Diaphorina citri psyllid: psy698

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------

MRQKDDSIFADMLTRIRLGVLSQKDESTLTDRLVSLEQPSLAGRLKEVTQHLSSLPENTVCLLPTRHKCEQLNKAMINSIEEPAIHIDAGRRVPSYNNNNNNNNNNNNNNNNNNNNNNNNIHRTVWFELLCGEWPFKDQSPESIIFQVGKGMKPSLANLQASQDVKDVLMKCWSYKPSDRPDFITLMKSLEKLPKKRILARSPSHPLNLSRSAESVF

cccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEcccccHHHHccHHHHHHcccccEEEcccccccccccccccccccccccccccccccccEEHHHHHHHHcccccccccccHHHHHHHccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccccccccc

*******IFADMLTRIRLGVLSQKDESTLTDRLVSLEQPSLAGRLKEVTQHLSSLPENTVCLLPTRHKCEQLNKAMINSIEEPAIHIDAGRRVPSYNN****************NNNNNNIHRTVWFELLCGEWPFKDQSPESIIFQVGKGMKPSLANLQASQDVKDVLMKCWSYKPSDRPDFITLMKSLEK*************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0008595 [BP]	anterior/posterior axis specification, embryo	probable	GO:0032502, GO:0007389, GO:0032501, GO:0009952, GO:0044707, GO:0009948, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0008150, GO:0003002, GO:0000578, GO:0009798, GO:0007351, GO:0007350, GO:0035282, GO:0044699, GO:0009880
GO:0007426 [BP]	tracheal outgrowth, open tracheal system	probable	GO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0007265 [BP]	Ras protein signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U46, chain A
Confidence level:very confident
Coverage over the Query: 24-194
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
2y4i, chain B		very confident	Alignment \| Template Structure