss_pred             CCEEEEEEeeCCC
Confidence            3679999999996


No 81 
>PRK14975 bifunctional 3'-5' exonuclease/DNA polymerase; Provisional
Probab=26.68  E-value=42  Score=26.89  Aligned_cols=25  Identities=24%  Similarity=0.065  Sum_probs=20.4

Q ss_pred             HHHHHHHHhccCCeEEEeccCCCCc
Q psy6931          14 ITTRYAKAIKSALFVTIDGEFTGLN   38 (81)
Q Consensus        14 ~l~~i~~~I~~a~FVAiD~EFtGl~   38 (81)
                      .+......+..+.++|+||||....
T Consensus        11 ~l~~~~~~l~~~~~~a~DtEf~r~~   35 (553)
T PRK14975         11 ELGAALERLSPAGVVAGDTETTGDD   35 (553)
T ss_pred             hhHHHHHHhccCCceeCCccccCCc
Confidence            3446677789999999999998765


No 82 
>PF00491 Arginase:  Arginase family;  InterPro: IPR006035 The ureohydrolase superfamily includes arginase (3.5.3.1 from EC), agmatinase (3.5.3.11 from EC), formiminoglutamase (3.5.3.8 from EC) and proclavaminate amidinohydrolase (3.5.3.22 from EC) []. These enzymes share a 3-layer alpha-beta-alpha structure [, , ], and play important roles in arginine/agmatine metabolism, the urea cycle, histidine degradation, and other pathways.  Arginase, which catalyses the conversion of arginine to urea and ornithine, is one of the five members of the urea cycle enzymes that convert ammonia to urea as the principal product of nitrogen excretion []. There are several arginase isozymes that differ in catalytic, molecular and immunological properties. Deficiency in the liver isozyme leads to argininemia, which is usually associated with hyperammonemia. Agmatinase hydrolyses agmatine to putrescine, the precursor for the biosynthesis of higher polyamines, spermidine and spermine. In addition, agmatine may play an important regulatory role in mammals.   Formiminoglutamase catalyses the fourth step in histidine degradation, acting to hydrolyse N-formimidoyl-L-glutamate to L-glutamate and formamide.  Proclavaminate amidinohydrolase is involved in clavulanic acid biosynthesis. Clavulanic acid acts as an inhibitor of a wide range of beta-lactamase enzymes that are used by various microorganisms to resist beta-lactam antibiotics. As a result, this enzyme improves the effectiveness of beta-lactamase antibiotics [].; GO: 0016813 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines, 0046872 metal ion binding; PDB: 4DZ4_A 3SL0_A 3MMR_A 3SL1_A 2EF5_D 2EIV_K 2EF4_A 3NIO_F 3THH_A 1WVA_A ....
Probab=26.57  E-value=2.2e+02  Score=20.21  Aligned_cols=65  Identities=11%  Similarity=0.189  Sum_probs=43.0

Q ss_pred             cHHHHHHHHHHHhc---cCCeEEEecc------CCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeeec
Q psy6931          10 LQHNITTRYAKAIK---SALFVTIDGE------FTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYD   76 (81)
Q Consensus        10 NF~~~l~~i~~~I~---~a~FVAiD~E------FtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~   76 (81)
                      ++.+.+..+.+.+.   +.-||+||..      ++|..... +.. -+++|..+-++...+...++=+.||-+...
T Consensus       183 g~~~~~~~~~~~~~~~~~~vylsiDiDvlDp~~~pg~~~p~-pgG-l~~~e~~~~l~~l~~~~~vvg~di~E~~P~  256 (277)
T PF00491_consen  183 GIDAVLEEILEALGSGTDPVYLSIDIDVLDPAFAPGVGTPE-PGG-LSPRELLQLLRALARSGKVVGLDIVEYNPD  256 (277)
T ss_dssp             HHHHHHHHHHHHHTTSTSEEEEEEEGGGBBTTTSTSBSS-B-SS--B-HHHHHHHHHHHHHHSEEEEEEEE-B-GG
T ss_pred             hhhhHHHHHHHHHhcCCCeEEEEEehhhcChhhCCCcCCCc-CCC-CCHHHHHHHHHHHcccCCeEEEEEEEECCC
Confidence            44556788888884   6778999975      45543322 223 377888888888777789998888877654


No 83 
>cd06138 ExoI_N N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins. This subfamily is composed of the N-terminal domain of Escherichia coli exonuclease I (ExoI) and similar proteins. ExoI is a monomeric enzyme that hydrolyzes single stranded DNA in the 3' to 5' direction. It plays a role in DNA recombination and repair. It primarily functions in repairing frameshift mutations. The N-terminal domain of ExoI is a DEDDh-type DnaQ-like 3'-5 exonuclease containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The ExoI structure is unique among DnaQ family enzymes in that there is a large distance between the two metal ions required for catalysis and the catalytic histidine is oriented away from the active site.
Probab=25.02  E-value=41  Score=22.61  Aligned_cols=12  Identities=42%  Similarity=0.304  Sum_probs=9.7

Q ss_pred             EEeccCCCCccC
Q psy6931          29 TIDGEFTGLNNG   40 (81)
Q Consensus        29 AiD~EFtGl~~~   40 (81)
                      -+|+|-||+...
T Consensus         2 ~~D~ETTGl~~~   13 (183)
T cd06138           2 FYDYETFGLNPS   13 (183)
T ss_pred             EEEeecCCCCCC
Confidence            489999999753


No 84 
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases. Escherichia coli-like Polymerase I (Pol I), a subgroup of family-A DNA polymerases, contains a DEDDy-type DnaQ-like 3'-5' exonuclease domain in the same polypeptide chain as the polymerase domain. The exonuclease domain contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The 3'-5' exonuclease domain of DNA polymerases has a fundamental role in reducing polymerase errors and is involved in proofreading activity. E. coli DNA Pol I is involved in genome replication but is not the main replicating enzyme. It is also implicated in DNA repair.
Probab=24.59  E-value=53  Score=21.39  Aligned_cols=17  Identities=29%  Similarity=0.399  Sum_probs=14.1

Q ss_pred             hccCCeEEEeccCCCCc
Q psy6931          22 IKSALFVTIDGEFTGLN   38 (81)
Q Consensus        22 I~~a~FVAiD~EFtGl~   38 (81)
                      ..+..++|+|+|-+|+.
T Consensus         2 ~~~~~~~a~d~e~~~~~   18 (193)
T cd06139           2 LEKAKVFAFDTETTSLD   18 (193)
T ss_pred             CccCCeEEEEeecCCCC
Confidence            35678999999999976


No 85 
>PF13486 Dehalogenase:  Reductive dehalogenase subunit
Probab=23.45  E-value=70  Score=23.79  Aligned_cols=36  Identities=25%  Similarity=0.267  Sum_probs=29.3

Q ss_pred             CCCCCCHHHHHHHHHhccccccceeeeeeeeeecCCCC
Q psy6931          43 TTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKYDNTTK   80 (81)
Q Consensus        43 ~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~~~~~~   80 (81)
                      +.-.-||||--+-+|.+++-|-.-++|++-.  |++.+
T Consensus       134 PkWqGTPEEN~~miRaA~r~fGa~~VG~~el--d~~~k  169 (308)
T PF13486_consen  134 PKWQGTPEENLRMIRAAARFFGAPDVGVAEL--DENTK  169 (308)
T ss_pred             CcccCCHHHHHHHHHHHHHHcCCCceeEEEe--cCCce
Confidence            3455789999999999999999999999865  44433


No 86 
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]
Probab=22.97  E-value=99  Score=21.90  Aligned_cols=23  Identities=17%  Similarity=0.081  Sum_probs=19.9

Q ss_pred             ccHH-HHHHHHHHHhccCCeEEEe
Q psy6931           9 ILQH-NITTRYAKAIKSALFVTID   31 (81)
Q Consensus         9 ~NF~-~~l~~i~~~I~~a~FVAiD   31 (81)
                      ++|+ -..|.|+.+.+.||-|.||
T Consensus        84 ~~le~i~~~al~rA~~~aDvIIID  107 (179)
T COG1618          84 EGLEEIAIPALRRALEEADVIIID  107 (179)
T ss_pred             HHHHHHhHHHHHHHhhcCCEEEEe
Confidence            5677 4569999999999999999


No 87 
>cd03114 ArgK-like The function of this protein family is unkown. The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.
Probab=22.40  E-value=1.4e+02  Score=19.51  Aligned_cols=16  Identities=6%  Similarity=0.229  Sum_probs=13.3

Q ss_pred             ccCCeEEEeccCCCCccC
Q psy6931          23 KSALFVTIDGEFTGLNNG   40 (81)
Q Consensus        23 ~~a~FVAiD~EFtGl~~~   40 (81)
                      ..+|||=||+  +|+...
T Consensus        90 ~~~D~iiIDt--aG~~~~  105 (148)
T cd03114          90 AGFDVIIVET--VGVGQS  105 (148)
T ss_pred             cCCCEEEEEC--CccChh
Confidence            5799999999  997643


No 88 
>PF06938 DUF1285:  Protein of unknown function (DUF1285);  InterPro: IPR010707 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.; PDB: 2RA9_A 2RE3_B.
Probab=22.13  E-value=44  Score=22.66  Aligned_cols=17  Identities=24%  Similarity=0.470  Sum_probs=13.1

Q ss_pred             HhccCCeEEEeccCCCC
Q psy6931          21 AIKSALFVTIDGEFTGL   37 (81)
Q Consensus        21 ~I~~a~FVAiD~EFtGl   37 (81)
                      .+++++|+++|.++.|-
T Consensus        49 ~VEDaPf~iv~~~~~~~   65 (148)
T PF06938_consen   49 QVEDAPFLIVDVDVEGE   65 (148)
T ss_dssp             EESS-SEEEEEEEECS-
T ss_pred             EEecCcEEEEEEEEecc
Confidence            36789999999999964


No 89 
>PF14305 ATPgrasp_TupA:  TupA-like ATPgrasp
Probab=22.04  E-value=1.1e+02  Score=21.79  Aligned_cols=24  Identities=21%  Similarity=0.066  Sum_probs=22.6

Q ss_pred             ccHHHHHHHHHHHhccCCeEEEec
Q psy6931           9 ILQHNITTRYAKAIKSALFVTIDG   32 (81)
Q Consensus         9 ~NF~~~l~~i~~~I~~a~FVAiD~   32 (81)
                      .||++.+..-+.+-+..+||=+|+
T Consensus       179 ~~l~emi~iA~~Ls~~f~fvRVDl  202 (239)
T PF14305_consen  179 KNLEEMIEIAEKLSKGFPFVRVDL  202 (239)
T ss_pred             hhHHHHHHHHHHHccCCCEEEEEE
Confidence            899999999999999999999996


No 90 
>COG1099 Predicted metal-dependent hydrolases with the TIM-barrel fold [General function prediction only]
Probab=22.04  E-value=1.1e+02  Score=22.86  Aligned_cols=28  Identities=14%  Similarity=0.165  Sum_probs=24.4

Q ss_pred             CcCcc---ccHHHHHHHHHHHhccCCeEEEe
Q psy6931           4 TQHPM---ILQHNITTRYAKAIKSALFVTID   31 (81)
Q Consensus         4 ~~~~~---~NF~~~l~~i~~~I~~a~FVAiD   31 (81)
                      ..|||   .|+++.+..+...+.+.+-|||-
T Consensus        71 GvHPr~iP~e~~~~l~~L~~~l~~e~VvAiG  101 (254)
T COG1099          71 GVHPRAIPPELEEVLEELEELLSNEDVVAIG  101 (254)
T ss_pred             ccCCCCCCchHHHHHHHHHhhcccCCeeEee
Confidence            35777   67999999999999999999985


No 91 
>PF00113 Enolase_C:  Enolase, C-terminal TIM barrel domain;  InterPro: IPR020810 Enolase (2-phospho-D-glycerate hydrolase) is an essential glycolytic enzyme that catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate [, ]. In vertebrates, there are 3 different, tissue-specific isoenzymes, designated alpha, beta and gamma. Alpha is present in most tissues, beta is localised in muscle tissue, and gamma is found only in nervous tissue. The functional enzyme exists as a dimer of any 2 isoforms. In immature organs and in adult liver, it is usually an alpha homodimer, in adult skeletal muscle, a beta homodimer, and in adult neurons, a gamma homodimer. In developing muscle, it is usually an alpha/beta heterodimer, and in the developing nervous system, an alpha/gamma heterodimer []. The tissue specific forms display minor kinetic differences. Tau-crystallin, one of the major lens proteins in some fish, reptiles and birds, has been shown [] to be evolutionary related to enolase. Neuron-specific enolase is released in a variety of neurological diseases, such as multiple sclerosis and after seizures or acute stroke. Several tumour cells have also been found positive for neuron-specific enolase. Beta-enolase deficiency is associated with glycogenosis type XIII defect.; GO: 0000287 magnesium ion binding, 0004634 phosphopyruvate hydratase activity, 0006096 glycolysis, 0000015 phosphopyruvate hydratase complex; PDB: 2FYM_D 3H8A_C 1E9I_D 3TQP_B 2PU1_A 1OEP_A 2PA6_A 1PDY_A 1PDZ_A 3UJ2_E ....
Probab=21.81  E-value=1.2e+02  Score=22.71  Aligned_cols=32  Identities=16%  Similarity=0.125  Sum_probs=24.5

Q ss_pred             ccccHHHHHHHHHHHhccCCe-----EEEeccCCCCc
Q psy6931           7 PMILQHNITTRYAKAIKSALF-----VTIDGEFTGLN   38 (81)
Q Consensus         7 ~~~NF~~~l~~i~~~I~~a~F-----VAiD~EFtGl~   38 (81)
                      +..+.++.|..|.++|++|-|     ||||+-=+-+.
T Consensus        75 ~~~~~eeaL~ll~~Ai~~aGy~~~v~ialD~AAsefy  111 (295)
T PF00113_consen   75 NIDDNEEALDLLMEAIKEAGYEPDVAIALDVAASEFY  111 (295)
T ss_dssp             SBSSHHHHHHHHHHHHHHTT-TTTBEEEEE--GGGGE
T ss_pred             CCcchhHHHHHHHHHHHHccccceeeeeccccHHHhh
Confidence            446679999999999999986     99998776665


No 92 
>TIGR01229 rocF_arginase arginase. This model helps resolve arginases from known and putative agmatinases, formiminoglutamases, and other related proteins of unknown specifity. The pathway from arginine to the polyamine putrescine may procede by hydrolysis to remove urea (arginase) followed by decarboxylation (ornithine decarboxylase), or by decarboxylation first (arginine decarboxylase) followed by removal of urea (agmatinase).
Probab=20.06  E-value=3.6e+02  Score=19.69  Aligned_cols=63  Identities=8%  Similarity=-0.078  Sum_probs=40.2

Q ss_pred             HHHHHHHHHHHhccCC---eEEEecc------CCCCccCCCCCCCCCHHHHHHHHHhccccccceeeeeeeeee
Q psy6931          11 QHNITTRYAKAIKSAL---FVTIDGE------FTGLNNGPNTTPYDTPAQYYDKIRQGSMDFLLIQFGLCAFKY   75 (81)
Q Consensus        11 F~~~l~~i~~~I~~a~---FVAiD~E------FtGl~~~~~~~~~dt~eerY~~~k~~v~~f~iiQ~Gl~~F~~   75 (81)
                      .++.+..+.+.++..+   ||++|..      ++|..... +.. -++.|....++..++...++=+.|+-+..
T Consensus       202 ~~~v~~~~~~~l~~~~~~vyvS~DiDvlDps~aPgv~tp~-pgG-l~~~e~~~~l~~i~~~~~v~g~DivE~~P  273 (300)
T TIGR01229       202 IGKVVEETLEYLKAEDGPIHLSLDVDGLDPSLAPATGTPV-VGG-LTFREGLLIMEMLYETGLLTALDVVEVNP  273 (300)
T ss_pred             HHHHHHHHHHHHhcCCCeEEEEEeccccCcccCCCCCCCC-CCC-CCHHHHHHHHHHHHhcCCEEEEEEEEECc
Confidence            4455667777776655   9999964      56654433 233 35566667777777777777666665544


Done!