BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6966
(155 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3H0G|A Chain A, Rna Polymerase Ii From Schizosaccharomyces Pombe
pdb|3H0G|M Chain M, Rna Polymerase Ii From Schizosaccharomyces Pombe
Length = 1752
Score = 29.6 bits (65), Expect = 0.62, Method: Composition-based stats.
Identities = 13/30 (43%), Positives = 20/30 (66%)
Query: 126 LETTIVLGIEAVRKSVEKEMNTVLQFYGLY 155
+E +LGIEA R ++ KE+ V++F G Y
Sbjct: 1339 VEILQILGIEATRSALLKELRNVIEFDGSY 1368
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
Reductase From Sinorhizobium Meliloti
pdb|3U5T|B Chain B, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
Reductase From Sinorhizobium Meliloti
pdb|3U5T|C Chain C, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
Reductase From Sinorhizobium Meliloti
pdb|3U5T|D Chain D, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
Reductase From Sinorhizobium Meliloti
Length = 267
Score = 26.9 bits (58), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 6/51 (11%)
Query: 68 DPSPFILPLTGVSHPLDLHPSVLLLEGTTGSYGPEGTWIHDPLYGLRGGVI 118
D + PL + P D+ +V L GP+G W++ + GG+I
Sbjct: 223 DRFAKLAPLERLGTPQDIAGAVAFL------AGPDGAWVNGQVLRANGGII 267
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.144 0.452
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,751,515
Number of Sequences: 62578
Number of extensions: 139946
Number of successful extensions: 238
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 237
Number of HSP's gapped (non-prelim): 2
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)