Diaphorina citri psyllid: psy6983


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MLKAVGAFKLSGAGALFKCFPSQLHILLSVPFCFLCASQNHNSTGKRMSSSVNNKKPFTVFVEGNIGSGKTTFLDYFNKSGDITAYAEPVNLWRDVKGHNLLALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARWELTQCQICSQALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARFVLVIEK
ccccccHHHHHccccHHcccccccHccccccccHcccccccccccccccccccccccEEEEEECcccccHHHHHHHHHHccccEEECccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccEEEEECcccccHHHHHHHHHccccEEEEcc
****VGAFKLSGAGALFKCFPSQLHILLSVPFCFLCA*******************PFTVFVEGNIGSGKTTFLDYFNKSGDITAYAEPVNLWRDVKGHNLLALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARWELTQCQICSQALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARFVLVIEK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKAVGAFKLSGAGALFKCFPSQLHILLSVPFCFLCASQNHNSTGKRMSSSVNNKKPFTVFVEGNIGSGKTTFLDYFNKSGDITAYAEPVNLWRDVKGHNLLALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARWELTQCQICSQALMYENASRWSLTFQTMVQKTMLEVHLDQPITPIKMMERSIHSARFVLVIEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thymidine kinase 2, mitochondrial Deoxyribonucleoside kinase that phosphorylates thymidine, deoxycytidine, and deoxyuridine. Also phosphorylates anti-viral and anti-cancer nucleoside analogs.confidentQ9R088

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004797 [MF]thymidine kinase activityprobableGO:0019206, GO:0019205, GO:0016772, GO:0019136, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0004137 [MF]deoxycytidine kinase activityprobableGO:0019206, GO:0019205, GO:0016772, GO:0019136, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0034654 [BP]nucleobase-containing compound biosynthetic processprobableGO:0071704, GO:0006139, GO:0044271, GO:0044238, GO:0009987, GO:0006725, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901576, GO:0019438, GO:0046483, GO:1901362, GO:1901360, GO:0018130
GO:0046092 [BP]deoxycytidine metabolic processprobableGO:0046125, GO:0034641, GO:0006807, GO:0006213, GO:0009120, GO:1901360, GO:0072527, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657, GO:0044281
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0009117 [BP]nucleotide metabolic processprobableGO:0006139, GO:0044710, GO:0044238, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:0006753, GO:0055086, GO:0046483
GO:0046104 [BP]thymidine metabolic processprobableGO:0046125, GO:0034641, GO:0006807, GO:0006213, GO:0009120, GO:1901360, GO:0072527, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0008150, GO:0009116, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:1901657, GO:0044281

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P5Z, chain B
Confidence level:very confident
Coverage over the Query: 56-204
View the alignment between query and template
View the model in PyMOL
Template: 1B0U, chain A
Confidence level:confident
Coverage over the Query: 30-209
View the alignment between query and template
View the model in PyMOL