Query psy6945
Match_columns 61
No_of_seqs 107 out of 176
Neff 5.5
Searched_HMMs 46136
Date Fri Aug 16 22:45:31 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy6945.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6945hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PLN03144 Carbon catabolite rep 99.1 4.2E-11 9.2E-16 91.1 1.9 52 1-60 472-546 (606)
2 KOG0620|consensus 98.2 6.2E-07 1.4E-11 64.9 2.2 60 1-61 238-297 (361)
3 COG5239 CCR4 mRNA deadenylase, 97.5 2.5E-05 5.4E-10 57.4 -0.1 50 1-59 259-309 (378)
4 PRK09979 putative rho operon l 19.9 68 0.0015 15.9 1.0 17 34-50 7-23 (33)
5 cd07497 Peptidases_S8_14 Pepti 19.1 46 0.00099 23.4 0.4 12 9-20 12-23 (311)
6 PF08022 FAD_binding_8: FAD-bi 19.0 38 0.00082 19.8 0.0 16 38-53 49-64 (105)
7 cd04843 Peptidases_S8_11 Pepti 17.1 62 0.0013 22.2 0.7 14 9-22 26-39 (277)
8 PF12500 TRSP: TRSP domain C t 17.0 75 0.0016 20.8 1.1 24 35-61 103-126 (155)
9 cd07491 Peptidases_S8_7 Peptid 15.9 84 0.0018 21.2 1.1 15 5-20 10-24 (247)
10 PHA02672 ORF110 EEV glycoprote 15.9 59 0.0013 21.8 0.4 19 42-60 44-62 (166)
No 1
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional
Probab=99.07 E-value=4.2e-11 Score=91.07 Aligned_cols=52 Identities=33% Similarity=0.424 Sum_probs=44.2
Q ss_pred CEEecccCCCCCCCccccCCCccchhhhhccCCC-CCceeccCCCccccCC----------------------CCCCcee
Q psy6945 1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDK-SNDFTHSFKLASAYSE----------------------DIMPYTN 57 (61)
Q Consensus 1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~-~~~l~H~f~L~SAY~~----------------------~~l~fTN 57 (61)
||+||++|.|+.+||||....++.. . ...++|+|+|+|||.. ++|+|||
T Consensus 472 vy~lLt~G~v~~~h~d~~~~~~~~~--------~~~~~l~H~~~L~SAY~~~~~~~g~~~~~~~~~~r~~~~~geP~fTN 543 (606)
T PLN03144 472 PHCLLATGKVDPLHPDLAVDPLGIL--------RPASKLTHQLPLVSAYSSFARMPGSGSGLEQQRRRMDPATNEPLFTN 543 (606)
T ss_pred hhhhhhcCCcCCCchhhccCccccc--------cccccccCCCcccchhhhhccccccccchhhhhhccccccCCCCcee
Confidence 7899999999999999998766544 2 5679999999999963 4899999
Q ss_pred eee
Q psy6945 58 YTY 60 (61)
Q Consensus 58 yT~ 60 (61)
||-
T Consensus 544 yt~ 546 (606)
T PLN03144 544 CTR 546 (606)
T ss_pred ecC
Confidence 984
No 2
>KOG0620|consensus
Probab=98.23 E-value=6.2e-07 Score=64.90 Aligned_cols=60 Identities=27% Similarity=0.409 Sum_probs=51.7
Q ss_pred CEEecccCCCCCCCccccCCCccchhhhhccCCCCCceeccCCCccccCCCCCCceeeeeC
Q psy6945 1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDKSNDFTHSFKLASAYSEDIMPYTNYTYV 61 (61)
Q Consensus 1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~~~~l~H~f~L~SAY~~~~l~fTNyT~~ 61 (61)
||+++..|.++.+|+||+...+.....++.+. ..+.++|.++++++|.+.++.|||||.+
T Consensus 238 v~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~ftn~t~~ 297 (361)
T KOG0620|consen 238 VYALLASGILSPEDADNKDLPLMSALGSKVNK-SYEEMSHDQRRKLEYTTGEPRFTNYTPG 297 (361)
T ss_pred ceeecccCCCCcchhhHhhccccccccccccc-cccccchhhhcccccccCccccccccCC
Confidence 78999999999999999999998886554443 3567999999999999988999999963
No 3
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification]
Probab=97.47 E-value=2.5e-05 Score=57.36 Aligned_cols=50 Identities=26% Similarity=0.404 Sum_probs=41.5
Q ss_pred CEEecccCCCCCCCccccCCCccchhhhhccCCCC-CceeccCCCccccCCCCCCceeee
Q psy6945 1 VIEFLSTGRVTSDHQDFKDLPYKSVLNKICQNDKS-NDFTHSFKLASAYSEDIMPYTNYT 59 (61)
Q Consensus 1 VyelLs~G~V~~~H~Df~~~~y~~~l~~~~~~~~~-~~l~H~f~L~SAY~~~~l~fTNyT 59 (61)
||++|.++.| ..|.++..++++-. +. .++.||+.|+|+...++|+|||||
T Consensus 259 vy~~l~~~~~-q~H~~~~~~~~~ly--------svg~~~~h~~n~~~~~~~~~~~fTN~t 309 (378)
T COG5239 259 VYKFLVTSQI-QLHESLNGRDFSLY--------SVGYKFVHPENLKSDNSKGELGFTNWT 309 (378)
T ss_pred ehhhhhhHHH-Hhhhcccccchhhh--------cccccccChhhcccCCCcCCccccccc
Confidence 6788888666 78999999988776 43 689999999995555999999997
No 4
>PRK09979 putative rho operon leader peptide; Provisional
Probab=19.90 E-value=68 Score=15.88 Aligned_cols=17 Identities=29% Similarity=0.483 Sum_probs=12.6
Q ss_pred CCCceeccCCCccccCC
Q psy6945 34 KSNDFTHSFKLASAYSE 50 (61)
Q Consensus 34 ~~~~l~H~f~L~SAY~~ 50 (61)
++..+.-.-++.|||.+
T Consensus 7 sgsslnpscrfssaysp 23 (33)
T PRK09979 7 SGSSLNPSCRFSSAYSP 23 (33)
T ss_pred cCCcCCcccccccccCh
Confidence 45566677788999985
No 5
>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=19.11 E-value=46 Score=23.42 Aligned_cols=12 Identities=25% Similarity=0.285 Sum_probs=9.3
Q ss_pred CCCCCCccccCC
Q psy6945 9 RVTSDHQDFKDL 20 (61)
Q Consensus 9 ~V~~~H~Df~~~ 20 (61)
.|..+||||+.+
T Consensus 12 Gid~~HPdl~~~ 23 (311)
T cd07497 12 GVDYSHPDLDIY 23 (311)
T ss_pred CcCCCChhHhcc
Confidence 377899999753
No 6
>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=18.96 E-value=38 Score=19.85 Aligned_cols=16 Identities=25% Similarity=0.389 Sum_probs=0.0
Q ss_pred eeccCCCccccCCCCC
Q psy6945 38 FTHSFKLASAYSEDIM 53 (61)
Q Consensus 38 l~H~f~L~SAY~~~~l 53 (61)
=.|||.+.|+...+.+
T Consensus 49 q~HPFTIas~~~~~~i 64 (105)
T PF08022_consen 49 QWHPFTIASSPEDNSI 64 (105)
T ss_dssp ----------------
T ss_pred cccccEeeccCCCCEE
Confidence 4799999998775433
No 7
>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=17.13 E-value=62 Score=22.25 Aligned_cols=14 Identities=14% Similarity=0.109 Sum_probs=10.5
Q ss_pred CCCCCCccccCCCc
Q psy6945 9 RVTSDHQDFKDLPY 22 (61)
Q Consensus 9 ~V~~~H~Df~~~~y 22 (61)
.|..+||||+++.-
T Consensus 26 Gid~~Hpdl~~~~~ 39 (277)
T cd04843 26 GWNLNHEDLVGNGI 39 (277)
T ss_pred CCCCCChhhccccc
Confidence 46778999987643
No 8
>PF12500 TRSP: TRSP domain C terminus to PRTase_2 ; InterPro: IPR022537 This domain is found in bacteria, and is typically between 174 and 217 amino acids in length. There is a conserved TRSP sequence motif.
Probab=17.01 E-value=75 Score=20.77 Aligned_cols=24 Identities=25% Similarity=0.526 Sum_probs=18.9
Q ss_pred CCceeccCCCccccCCCCCCceeeeeC
Q psy6945 35 SNDFTHSFKLASAYSEDIMPYTNYTYV 61 (61)
Q Consensus 35 ~~~l~H~f~L~SAY~~~~l~fTNyT~~ 61 (61)
+-.|.+.|++.+.|+.+. +||.|.
T Consensus 103 gyaI~~~~~F~~~~~~~~---~~ylYN 126 (155)
T PF12500_consen 103 GYAIRSGFSFPDPYDPGI---PNYLYN 126 (155)
T ss_pred CCccceeeEecCCCCCCC---cceEec
Confidence 446889999999999743 888874
No 9
>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
Probab=15.92 E-value=84 Score=21.19 Aligned_cols=15 Identities=20% Similarity=0.319 Sum_probs=11.4
Q ss_pred cccCCCCCCCccccCC
Q psy6945 5 LSTGRVTSDHQDFKDL 20 (61)
Q Consensus 5 Ls~G~V~~~H~Df~~~ 20 (61)
|.+| |..+||||+++
T Consensus 10 IDsG-vd~~hpdl~~~ 24 (247)
T cd07491 10 IDDG-VDILDSDLQGK 24 (247)
T ss_pred ECCC-cCCCchhhccc
Confidence 4444 78899999976
No 10
>PHA02672 ORF110 EEV glycoprotein; Provisional
Probab=15.92 E-value=59 Score=21.78 Aligned_cols=19 Identities=21% Similarity=0.317 Sum_probs=15.8
Q ss_pred CCCccccCCCCCCceeeee
Q psy6945 42 FKLASAYSEDIMPYTNYTY 60 (61)
Q Consensus 42 f~L~SAY~~~~l~fTNyT~ 60 (61)
|=|++||+.+=+||-||-|
T Consensus 44 ~f~~~AC~~GWvp~dd~Cy 62 (166)
T PHA02672 44 FFLKEACENGWVPIKDLCV 62 (166)
T ss_pred hhhhhhhhcCCeeccCEEE
Confidence 4589999999999988754
Done!