RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy70
         (88 letters)



>gnl|CDD|215825 pfam00262, Calreticulin, Calreticulin family. 
          Length = 359

 Score = 92.0 bits (229), Expect = 7e-24
 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 3/56 (5%)

Query: 29  PFVIQYEVMFQDKHDCGGAYLKLLTEGPALQDLTAFNDKTPYTIMFGPDKCGTDDK 84
             V+QYEV  Q   DCGGAY+KLL++     D   F+ +TPYTIMFGPD CG+D K
Sbjct: 72  TLVVQYEVKLQQGIDCGGAYIKLLSKDF---DQKDFSGETPYTIMFGPDICGSDTK 124


>gnl|CDD|241298 cd01268, PTB_Numb, Numb Phosphotyrosine-binding (PTB) domain.
          Numb is a membrane associated adaptor protein which
          plays critical roles in cell fate determination. Numb
          proteins are involved in control of asymmetric cell
          division and cell fate choice, endocytosis, cell
          adhesion, cell migration, ubiquitination of specific
          substrates and a number of signaling pathways (Notch,
          Hedgehog, p53). Mutations in Numb plays a critical role
          in disease (cancer).  Numb has an N-terminal PTB domain
          and a C-terminal NumbF domain. PTB domains have a
          common PH-like fold and are found in various eukaryotic
          signaling molecules. This domain was initially shown to
          binds peptides with a NPXY motif with differing
          requirements for phosphorylation of the tyrosine,
          although more recent studies have found that some types
          of PTB domains can bind to peptides lack tyrosine
          residues altogether. In contrast to SH2 domains, which
          recognize phosphotyrosine and adjacent carboxy-terminal
          residues, PTB-domain binding specificity is conferred
          by residues amino-terminal to the phosphotyrosine.  PTB
          domains are classified into three groups:
          phosphotyrosine-dependent Shc-like,
          phosphotyrosine-dependent IRS-like, and
          phosphotyrosine-independent Dab-like PTB domains. This
          cd is part of the Dab-like subgroup.
          Length = 135

 Score = 41.5 bits (98), Expect = 4e-06
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 8  HQWQSDEASVRAGTCYFHVK 27
          HQWQ+DE +VR+GTC F VK
Sbjct: 1  HQWQADEEAVRSGTCSFPVK 20


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.137    0.441 

Gapped
Lambda     K      H
   0.267   0.0734    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,209,920
Number of extensions: 308750
Number of successful extensions: 151
Number of sequences better than 10.0: 1
Number of HSP's gapped: 150
Number of HSP's successfully gapped: 2
Length of query: 88
Length of database: 10,937,602
Length adjustment: 56
Effective length of query: 32
Effective length of database: 8,453,778
Effective search space: 270520896
Effective search space used: 270520896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.2 bits)