Query         psy6945
Match_columns 61
No_of_seqs    107 out of 176
Neff          5.5 
Searched_HMMs 46136
Date          Fri Aug 16 22:45:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6945.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6945hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03144 Carbon catabolite rep  99.1 4.2E-11 9.2E-16   91.1   1.9   52    1-60    472-546 (606)
  2 KOG0620|consensus               98.2 6.2E-07 1.4E-11   64.9   2.2   60    1-61    238-297 (361)
  3 COG5239 CCR4 mRNA deadenylase,  97.5 2.5E-05 5.4E-10   57.4  -0.1   50    1-59    259-309 (378)
  4 PRK09979 putative rho operon l  19.9      68  0.0015   15.9   1.0   17   34-50      7-23  (33)
  5 cd07497 Peptidases_S8_14 Pepti  19.1      46 0.00099   23.4   0.4   12    9-20     12-23  (311)
  6 PF08022 FAD_binding_8:  FAD-bi  19.0      38 0.00082   19.8   0.0   16   38-53     49-64  (105)
  7 cd04843 Peptidases_S8_11 Pepti  17.1      62  0.0013   22.2   0.7   14    9-22     26-39  (277)
  8 PF12500 TRSP:  TRSP domain C t  17.0      75  0.0016   20.8   1.1   24   35-61    103-126 (155)
  9 cd07491 Peptidases_S8_7 Peptid  15.9      84  0.0018   21.2   1.1   15    5-20     10-24  (247)
 10 PHA02672 ORF110 EEV glycoprote  15.9      59  0.0013   21.8   0.4   19   42-60     44-62  (166)

No 1  
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional
Probab=99.07  E-value=4.2e-11  Score=91.07  Aligned_cols=52  Identities=33%  Similarity=0.424  Sum_probs=44.2

Q ss_pred             CEEecccCCCCCCCccccCCCccchhhhhccCCC-CCceeccCCCccccCC----------------------CCCCcee
Q psy6945           1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDK-SNDFTHSFKLASAYSE----------------------DIMPYTN   57 (61)
Q Consensus         1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~-~~~l~H~f~L~SAY~~----------------------~~l~fTN   57 (61)
                      ||+||++|.|+.+||||....++..        . ...++|+|+|+|||..                      ++|+|||
T Consensus       472 vy~lLt~G~v~~~h~d~~~~~~~~~--------~~~~~l~H~~~L~SAY~~~~~~~g~~~~~~~~~~r~~~~~geP~fTN  543 (606)
T PLN03144        472 PHCLLATGKVDPLHPDLAVDPLGIL--------RPASKLTHQLPLVSAYSSFARMPGSGSGLEQQRRRMDPATNEPLFTN  543 (606)
T ss_pred             hhhhhhcCCcCCCchhhccCccccc--------cccccccCCCcccchhhhhccccccccchhhhhhccccccCCCCcee
Confidence            7899999999999999998766544        2 5679999999999963                      4899999


Q ss_pred             eee
Q psy6945          58 YTY   60 (61)
Q Consensus        58 yT~   60 (61)
                      ||-
T Consensus       544 yt~  546 (606)
T PLN03144        544 CTR  546 (606)
T ss_pred             ecC
Confidence            984


No 2  
>KOG0620|consensus
Probab=98.23  E-value=6.2e-07  Score=64.90  Aligned_cols=60  Identities=27%  Similarity=0.409  Sum_probs=51.7

Q ss_pred             CEEecccCCCCCCCccccCCCccchhhhhccCCCCCceeccCCCccccCCCCCCceeeeeC
Q psy6945           1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDKSNDFTHSFKLASAYSEDIMPYTNYTYV   61 (61)
Q Consensus         1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~~~~l~H~f~L~SAY~~~~l~fTNyT~~   61 (61)
                      ||+++..|.++.+|+||+...+.....++.+. ..+.++|.++++++|.+.++.|||||.+
T Consensus       238 v~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~ftn~t~~  297 (361)
T KOG0620|consen  238 VYALLASGILSPEDADNKDLPLMSALGSKVNK-SYEEMSHDQRRKLEYTTGEPRFTNYTPG  297 (361)
T ss_pred             ceeecccCCCCcchhhHhhccccccccccccc-cccccchhhhcccccccCccccccccCC
Confidence            78999999999999999999998886554443 3567999999999999988999999963


No 3  
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification]
Probab=97.47  E-value=2.5e-05  Score=57.36  Aligned_cols=50  Identities=26%  Similarity=0.404  Sum_probs=41.5

Q ss_pred             CEEecccCCCCCCCccccCCCccchhhhhccCCCC-CceeccCCCccccCCCCCCceeee
Q psy6945           1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDKS-NDFTHSFKLASAYSEDIMPYTNYT   59 (61)
Q Consensus         1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~~-~~l~H~f~L~SAY~~~~l~fTNyT   59 (61)
                      ||++|.++.| ..|.++..++++-.        +. .++.||+.|+|+...++|+|||||
T Consensus       259 vy~~l~~~~~-q~H~~~~~~~~~ly--------svg~~~~h~~n~~~~~~~~~~~fTN~t  309 (378)
T COG5239         259 VYKFLVTSQI-QLHESLNGRDFSLY--------SVGYKFVHPENLKSDNSKGELGFTNWT  309 (378)
T ss_pred             ehhhhhhHHH-Hhhhcccccchhhh--------cccccccChhhcccCCCcCCccccccc
Confidence            6788888666 78999999988776        43 689999999995555999999997


No 4  
>PRK09979 putative rho operon leader peptide; Provisional
Probab=19.90  E-value=68  Score=15.88  Aligned_cols=17  Identities=29%  Similarity=0.483  Sum_probs=12.6

Q ss_pred             CCCceeccCCCccccCC
Q psy6945          34 KSNDFTHSFKLASAYSE   50 (61)
Q Consensus        34 ~~~~l~H~f~L~SAY~~   50 (61)
                      ++..+.-.-++.|||.+
T Consensus         7 sgsslnpscrfssaysp   23 (33)
T PRK09979          7 SGSSLNPSCRFSSAYSP   23 (33)
T ss_pred             cCCcCCcccccccccCh
Confidence            45566677788999985


No 5  
>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=19.11  E-value=46  Score=23.42  Aligned_cols=12  Identities=25%  Similarity=0.285  Sum_probs=9.3

Q ss_pred             CCCCCCccccCC
Q psy6945           9 RVTSDHQDFKDL   20 (61)
Q Consensus         9 ~V~~~H~Df~~~   20 (61)
                      .|..+||||+.+
T Consensus        12 Gid~~HPdl~~~   23 (311)
T cd07497          12 GVDYSHPDLDIY   23 (311)
T ss_pred             CcCCCChhHhcc
Confidence            377899999753


No 6  
>PF08022 FAD_binding_8:  FAD-binding domain;  InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=18.96  E-value=38  Score=19.85  Aligned_cols=16  Identities=25%  Similarity=0.389  Sum_probs=0.0

Q ss_pred             eeccCCCccccCCCCC
Q psy6945          38 FTHSFKLASAYSEDIM   53 (61)
Q Consensus        38 l~H~f~L~SAY~~~~l   53 (61)
                      =.|||.+.|+...+.+
T Consensus        49 q~HPFTIas~~~~~~i   64 (105)
T PF08022_consen   49 QWHPFTIASSPEDNSI   64 (105)
T ss_dssp             ----------------
T ss_pred             cccccEeeccCCCCEE
Confidence            4799999998775433


No 7  
>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=17.13  E-value=62  Score=22.25  Aligned_cols=14  Identities=14%  Similarity=0.109  Sum_probs=10.5

Q ss_pred             CCCCCCccccCCCc
Q psy6945           9 RVTSDHQDFKDLPY   22 (61)
Q Consensus         9 ~V~~~H~Df~~~~y   22 (61)
                      .|..+||||+++.-
T Consensus        26 Gid~~Hpdl~~~~~   39 (277)
T cd04843          26 GWNLNHEDLVGNGI   39 (277)
T ss_pred             CCCCCChhhccccc
Confidence            46778999987643


No 8  
>PF12500 TRSP:  TRSP domain C terminus to PRTase_2 ;  InterPro: IPR022537  This domain is found in bacteria, and is typically between 174 and 217 amino acids in length. There is a conserved TRSP sequence motif. 
Probab=17.01  E-value=75  Score=20.77  Aligned_cols=24  Identities=25%  Similarity=0.526  Sum_probs=18.9

Q ss_pred             CCceeccCCCccccCCCCCCceeeeeC
Q psy6945          35 SNDFTHSFKLASAYSEDIMPYTNYTYV   61 (61)
Q Consensus        35 ~~~l~H~f~L~SAY~~~~l~fTNyT~~   61 (61)
                      +-.|.+.|++.+.|+.+.   +||.|.
T Consensus       103 gyaI~~~~~F~~~~~~~~---~~ylYN  126 (155)
T PF12500_consen  103 GYAIRSGFSFPDPYDPGI---PNYLYN  126 (155)
T ss_pred             CCccceeeEecCCCCCCC---cceEec
Confidence            446889999999999743   888874


No 9  
>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=15.92  E-value=84  Score=21.19  Aligned_cols=15  Identities=20%  Similarity=0.319  Sum_probs=11.4

Q ss_pred             cccCCCCCCCccccCC
Q psy6945           5 LSTGRVTSDHQDFKDL   20 (61)
Q Consensus         5 Ls~G~V~~~H~Df~~~   20 (61)
                      |.+| |..+||||+++
T Consensus        10 IDsG-vd~~hpdl~~~   24 (247)
T cd07491          10 IDDG-VDILDSDLQGK   24 (247)
T ss_pred             ECCC-cCCCchhhccc
Confidence            4444 78899999976


No 10 
>PHA02672 ORF110 EEV glycoprotein; Provisional
Probab=15.92  E-value=59  Score=21.78  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=15.8

Q ss_pred             CCCccccCCCCCCceeeee
Q psy6945          42 FKLASAYSEDIMPYTNYTY   60 (61)
Q Consensus        42 f~L~SAY~~~~l~fTNyT~   60 (61)
                      |=|++||+.+=+||-||-|
T Consensus        44 ~f~~~AC~~GWvp~dd~Cy   62 (166)
T PHA02672         44 FFLKEACENGWVPIKDLCV   62 (166)
T ss_pred             hhhhhhhhcCCeeccCEEE
Confidence            4589999999999988754


Done!