Query         psy7022
Match_columns 124
No_of_seqs    147 out of 227
Neff          4.9 
Searched_HMMs 46136
Date          Sat Aug 17 00:48:06 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7022.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7022hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4727|consensus              100.0 1.2E-45 2.6E-50  284.9  10.7  121    1-123    73-193 (193)
  2 smart00451 ZnF_U1 U1-like zinc  99.0 1.3E-10 2.9E-15   66.5   2.4   33    1-33      1-33  (35)
  3 PF12171 zf-C2H2_jaz:  Zinc-fin  98.9 1.1E-09 2.5E-14   60.4   2.2   27    3-29      1-27  (27)
  4 PF12874 zf-met:  Zinc-finger o  98.7 7.9E-09 1.7E-13   55.4   1.9   25    4-28      1-25  (25)
  5 PF08648 DUF1777:  Protein of u  98.4 1.2E-07 2.6E-12   72.1   1.9   18  106-123   126-143 (180)
  6 PF06220 zf-U1:  U1 zinc finger  98.3   4E-07 8.7E-12   54.7   1.8   32    1-32      1-34  (38)
  7 KOG0717|consensus               97.9 5.4E-06 1.2E-10   72.9   1.6   28    4-31    293-320 (508)
  8 COG5188 PRP9 Splicing factor 3  97.5 5.5E-05 1.2E-09   65.2   2.6   30    2-31    237-266 (470)
  9 KOG3454|consensus               97.2 0.00015 3.2E-09   56.2   1.6   32    1-32      1-34  (165)
 10 PF00096 zf-C2H2:  Zinc finger,  97.1 0.00027 5.8E-09   36.7   1.2   22    4-25      1-22  (23)
 11 KOG3408|consensus               96.9 0.00032 6.9E-09   52.3   1.1   29    2-30     56-84  (129)
 12 KOG3263|consensus               96.7 0.00068 1.5E-08   53.3   1.3   18  106-123   143-160 (196)
 13 PF07535 zf-DBF:  DBF zinc fing  96.7  0.0013 2.9E-08   41.6   2.3   43    3-50      5-47  (49)
 14 PF13912 zf-C2H2_6:  C2H2-type   96.6  0.0013 2.9E-08   35.3   1.4   22    4-25      2-23  (27)
 15 KOG2837|consensus               96.5 0.00072 1.6E-08   56.4   0.2   54    3-56     25-83  (309)
 16 PF13894 zf-C2H2_4:  C2H2-type   96.4  0.0021 4.5E-08   32.6   1.4   21    4-24      1-21  (24)
 17 PF12756 zf-C2H2_2:  C2H2 type   96.3  0.0015 3.2E-08   43.3   0.7   29    3-31     50-78  (100)
 18 COG5112 UFD2 U1-like Zn-finger  95.9  0.0025 5.4E-08   46.9   0.4   30    2-31     54-83  (126)
 19 PHA02768 hypothetical protein;  95.8  0.0044 9.6E-08   40.2   1.2   24    2-25      4-27  (55)
 20 PF03194 LUC7:  LUC7 N_terminus  95.6    0.02 4.3E-07   46.6   4.6   42    4-57    191-235 (254)
 21 KOG2384|consensus               95.5  0.0038 8.2E-08   50.2   0.1   30    2-32     83-112 (223)
 22 PLN02748 tRNA dimethylallyltra  95.4  0.0088 1.9E-07   52.6   2.1   30    3-32    418-448 (468)
 23 smart00355 ZnF_C2H2 zinc finge  95.3  0.0097 2.1E-07   30.2   1.2   21    4-24      1-21  (26)
 24 smart00586 ZnF_DBF Zinc finger  95.1   0.011 2.4E-07   37.5   1.2   26    2-30      4-29  (49)
 25 KOG3032|consensus               94.7    0.02 4.4E-07   47.0   2.1   30    1-31     33-62  (264)
 26 KOG2785|consensus               94.4   0.013 2.8E-07   50.7   0.4   32    3-34     68-99  (390)
 27 COG4049 Uncharacterized protei  94.0   0.016 3.5E-07   38.3   0.1   29    4-33     18-46  (65)
 28 KOG0150|consensus               93.8   0.028 6.2E-07   47.7   1.3   30    2-31      9-39  (336)
 29 PHA00616 hypothetical protein   91.9   0.048   1E-06   33.9   0.0   22    4-25      2-23  (44)
 30 KOG0227|consensus               90.5    0.12 2.6E-06   41.6   1.0   32    1-32     51-82  (222)
 31 PF14968 CCDC84:  Coiled coil p  90.2    0.45 9.7E-06   40.6   4.3   30    3-32     58-93  (336)
 32 KOG0796|consensus               90.0     0.3 6.4E-06   41.5   3.1   41    5-57    188-231 (319)
 33 KOG2785|consensus               90.0    0.45 9.8E-06   41.4   4.2   58    1-58      1-59  (390)
 34 COG5136 U1 snRNP-specific prot  89.7     0.1 2.2E-06   40.9   0.0   31    1-31      1-33  (188)
 35 COG5246 PRP11 Splicing factor   88.6    0.23 4.9E-06   39.8   1.3   32    1-32     51-82  (222)
 36 PF11931 DUF3449:  Domain of un  88.5    0.14 2.9E-06   40.8   0.0   33    3-35    101-137 (196)
 37 PF13913 zf-C2HC_2:  zinc-finge  88.2    0.32 6.8E-06   26.3   1.3   20    4-24      3-22  (25)
 38 PTZ00448 hypothetical protein;  86.7    0.43 9.3E-06   41.3   2.0   31    3-33    314-344 (373)
 39 smart00734 ZnF_Rad18 Rad18-lik  85.5    0.47   1E-05   26.0   1.1   19    5-24      3-21  (26)
 40 PF06658 DUF1168:  Protein of u  83.5     5.2 0.00011   30.4   6.3   45   48-92     50-94  (142)
 41 PF14968 CCDC84:  Coiled coil p  82.8    0.48   1E-05   40.5   0.5   27    5-34      1-27  (336)
 42 PF05605 zf-Di19:  Drought indu  82.7    0.67 1.5E-05   28.8   1.1   23    3-26      2-24  (54)
 43 PF04959 ARS2:  Arsenite-resist  82.7     1.9   4E-05   34.7   3.9   25    3-27     77-101 (214)
 44 PF13909 zf-H2C2_5:  C2H2-type   81.1     1.1 2.3E-05   23.2   1.3   20    4-24      1-20  (24)
 45 PF09237 GAGA:  GAGA factor;  I  80.4       1 2.2E-05   29.2   1.3   21    4-24     25-45  (54)
 46 PF13465 zf-H2C2_2:  Zinc-finge  80.0    0.79 1.7E-05   24.6   0.6   12    3-14     14-25  (26)
 47 PF12756 zf-C2H2_2:  C2H2 type   79.2    0.61 1.3E-05   30.6   0.0   24    6-30      2-25  (100)
 48 PF04988 AKAP95:  A-kinase anch  79.0     0.7 1.5E-05   36.0   0.3   47    4-50     92-140 (165)
 49 KOG3792|consensus               74.0       1 2.3E-05   42.2   0.0   31    3-33    359-389 (816)
 50 PF12855 Ecl1:  Life-span regul  73.7    0.89 1.9E-05   28.0  -0.3   16    4-19      7-25  (43)
 51 PF13821 DUF4187:  Domain of un  73.0     1.9 4.1E-05   27.6   1.0   24    3-26     27-50  (55)
 52 PHA00732 hypothetical protein   72.7     2.1 4.6E-05   29.1   1.3   21    4-24      2-22  (79)
 53 PF04423 Rad50_zn_hook:  Rad50   65.9       3 6.4E-05   25.9   0.8   13    5-17     22-34  (54)
 54 PF15437 PGBA_C:  Plasminogen-b  65.6      32 0.00069   24.2   6.0   48   39-86     32-79  (86)
 55 KOG2482|consensus               65.3       2 4.3E-05   37.4  -0.1   28    3-30    195-222 (423)
 56 KOG2636|consensus               65.3     5.7 0.00012   35.6   2.7   33    3-35    401-437 (497)
 57 PHA00733 hypothetical protein   64.2     3.8 8.3E-05   30.0   1.3   22    3-24     73-94  (128)
 58 KOG2636|consensus               63.9      11 0.00024   33.8   4.3   31    2-32    270-300 (497)
 59 PF04780 DUF629:  Protein of un  60.7     5.9 0.00013   35.3   2.0   21    4-24     58-78  (466)
 60 KOG2462|consensus               59.5     4.3 9.4E-05   34.0   0.9   27    3-29    215-241 (279)
 61 PF08790 zf-LYAR:  LYAR-type C2  59.4     4.4 9.6E-05   22.9   0.7   19    4-23      1-19  (28)
 62 KOG1144|consensus               58.8      37 0.00081   32.9   6.9   15   43-57    216-230 (1064)
 63 PF02892 zf-BED:  BED zinc fing  56.9     6.8 0.00015   22.9   1.2   21    3-23     16-40  (45)
 64 COG5188 PRP9 Splicing factor 3  56.3      14  0.0003   32.6   3.5   30    3-32    374-404 (470)
 65 KOG2505|consensus               55.8     7.7 0.00017   35.4   1.9   48    3-50     66-114 (591)
 66 PF14616 DUF4451:  Domain of un  55.3     5.9 0.00013   29.0   0.9   22    5-26     27-51  (124)
 67 KOG4722|consensus               55.3     4.4 9.5E-05   36.5   0.3   47    5-51    495-551 (672)
 68 KOG1842|consensus               52.9     5.2 0.00011   35.8   0.4   22    3-24     15-36  (505)
 69 COG5200 LUC7 U1 snRNP componen  51.9       5 0.00011   32.9   0.1   26    5-30    187-215 (258)
 70 KOG4055|consensus               51.4      62  0.0013   26.1   6.1   30   62-91    108-137 (213)
 71 PRK02224 chromosome segregatio  47.5      60  0.0013   30.0   6.3   19    5-23    453-473 (880)
 72 TIGR03831 YgiT_finger YgiT-typ  44.5      12 0.00025   21.6   0.9   14    2-15     31-44  (46)
 73 PF04988 AKAP95:  A-kinase anch  42.9      14 0.00031   28.8   1.4   44    4-47      1-45  (165)
 74 KOG3623|consensus               41.7      11 0.00024   36.0   0.7   40    3-45    950-989 (1007)
 75 KOG3623|consensus               41.6       9 0.00019   36.6   0.1   50    3-52    309-376 (1007)
 76 PRK10328 DNA binding protein,   40.7 1.5E+02  0.0033   22.1   7.4   17   70-86     37-53  (134)
 77 smart00614 ZnF_BED BED zinc fi  40.7      15 0.00033   22.2   1.0   22    4-25     19-45  (50)
 78 PF08432 Vfa1:  AAA-ATPase Vps4  40.3      47   0.001   25.5   3.9   18    8-26     38-55  (182)
 79 KOG3993|consensus               40.1      12 0.00027   33.5   0.7   26    3-28    295-321 (500)
 80 PHA03123 dUTPase; Provisional   38.5      16 0.00034   32.2   1.1   14  110-123   388-401 (402)
 81 KOG2894|consensus               38.4 1.2E+02  0.0025   26.1   6.1   17   41-57     67-83  (331)
 82 PF08262 Lem_TRP:  Leucophaea m  38.1      13 0.00029   16.4   0.3    7  112-118     3-9   (10)
 83 PF09986 DUF2225:  Uncharacteri  36.9      10 0.00022   29.9  -0.3   22    3-24      5-26  (214)
 84 PF04615 Utp14:  Utp14 protein;  36.5 1.1E+02  0.0025   28.2   6.3   52   38-94    194-245 (735)
 85 COG1645 Uncharacterized Zn-fin  35.7      16 0.00035   27.4   0.7   12    2-13     43-54  (131)
 86 PHA02562 46 endonuclease subun  35.3 1.8E+02  0.0039   25.1   7.1   20    4-23    285-304 (562)
 87 KOG1074|consensus               35.2      17 0.00036   35.1   0.8   21    3-23    879-899 (958)
 88 PF13240 zinc_ribbon_2:  zinc-r  34.8      14 0.00031   19.5   0.2   15    5-19      1-15  (23)
 89 TIGR00570 cdk7 CDK-activating   34.6 2.9E+02  0.0063   23.5   8.3   16    2-17     42-57  (309)
 90 PF06936 Selenoprotein_S:  Sele  34.5 1.1E+02  0.0023   24.2   5.1    8  109-116   166-173 (190)
 91 KOG3576|consensus               34.3      15 0.00032   30.3   0.2   20    4-23    174-193 (267)
 92 PF00692 dUTPase:  dUTPase;  In  33.6      21 0.00045   25.2   0.9   12  110-121   117-128 (129)
 93 PHA03127 dUTPase; Provisional   33.1      20 0.00044   30.6   0.9   12  110-121   309-320 (322)
 94 KOG3634|consensus               33.0      65  0.0014   28.0   3.9   13  108-120   181-194 (361)
 95 PTZ00373 60S Acidic ribosomal   32.8      26 0.00057   25.5   1.3    7  113-119   106-112 (112)
 96 PF03879 Cgr1:  Cgr1 family;  I  32.1 1.4E+02   0.003   21.7   5.0   17   41-57     41-57  (108)
 97 PF13119 DUF3973:  Domain of un  31.5      13 0.00029   22.7  -0.3    8    4-11      2-9   (41)
 98 PHA03126 dUTPase; Provisional   31.1      22 0.00049   30.4   0.9   12  110-121   313-324 (326)
 99 COG5067 DBF4 Protein kinase es  30.7      13 0.00029   32.9  -0.5   30    5-37    424-453 (468)
100 PF13462 Thioredoxin_4:  Thiore  30.1      10 0.00022   26.7  -1.2   21    3-23     21-41  (162)
101 KOG2462|consensus               29.9      26 0.00056   29.5   1.0   23    3-25    187-209 (279)
102 PRK10947 global DNA-binding tr  29.6 2.4E+02  0.0052   21.0   7.3   13   19-31      4-16  (135)
103 PF05766 NinG:  Bacteriophage L  29.5 1.6E+02  0.0034   23.4   5.3   12    6-17    126-137 (189)
104 KOG2593|consensus               29.3      21 0.00046   31.7   0.4   54    2-55    127-184 (436)
105 COG4469 CoiA Competence protei  28.7      22 0.00047   30.7   0.4   10    3-12     25-34  (342)
106 PF05477 SURF2:  Surfeit locus   28.6      30 0.00065   28.4   1.1   32    3-34     79-111 (244)
107 PF10825 DUF2752:  Protein of u  28.4      21 0.00045   22.3   0.1   10    3-12      9-18  (52)
108 PHA03129 dUTPase; Provisional   27.9      28  0.0006   31.0   0.9   12  110-121   423-434 (436)
109 cd04411 Ribosomal_P1_P2_L12p R  27.4      38 0.00083   24.2   1.4   12   41-52     17-28  (105)
110 PF13842 Tnp_zf-ribbon_2:  DDE_  26.9      26 0.00057   19.8   0.4   11    3-13     16-26  (32)
111 cd00085 HNHc HNH nucleases; HN  26.4      19  0.0004   20.7  -0.3   24    4-27     12-35  (57)
112 smart00834 CxxC_CXXC_SSSS Puta  26.2      31 0.00068   19.4   0.7   15    3-17      5-19  (41)
113 TIGR03830 CxxCG_CxxCG_HTH puta  26.2      32 0.00068   23.8   0.8   17    2-18     30-46  (127)
114 KOG2186|consensus               25.9      29 0.00062   29.1   0.6   22    2-24     28-49  (276)
115 smart00400 ZnF_CHCC zinc finge  25.7      44 0.00094   20.5   1.3   26    2-28     22-47  (55)
116 PF07649 C1_3:  C1-like domain;  25.2      26 0.00057   19.1   0.2   13    2-14     14-26  (30)
117 PHA03130 dUTPase; Provisional   25.2      33 0.00071   29.9   0.8   13  109-121   354-366 (368)
118 TIGR00606 rad50 rad50. This fa  24.7 1.9E+02  0.0042   28.5   6.0   21    5-25    679-702 (1311)
119 cd05833 Ribosomal_P2 Ribosomal  24.4      49  0.0011   23.8   1.5    7  113-119   103-109 (109)
120 PF01418 HTH_6:  Helix-turn-hel  24.1      33 0.00071   22.4   0.5   12  108-119    53-64  (77)
121 PF15005 IZUMO:  Izumo sperm-eg  23.8 3.2E+02  0.0069   21.0   6.0   81    2-82      2-108 (160)
122 PF00558 Vpu:  Vpu protein;  In  23.7      39 0.00084   23.5   0.8    8  110-117    69-76  (81)
123 PF01844 HNH:  HNH endonuclease  23.6      19 0.00041   20.7  -0.7   23    6-28      1-24  (47)
124 COG5509 Uncharacterized small   23.6 1.5E+02  0.0032   19.8   3.5   25   64-88     28-52  (65)
125 PF04640 PLATZ:  PLATZ transcri  23.5      30 0.00064   23.4   0.2   16    2-17     48-63  (72)
126 KOG2893|consensus               23.0      37  0.0008   28.7   0.7   44    4-47     11-66  (341)
127 KOG3608|consensus               22.6      27  0.0006   30.8  -0.1   20    5-24    209-228 (467)
128 KOG2635|consensus               22.5 1.3E+02  0.0028   27.3   4.0   11   41-51    125-135 (512)
129 KOG0801|consensus               22.3      37 0.00081   27.0   0.6   14    2-15    137-150 (205)
130 PF07043 DUF1328:  Protein of u  21.8      48   0.001   20.0   0.9   11  109-119     9-19  (39)
131 KOG3576|consensus               21.8      33 0.00071   28.3   0.2   23    3-25    117-139 (267)
132 COG5487 Small integral membran  21.6      49  0.0011   21.3   0.9   12  108-119    13-24  (54)
133 COG5151 SSL1 RNA polymerase II  21.6      37 0.00079   29.6   0.4   30    1-30    306-346 (421)
134 PLN00138 large subunit ribosom  21.4      59  0.0013   23.6   1.4    8  112-119   106-113 (113)
135 PF09712 PHA_synth_III_E:  Poly  21.1 1.1E+02  0.0023   25.4   3.1   21   17-37    226-246 (293)
136 KOG1029|consensus               21.1 2.8E+02  0.0062   27.2   6.1    8   63-70    370-377 (1118)
137 KOG3792|consensus               21.0      38 0.00082   32.2   0.4   29    4-32    194-222 (816)
138 PF12760 Zn_Tnp_IS1595:  Transp  21.0      48   0.001   19.8   0.8   11    2-12     17-27  (46)
139 PF03992 ABM:  Antibiotic biosy  20.7      87  0.0019   19.0   2.0   18   13-30     57-74  (78)
140 smart00531 TFIIE Transcription  20.7      44 0.00096   24.6   0.7   16    2-17     98-113 (147)
141 KOG2807|consensus               20.7      40 0.00086   29.4   0.5   10    1-10    274-283 (378)
142 KOG1280|consensus               20.6      48   0.001   29.0   1.0   24    3-26     79-102 (381)
143 PF04504 DUF573:  Protein of un  20.6   1E+02  0.0022   21.5   2.5   17   41-57     49-65  (98)
144 KOG2963|consensus               20.6 5.4E+02   0.012   22.8   7.3   10   41-50    316-325 (405)
145 PF10186 Atg14:  UV radiation r  20.4 3.9E+02  0.0085   20.7   6.1   10    3-12     11-20  (302)

No 1  
>KOG4727|consensus
Probab=100.00  E-value=1.2e-45  Score=284.87  Aligned_cols=121  Identities=69%  Similarity=1.122  Sum_probs=111.0

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHHhccccccccccHHHHHHHHHHHHHHHHhhhhcccHHHHHHHHHHHHHHH
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKL   80 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~ver~tle~V~~rl~~lk~k~~~~~~~~~~~eRl~~~~eeEek~   80 (124)
                      ++||||.||||+|+||++|||||||+.|++|+||||+|+|+||+||+.||+.++.+.+.....+++++||.+.+++|++.
T Consensus        73 ~~GyyCdVCdcvvKDSinflDHiNgKkHqrnlgmsm~verst~~qv~erf~~~k~k~~~~~ke~~vE~r~~e~qeee~rl  152 (193)
T KOG4727|consen   73 KGGYYCDVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKERFEQNKKKMEEKQKEYDVEERLRETQEEEERL  152 (193)
T ss_pred             cCceeeeecceeehhhHHHHHHhccHHHHHHHhhhhcchhhhHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999998888889999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhccCCccccCChHHHHHHhCCCCCCCCCC
Q psy7022          81 KEYRRERRKEKKRKLDDGEEEEEGDQSDLAAIMGFSGFGGGKK  123 (124)
Q Consensus        81 re~rr~kkkekk~~~~~~~~~~~~~~~emaamMGF~gFGssKK  123 (124)
                      +..+++|++++|+...+..+.+  ..|||+|||||||||+|||
T Consensus       153 kd~~kEK~ke~K~~t~~di~~e--s~~~~~amMGFSgF~tsKk  193 (193)
T KOG4727|consen  153 KDTRKEKKKEKKRATKEDIDFE--SKDEMAAMMGFSGFGTSKK  193 (193)
T ss_pred             HHHHHHHHHHHhhccccccccc--ccHHHHHHhCccccccCCC
Confidence            9999999988887765432222  2489999999999999997


No 2  
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=99.03  E-value=1.3e-10  Score=66.48  Aligned_cols=33  Identities=36%  Similarity=0.874  Sum_probs=30.4

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHHhc
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLG   33 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G   33 (124)
                      .++|||++|+++|.++.+|..|++|++|..++.
T Consensus         1 ~~~~~C~~C~~~~~~~~~~~~H~~gk~H~~~~~   33 (35)
T smart00451        1 TGGFYCKLCNVTFTDEISVEAHLKGKKHKKNVK   33 (35)
T ss_pred             CcCeEccccCCccCCHHHHHHHHChHHHHHHHH
Confidence            478999999999999999999999999998754


No 3  
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=98.87  E-value=1.1e-09  Score=60.35  Aligned_cols=27  Identities=30%  Similarity=0.755  Sum_probs=25.2

Q ss_pred             CccccccCceecchhhHhhhhccHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQ   29 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~   29 (124)
                      -|||++||++|.+..+|..|++|+.|.
T Consensus         1 q~~C~~C~k~f~~~~~~~~H~~sk~Hk   27 (27)
T PF12171_consen    1 QFYCDACDKYFSSENQLKQHMKSKKHK   27 (27)
T ss_dssp             -CBBTTTTBBBSSHHHHHCCTTSHHHH
T ss_pred             CCCcccCCCCcCCHHHHHHHHccCCCC
Confidence            389999999999999999999999994


No 4  
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=98.70  E-value=7.9e-09  Score=55.38  Aligned_cols=25  Identities=28%  Similarity=0.816  Sum_probs=24.5

Q ss_pred             ccccccCceecchhhHhhhhccHHH
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKKH   28 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~H   28 (124)
                      |||.+|+++|.+..+|..|++|+.|
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~~H   25 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSKKH   25 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTHHH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcCCC
Confidence            8999999999999999999999998


No 5  
>PF08648 DUF1777:  Protein of unknown function (DUF1777);  InterPro: IPR013957  This entry shows eukaryotic proteins of unknown function. Some of the proteins are putative nucleic acid binding proteins. 
Probab=98.40  E-value=1.2e-07  Score=72.07  Aligned_cols=18  Identities=39%  Similarity=0.874  Sum_probs=15.9

Q ss_pred             hHHHHHHhCCCCCCCCCC
Q psy7022         106 QSDLAAIMGFSGFGGGKK  123 (124)
Q Consensus       106 ~~emaamMGF~gFGssKK  123 (124)
                      +.+||+||||+||||||-
T Consensus       126 e~~mmk~MGf~gF~TTKg  143 (180)
T PF08648_consen  126 EEEMMKMMGFGGFGTTKG  143 (180)
T ss_pred             HHHHHHhhcccccccCCC
Confidence            457999999999999985


No 6  
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=98.28  E-value=4e-07  Score=54.65  Aligned_cols=32  Identities=38%  Similarity=0.636  Sum_probs=18.2

Q ss_pred             CCCccccccCcee-cch-hhHhhhhccHHHHHHh
Q psy7022           1 MLGYYCNVCDCVV-KDS-INFLDHINGKKHQRNL   32 (124)
Q Consensus         1 ~~gfyC~vCd~~f-kDs-~~~ldHlngk~H~~~~   32 (124)
                      ++.|||+.|+++| .|+ ++...|.+|.+|+.|.
T Consensus         1 m~ryyCdyC~~~~~~d~~~~Rk~H~~G~kH~~nv   34 (38)
T PF06220_consen    1 MPRYYCDYCKKYLTHDSPSIRKQHERGWKHKENV   34 (38)
T ss_dssp             --S-B-TTT--B-S--SHHHHHHHT--THHHHHH
T ss_pred             CcCeecccccceecCCChHHHHHhhccHHHHHHH
Confidence            4689999999999 677 4669999999999875


No 7  
>KOG0717|consensus
Probab=97.87  E-value=5.4e-06  Score=72.87  Aligned_cols=28  Identities=39%  Similarity=0.723  Sum_probs=26.9

Q ss_pred             ccccccCceecchhhHhhhhccHHHHHH
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKKHQRN   31 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~H~~~   31 (124)
                      +||.||+++|++-.++.+|.||++|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnSKKHken  320 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENSKKHKEN  320 (508)
T ss_pred             eEEeeccccccchHHHHhhHHHHHHHHH
Confidence            8999999999999999999999999874


No 8  
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=97.52  E-value=5.5e-05  Score=65.17  Aligned_cols=30  Identities=30%  Similarity=0.523  Sum_probs=28.5

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQRN   31 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~~   31 (124)
                      .+|||++|++||+.|.+|..|+-|+.|.++
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~Hl~gK~H~k~  266 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYHLEGKRHCKE  266 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHHHhhhhhhhh
Confidence            589999999999999999999999999884


No 9  
>KOG3454|consensus
Probab=97.22  E-value=0.00015  Score=56.20  Aligned_cols=32  Identities=41%  Similarity=0.834  Sum_probs=27.3

Q ss_pred             CCCccccccC-ceecchh-hHhhhhccHHHHHHh
Q psy7022           1 MLGYYCNVCD-CVVKDSI-NFLDHINGKKHQRNL   32 (124)
Q Consensus         1 ~~gfyC~vCd-~~fkDs~-~~ldHlngk~H~~~~   32 (124)
                      +..|||+.|| ..+.||+ +-..|++|.+|+.|.
T Consensus         1 MpRYyCDYCdt~LthDslsvRK~H~~GrkH~~nv   34 (165)
T KOG3454|consen    1 MPRYYCDYCDTYLTHDSLSVRKTHCGGRKHKDNV   34 (165)
T ss_pred             CCcchhhhhhhhhhcccHHHHHhhhhhHHHHHHH
Confidence            3579999999 6778887 889999999999853


No 10 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.06  E-value=0.00027  Score=36.73  Aligned_cols=22  Identities=23%  Similarity=0.567  Sum_probs=20.4

Q ss_pred             ccccccCceecchhhHhhhhcc
Q psy7022           4 YYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlng   25 (124)
                      |-|+.|++.|.+...|..|+..
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            6799999999999999999975


No 11 
>KOG3408|consensus
Probab=96.95  E-value=0.00032  Score=52.29  Aligned_cols=29  Identities=28%  Similarity=0.505  Sum_probs=27.7

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQR   30 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~   30 (124)
                      |-|||..|.+.|-|+.++..|..++.|.+
T Consensus        56 GqfyCi~CaRyFi~~~~l~~H~ktK~HKr   84 (129)
T KOG3408|consen   56 GQFYCIECARYFIDAKALKTHFKTKVHKR   84 (129)
T ss_pred             ceeehhhhhhhhcchHHHHHHHhccHHHH
Confidence            57999999999999999999999999987


No 12 
>KOG3263|consensus
Probab=96.71  E-value=0.00068  Score=53.35  Aligned_cols=18  Identities=44%  Similarity=0.778  Sum_probs=15.8

Q ss_pred             hHHHHHHhCCCCCCCCCC
Q psy7022         106 QSDLAAIMGFSGFGGGKK  123 (124)
Q Consensus       106 ~~emaamMGF~gFGssKK  123 (124)
                      ..||++||||+||-|||-
T Consensus       143 eiEMmk~MGf~gFDtTkg  160 (196)
T KOG3263|consen  143 EIEMMKIMGFSGFDTTKG  160 (196)
T ss_pred             HHHHHHHhCcCcccCCCC
Confidence            457999999999999974


No 13 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=96.69  E-value=0.0013  Score=41.58  Aligned_cols=43  Identities=23%  Similarity=0.453  Sum_probs=31.8

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhccccccccccHHHHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQVKKRF   50 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~ver~tle~V~~rl   50 (124)
                      .-||+.|...|.|   |..||.|++|..=...+.+.  ..||.+-.+|
T Consensus         5 ~GYCE~C~~ky~~---l~~Hi~s~~Hr~FA~~~~Nf--~~lD~li~~l   47 (49)
T PF07535_consen    5 PGYCENCRVKYDD---LEEHIQSEKHRKFAENDSNF--KELDSLISQL   47 (49)
T ss_pred             CccCccccchhhh---HHHHhCCHHHHHHHcCcccH--HHHHHHHHHh
Confidence            5699999999986   99999999999865555553  3455554443


No 14 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=96.55  E-value=0.0013  Score=35.31  Aligned_cols=22  Identities=14%  Similarity=0.404  Sum_probs=20.3

Q ss_pred             ccccccCceecchhhHhhhhcc
Q psy7022           4 YYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlng   25 (124)
                      |.|.+|+.+|.+..+|..|+..
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~   23 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRS   23 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCT
T ss_pred             CCCCccCCccCChhHHHHHhHH
Confidence            7899999999999999999953


No 15 
>KOG2837|consensus
Probab=96.50  E-value=0.00072  Score=56.41  Aligned_cols=54  Identities=26%  Similarity=0.432  Sum_probs=38.5

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhccccc-----cccccHHHHHHHHHHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMR-----VERSSLDQVKKRFDMNKKK   56 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~-----ver~tle~V~~rl~~lk~k   56 (124)
                      .|||..|-+.|+|-+.|..|+.|..|++.+-.-.-     +++-|-+=.+.-|+.|++.
T Consensus        25 RwyCqmCQkQcrDeNGFkCH~~SeSHqRql~~~~~Np~~~~~~fs~eF~~dFl~LLr~~   83 (309)
T KOG2837|consen   25 RWYCQMCQKQCRDENGFKCHTMSESHQRQLLLFALNPGRSLERFSNEFEKDFLSLLRQR   83 (309)
T ss_pred             HHHHHHHHHHhccccccccccCCHHHHHHHHHHHhCcchhHHHhHHHHHHHHHHHHHHH
Confidence            48999999999999999999999999997644322     2233333344445555554


No 16 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=96.36  E-value=0.0021  Score=32.63  Aligned_cols=21  Identities=14%  Similarity=0.586  Sum_probs=17.7

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      |-|++|+.+|.+...|..|+.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHH
Confidence            679999999999999999985


No 17 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.27  E-value=0.0015  Score=43.34  Aligned_cols=29  Identities=17%  Similarity=0.584  Sum_probs=25.5

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRN   31 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~   31 (124)
                      .|.|.+|+..|.+..++..||+++.|...
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~H~~~   78 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKHHKKR   78 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTTTTC-
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCccCCCc
Confidence            58999999999999999999999999873


No 18 
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=95.88  E-value=0.0025  Score=46.93  Aligned_cols=30  Identities=27%  Similarity=0.484  Sum_probs=27.9

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQRN   31 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~~   31 (124)
                      |-|||..|++.|-.+.++..|..|+-|.+.
T Consensus        54 GqhYCieCaryf~t~~aL~~HkkgkvHkRR   83 (126)
T COG5112          54 GQHYCIECARYFITEKALMEHKKGKVHKRR   83 (126)
T ss_pred             ceeeeehhHHHHHHHHHHHHHhccchhHHH
Confidence            569999999999999999999999999873


No 19 
>PHA02768 hypothetical protein; Provisional
Probab=95.78  E-value=0.0044  Score=40.16  Aligned_cols=24  Identities=25%  Similarity=0.686  Sum_probs=22.4

Q ss_pred             CCccccccCceecchhhHhhhhcc
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlng   25 (124)
                      -||.|+.|++.|..+++|..|...
T Consensus         4 ~~y~C~~CGK~Fs~~~~L~~H~r~   27 (55)
T PHA02768          4 LGYECPICGEIYIKRKSMITHLRK   27 (55)
T ss_pred             cccCcchhCCeeccHHHHHHHHHh
Confidence            389999999999999999999976


No 20 
>PF03194 LUC7:  LUC7 N_terminus;  InterPro: IPR004882 This family consists of several LUC7 protein homologues that are restricted to eukaryotes. LUC7 has been shown to be a U1 snRNA associated protein [] with a role in splice site recognition []. The entry contains human and mouse LUC7 like (LUC7L) proteins [] and human cisplatin resistance-associated overexpressed protein (CROP) []. 
Probab=95.60  E-value=0.02  Score=46.61  Aligned_cols=42  Identities=29%  Similarity=0.535  Sum_probs=31.2

Q ss_pred             ccccccC--ceecchh-hHhhhhccHHHHHHhccccccccccHHHHHHHHHHHHHHH
Q psy7022           4 YYCNVCD--CVVKDSI-NFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKY   57 (124)
Q Consensus         4 fyC~vCd--~~fkDs~-~~ldHlngk~H~~~~G~s~~ver~tle~V~~rl~~lk~k~   57 (124)
                      -.|+||+  ++..|+. =+.||+.||+|+-            .-.||..|+.|+++.
T Consensus       191 ~VCeVCGA~Ls~~D~d~RladH~~GK~HlG------------y~~IR~~l~el~e~~  235 (254)
T PF03194_consen  191 EVCEVCGAFLSVGDNDRRLADHFGGKQHLG------------YAKIREKLKELKEKR  235 (254)
T ss_pred             cchhhhhhHHhccchHHHHHHHhccchhhh------------HHHHHHHHHHHHHHH
Confidence            4699999  5556666 4899999999975            445677777776654


No 21 
>KOG2384|consensus
Probab=95.51  E-value=0.0038  Score=50.20  Aligned_cols=30  Identities=30%  Similarity=0.631  Sum_probs=23.9

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHHHh
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      .+|||++||..|.++ .+..|+.|--|+.++
T Consensus        83 ~lfyCE~Cd~~ip~~-~~snH~tSttHllsl  112 (223)
T KOG2384|consen   83 ALFYCEVCDIYIPNS-KKSNHFTSTTHLLSL  112 (223)
T ss_pred             ccchhhhhhhhccCC-CCccchhhHHHHhhh
Confidence            589999999999985 456788887777654


No 22 
>PLN02748 tRNA dimethylallyltransferase
Probab=95.42  E-value=0.0088  Score=52.64  Aligned_cols=30  Identities=23%  Similarity=0.696  Sum_probs=27.2

Q ss_pred             CccccccCc-eecchhhHhhhhccHHHHHHh
Q psy7022           3 GYYCNVCDC-VVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         3 gfyC~vCd~-~fkDs~~~ldHlngk~H~~~~   32 (124)
                      -|+|++|+. ++....+|.-||+|+.|.+++
T Consensus       418 ~~~Ce~C~~~~~~G~~eW~~Hlksr~Hk~~~  448 (468)
T PLN02748        418 QYVCEACGNKVLRGAHEWEQHKQGRGHRKRV  448 (468)
T ss_pred             cccccCCCCcccCCHHHHHHHhcchHHHHHH
Confidence            478999997 999999999999999998843


No 23 
>smart00355 ZnF_C2H2 zinc finger.
Probab=95.26  E-value=0.0097  Score=30.19  Aligned_cols=21  Identities=29%  Similarity=0.637  Sum_probs=19.6

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      |-|+.|+.+|.+...+..|+.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHH
Confidence            579999999999999999986


No 24 
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins.
Probab=95.07  E-value=0.011  Score=37.47  Aligned_cols=26  Identities=27%  Similarity=0.519  Sum_probs=22.9

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQR   30 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~   30 (124)
                      ..-||+.|..-|.   .|..||.|++|..
T Consensus         4 k~GYCE~Cr~kfd---~l~~Hi~s~~Hr~   29 (49)
T smart00586        4 KPGYCENCREKYD---DLETHLLSEKHRR   29 (49)
T ss_pred             CCcccccHhHHHh---hHHHHhccHHHHH
Confidence            3569999999998   5888999999987


No 25 
>KOG3032|consensus
Probab=94.67  E-value=0.02  Score=47.00  Aligned_cols=30  Identities=30%  Similarity=0.502  Sum_probs=26.6

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHH
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRN   31 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~   31 (124)
                      +|...|.||+.-.| .+.|.-|+||++|.-+
T Consensus        33 sgql~C~vCn~piK-p~lW~vHvnsKkHre~   62 (264)
T KOG3032|consen   33 SGQLVCRVCNVPIK-PSLWDVHVNSKKHREA   62 (264)
T ss_pred             CCCeeEEEecCccc-HHHHHHHhccHHHHHH
Confidence            45678999999999 9999999999999654


No 26 
>KOG2785|consensus
Probab=94.41  E-value=0.013  Score=50.72  Aligned_cols=32  Identities=28%  Similarity=0.528  Sum_probs=28.9

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhcc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLGM   34 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~   34 (124)
                      -+||.||.+.|..+.++.+||+|+.|..++-.
T Consensus        68 ~~~c~~c~k~~~s~~a~~~hl~Sk~h~~~~~~   99 (390)
T KOG2785|consen   68 VVYCEACNKSFASPKAHENHLKSKKHVENLSN   99 (390)
T ss_pred             ceehHHhhccccChhhHHHHHHHhhcchhhhh
Confidence            48999999999999999999999999876544


No 27 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.97  E-value=0.016  Score=38.29  Aligned_cols=29  Identities=28%  Similarity=0.639  Sum_probs=23.9

Q ss_pred             ccccccCceecchhhHhhhhccHHHHHHhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKKHQRNLG   33 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~H~~~~G   33 (124)
                      |-|+-||..|+++-.|..|+| +.|....|
T Consensus        18 lrCPRC~~~FR~~K~Y~RHVN-KaH~~~~~   46 (65)
T COG4049          18 LRCPRCGMVFRRRKDYIRHVN-KAHGWLFG   46 (65)
T ss_pred             eeCCchhHHHHHhHHHHHHhh-HHhhhhhc
Confidence            579999999999999999998 45555443


No 28 
>KOG0150|consensus
Probab=93.82  E-value=0.028  Score=47.65  Aligned_cols=30  Identities=30%  Similarity=0.564  Sum_probs=25.2

Q ss_pred             CCccccccCceecchhh-HhhhhccHHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSIN-FLDHINGKKHQRN   31 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~-~ldHlngk~H~~~   31 (124)
                      +.+||.+|-|||.|+-. -..|=-|+.|..+
T Consensus         9 ~kkfCdyCKiWi~dN~~Sv~~He~GkrHke~   39 (336)
T KOG0150|consen    9 PKKFCDYCKIWIKDNPASVRFHERGKRHKEN   39 (336)
T ss_pred             cchhhhhhhhhhcCChHHHHhHhhhhHHHHH
Confidence            57899999999999984 4556699999874


No 29 
>PHA00616 hypothetical protein
Probab=91.90  E-value=0.048  Score=33.87  Aligned_cols=22  Identities=18%  Similarity=0.596  Sum_probs=20.3

Q ss_pred             ccccccCceecchhhHhhhhcc
Q psy7022           4 YYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlng   25 (124)
                      |-|+-|+..|.....+..|++.
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~   23 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLS   23 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHH
Confidence            7799999999999999999953


No 30 
>KOG0227|consensus
Probab=90.50  E-value=0.12  Score=41.58  Aligned_cols=32  Identities=38%  Similarity=0.699  Sum_probs=28.9

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHHh
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      .|.|-|..|.-.--+-.+|+.|..|++|+-|+
T Consensus        51 ~G~yeCkLClT~H~ne~Syl~HtqGKKHq~Nl   82 (222)
T KOG0227|consen   51 LGKYECKLCLTLHNNEGSYLAHTQGKKHQTNL   82 (222)
T ss_pred             CcceeehhhhhhhcchhhhhhhhccchhhHHH
Confidence            36799999999999999999999999998865


No 31 
>PF14968 CCDC84:  Coiled coil protein 84
Probab=90.23  E-value=0.45  Score=40.62  Aligned_cols=30  Identities=27%  Similarity=0.848  Sum_probs=27.3

Q ss_pred             CccccccCceecch------hhHhhhhccHHHHHHh
Q psy7022           3 GYYCNVCDCVVKDS------INFLDHINGKKHQRNL   32 (124)
Q Consensus         3 gfyC~vCd~~fkDs------~~~ldHlngk~H~~~~   32 (124)
                      .|+|..||+-..+.      ...|.||.|+.|++++
T Consensus        58 ~fWC~fC~~ev~~~~s~~~~~~ai~HLaS~eH~k~v   93 (336)
T PF14968_consen   58 RFWCVFCDCEVREHDSSFACGGAIEHLASPEHRKNV   93 (336)
T ss_pred             eeEeeCccchhhhccchhhhccHHhhcCCHHHHHHH
Confidence            68999999999988      6899999999999875


No 32 
>KOG0796|consensus
Probab=90.03  E-value=0.3  Score=41.53  Aligned_cols=41  Identities=27%  Similarity=0.515  Sum_probs=29.6

Q ss_pred             cccccCcee--cchh-hHhhhhccHHHHHHhccccccccccHHHHHHHHHHHHHHH
Q psy7022           5 YCNVCDCVV--KDSI-NFLDHINGKKHQRNLGMSMRVERSSLDQVKKRFDMNKKKY   57 (124)
Q Consensus         5 yC~vCd~~f--kDs~-~~ldHlngk~H~~~~G~s~~ver~tle~V~~rl~~lk~k~   57 (124)
                      .|+||+..+  .|+. =+.||+|||.|+-            --.|++.|..|+...
T Consensus       188 VCeVCGa~L~~~D~d~RlaDHf~GKlHlG------------y~~iR~~l~eLk~~~  231 (319)
T KOG0796|consen  188 VCEVCGAFLSVNDADRRLADHFGGKLHLG------------YVLIREKLAELKKEK  231 (319)
T ss_pred             HHHhhhHHHhccchHHHHHHhhcchHHHH------------HHHHHHHHHHHHHHH
Confidence            599999755  3443 5789999999976            345577777776654


No 33 
>KOG2785|consensus
Probab=89.99  E-value=0.45  Score=41.37  Aligned_cols=58  Identities=17%  Similarity=0.309  Sum_probs=48.8

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHHhc-cccccccccHHHHHHHHHHHHHHHH
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNLG-MSMRVERSSLDQVKKRFDMNKKKYE   58 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G-~s~~ver~tle~V~~rl~~lk~k~~   58 (124)
                      |+||-|..|...|.++-.--.|-.+-.|..|+- ..-.+.-.|+++.-+++......++
T Consensus         1 st~ftC~tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lPPItaE~F~~k~~s~~~~~~   59 (390)
T KOG2785|consen    1 STGFTCNTCNVEFDDADEQRAHYKSDWHRYNLKRKVASLPPITAEEFNEKVLSDDSEKE   59 (390)
T ss_pred             CCcceeeceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCCCcCHHHHhHHHhhhhhhhh
Confidence            689999999999999999999999999988763 3445667899999999887766553


No 34 
>COG5136 U1 snRNP-specific protein C [RNA processing and modification]
Probab=89.70  E-value=0.1  Score=40.95  Aligned_cols=31  Identities=26%  Similarity=0.510  Sum_probs=25.5

Q ss_pred             CCCccccccCceecc-hh-hHhhhhccHHHHHH
Q psy7022           1 MLGYYCNVCDCVVKD-SI-NFLDHINGKKHQRN   31 (124)
Q Consensus         1 ~~gfyC~vCd~~fkD-s~-~~ldHlngk~H~~~   31 (124)
                      ++.|||+.|..|+.. ++ +-..|+-|+.|.++
T Consensus         1 MpRY~CeyC~~~LthD~lsvRk~H~~G~~H~~~   33 (188)
T COG5136           1 MPRYFCEYCNKMLTHDRLSVRKMHCGGAKHGLM   33 (188)
T ss_pred             CcchHHHHHHHHHhccHHHHHHHhhhhHHHHHH
Confidence            468999999999853 33 77899999999984


No 35 
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=88.63  E-value=0.23  Score=39.81  Aligned_cols=32  Identities=28%  Similarity=0.570  Sum_probs=29.1

Q ss_pred             CCCccccccCceecchhhHhhhhccHHHHHHh
Q psy7022           1 MLGYYCNVCDCVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         1 ~~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      +|.|.|..|.-.--+-++|+.|+.|++|.-|+
T Consensus        51 ~Gk~vC~LC~T~H~~e~Sy~~H~~GKKH~~n~   82 (222)
T COG5246          51 TGKYVCLLCKTKHLTEMSYVKHREGKKHKENS   82 (222)
T ss_pred             CCcEEeeeeccccccHHHHHHhhccchhhhhH
Confidence            46799999999999999999999999998764


No 36 
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=88.50  E-value=0.14  Score=40.77  Aligned_cols=33  Identities=30%  Similarity=0.619  Sum_probs=0.0

Q ss_pred             CccccccC-ceecchhhHhhhhccHHHH---HHhccc
Q psy7022           3 GYYCNVCD-CVVKDSINFLDHINGKKHQ---RNLGMS   35 (124)
Q Consensus         3 gfyC~vCd-~~fkDs~~~ldHlngk~H~---~~~G~s   35 (124)
                      -|+|+||+ .+|+---+|..|++...|+   +.+|++
T Consensus       101 ey~CEICGN~~Y~GrkaFekHF~E~rH~~GlrcLGI~  137 (196)
T PF11931_consen  101 EYKCEICGNQSYKGRKAFEKHFQEWRHAYGLRCLGIP  137 (196)
T ss_dssp             -------------------------------------
T ss_pred             eeeeEeCCCcceecHHHHHHhcChhHHHccChhcCCC
Confidence            59999996 6789999999999999995   456766


No 37 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=88.16  E-value=0.32  Score=26.34  Aligned_cols=20  Identities=15%  Similarity=0.338  Sum_probs=16.3

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      .-|+.|+++| ....+..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3599999999 6778888864


No 38 
>PTZ00448 hypothetical protein; Provisional
Probab=86.73  E-value=0.43  Score=41.33  Aligned_cols=31  Identities=23%  Similarity=0.338  Sum_probs=28.4

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLG   33 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G   33 (124)
                      -|-|..|+..|.|+..+-+|.-|-.|..|+-
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KSDwHrYNLK  344 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRSEWHIFNTK  344 (373)
T ss_pred             CccccccccccCCHHHHHHHhhhhHHHHHHH
Confidence            5789999999999999999999999988763


No 39 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=85.54  E-value=0.47  Score=26.02  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=16.3

Q ss_pred             cccccCceecchhhHhhhhc
Q psy7022           5 YCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         5 yC~vCd~~fkDs~~~ldHln   24 (124)
                      -|++|+..+ ......+||.
T Consensus         3 ~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        3 QCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHHH
Confidence            599999999 6678889986


No 40 
>PF06658 DUF1168:  Protein of unknown function (DUF1168);  InterPro: IPR009548 This family consists of several hypothetical eukaryotic proteins of unknown function.
Probab=83.53  E-value=5.2  Score=30.36  Aligned_cols=45  Identities=24%  Similarity=0.462  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHHhhhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy7022          48 KRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKLKEYRRERRKEKK   92 (124)
Q Consensus        48 ~rl~~lk~k~~~~~~~~~~~eRl~~~~eeEek~re~rr~kkkekk   92 (124)
                      .||..+-...........|..++......++..-+.+++||..+|
T Consensus        50 ~Rl~~me~~~~~e~~~~eF~~kree~~~~~eekTaKkR~KR~KkK   94 (142)
T PF06658_consen   50 ERLEYMEEEAKKEKEDEEFQRKREERKKEAEEKTAKKRAKRQKKK   94 (142)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455555444434445667888888877777777777766665443


No 41 
>PF14968 CCDC84:  Coiled coil protein 84
Probab=82.78  E-value=0.48  Score=40.46  Aligned_cols=27  Identities=33%  Similarity=0.603  Sum_probs=23.0

Q ss_pred             cccccCceecchhhHhhhhccHHHHHHhcc
Q psy7022           5 YCNVCDCVVKDSINFLDHINGKKHQRNLGM   34 (124)
Q Consensus         5 yC~vCd~~fkDs~~~ldHlngk~H~~~~G~   34 (124)
                      ||.||.+..--   ...|+-++.|++++-.
T Consensus         1 yC~vCr~~h~~---gr~H~Y~~~Hq~~L~~   27 (336)
T PF14968_consen    1 YCEVCRRNHDQ---GRRHVYSPKHQKSLSA   27 (336)
T ss_pred             CcchhhCcccc---cCCCccCHHHHHHHHH
Confidence            99999987654   9999999999987653


No 42 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=82.74  E-value=0.67  Score=28.79  Aligned_cols=23  Identities=13%  Similarity=0.417  Sum_probs=19.1

Q ss_pred             CccccccCceecchhhHhhhhccH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGK   26 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk   26 (124)
                      .|-|++|++ .-|...|..|+...
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~   24 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDE   24 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhH
Confidence            588999999 66778999999743


No 43 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=82.70  E-value=1.9  Score=34.67  Aligned_cols=25  Identities=24%  Similarity=0.424  Sum_probs=19.8

Q ss_pred             CccccccCceecchhhHhhhhccHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKK   27 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~   27 (124)
                      .|-|.+|.+.|+-..=+.-||..|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             EECCCCCCcccCChHHHHHHHhhcC
Confidence            5889999999999999999997553


No 44 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=81.13  E-value=1.1  Score=23.21  Aligned_cols=20  Identities=25%  Similarity=0.604  Sum_probs=15.6

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      |-|+.|+-+.. ...+..|+.
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~   20 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLK   20 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHH
Confidence            67999998888 889999985


No 45 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=80.42  E-value=1  Score=29.17  Aligned_cols=21  Identities=29%  Similarity=0.708  Sum_probs=15.8

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      --|++|+.++..+-++-.|+-
T Consensus        25 atCP~C~a~~~~srnLrRHle   45 (54)
T PF09237_consen   25 ATCPICGAVIRQSRNLRRHLE   45 (54)
T ss_dssp             EE-TTT--EESSHHHHHHHHH
T ss_pred             CCCCcchhhccchhhHHHHHH
Confidence            359999999999999999983


No 46 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=79.96  E-value=0.79  Score=24.65  Aligned_cols=12  Identities=25%  Similarity=0.600  Sum_probs=10.8

Q ss_pred             CccccccCceec
Q psy7022           3 GYYCNVCDCVVK   14 (124)
Q Consensus         3 gfyC~vCd~~fk   14 (124)
                      .|-|++|++.|.
T Consensus        14 ~~~C~~C~k~F~   25 (26)
T PF13465_consen   14 PYKCPYCGKSFS   25 (26)
T ss_dssp             SEEESSSSEEES
T ss_pred             CCCCCCCcCeeC
Confidence            589999999996


No 47 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=79.24  E-value=0.61  Score=30.57  Aligned_cols=24  Identities=33%  Similarity=0.602  Sum_probs=0.0

Q ss_pred             ccccCceecchhhHhhhhccHHHHH
Q psy7022           6 CNVCDCVVKDSINFLDHINGKKHQR   30 (124)
Q Consensus         6 C~vCd~~fkDs~~~ldHlngk~H~~   30 (124)
                      |.+|+.+|.+...++.|++ ..|..
T Consensus         2 C~~C~~~f~~~~~l~~H~~-~~H~~   25 (100)
T PF12756_consen    2 CLFCDESFSSVDDLLQHMK-KKHGF   25 (100)
T ss_dssp             -------------------------
T ss_pred             ccccccccccccccccccc-ccccc
Confidence            9999999999999999995 44544


No 48 
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=79.02  E-value=0.7  Score=35.99  Aligned_cols=47  Identities=21%  Similarity=0.398  Sum_probs=32.9

Q ss_pred             ccccccCceecchh-hHhhhhccHHHHHHhcc-ccccccccHHHHHHHH
Q psy7022           4 YYCNVCDCVVKDSI-NFLDHINGKKHQRNLGM-SMRVERSSLDQVKKRF   50 (124)
Q Consensus         4 fyC~vCd~~fkDs~-~~ldHlngk~H~~~~G~-s~~ver~tle~V~~rl   50 (124)
                      ++|.+||...-.+. ....||.|..|++|.-. --..+|.+|.=-+.-|
T Consensus        92 ~hCsACd~~IP~~~~~vQ~Hl~S~~H~~Nrr~~~eq~Kr~sl~vA~Sil  140 (165)
T PF04988_consen   92 AHCSACDVFIPMQHSSVQKHLKSQDHNKNRRAMMEQSKRSSLSVARSIL  140 (165)
T ss_pred             hhhhHhhhhccCcHHHHHHHhccHHHHhhHHHHHHHHHHHHHHHHHHHh
Confidence            58999999998876 77899999999997533 3334444444333333


No 49 
>KOG3792|consensus
Probab=74.01  E-value=1  Score=42.17  Aligned_cols=31  Identities=26%  Similarity=0.670  Sum_probs=27.7

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLG   33 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G   33 (124)
                      .|.|.+|||.|.|-++-+-|||+..|-...-
T Consensus       359 ~f~cKlcdckf~d~nak~mhl~grRhrLQYk  389 (816)
T KOG3792|consen  359 RFHCKLCDCKFNDPNAKEMHLKGRRHRLQYK  389 (816)
T ss_pred             hhhhhhhcCCCCCcchHHhhhhcccccceec
Confidence            5899999999999999999999999965443


No 50 
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=73.71  E-value=0.89  Score=27.97  Aligned_cols=16  Identities=38%  Similarity=0.791  Sum_probs=12.4

Q ss_pred             ccccccCcee---cchhhH
Q psy7022           4 YYCNVCDCVV---KDSINF   19 (124)
Q Consensus         4 fyC~vCd~~f---kDs~~~   19 (124)
                      -||.+||+.+   .++..|
T Consensus         7 ~yC~~Cdk~~~~~~~~~lY   25 (43)
T PF12855_consen    7 DYCIVCDKQIDPPDDGSLY   25 (43)
T ss_pred             hHHHHhhccccCCCCCccc
Confidence            4999999999   555544


No 51 
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=72.98  E-value=1.9  Score=27.60  Aligned_cols=24  Identities=21%  Similarity=0.392  Sum_probs=21.5

Q ss_pred             CccccccCceecchhhHhhhhccH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGK   26 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk   26 (124)
                      =+||-.|+..|.|...+..|..|.
T Consensus        27 ~~YC~~Cg~~Y~d~~dL~~~CPG~   50 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEEDLERNCPGP   50 (55)
T ss_pred             CceeeeeCCccCCHHHHHhCCCCC
Confidence            379999999999999999998775


No 52 
>PHA00732 hypothetical protein
Probab=72.72  E-value=2.1  Score=29.11  Aligned_cols=21  Identities=14%  Similarity=0.488  Sum_probs=19.4

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      |-|+.|+..|.+..++..|+.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r   22 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHAR   22 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhh
Confidence            679999999999999999985


No 53 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=65.95  E-value=3  Score=25.88  Aligned_cols=13  Identities=15%  Similarity=0.578  Sum_probs=7.7

Q ss_pred             cccccCceecchh
Q psy7022           5 YCNVCDCVVKDSI   17 (124)
Q Consensus         5 yC~vCd~~fkDs~   17 (124)
                      -||||+..|.+..
T Consensus        22 ~CPlC~r~l~~e~   34 (54)
T PF04423_consen   22 CCPLCGRPLDEEH   34 (54)
T ss_dssp             E-TTT--EE-HHH
T ss_pred             cCCCCCCCCCHHH
Confidence            6999999998776


No 54 
>PF15437 PGBA_C:  Plasminogen-binding protein pgbA C-terminal
Probab=65.62  E-value=32  Score=24.19  Aligned_cols=48  Identities=33%  Similarity=0.446  Sum_probs=36.6

Q ss_pred             ccccHHHHHHHHHHHHHHHHhhhhcccHHHHHHHHHHHHHHHHHHHHH
Q psy7022          39 ERSSLDQVKKRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKLKEYRRE   86 (124)
Q Consensus        39 er~tle~V~~rl~~lk~k~~~~~~~~~~~eRl~~~~eeEek~re~rr~   86 (124)
                      ...+..+-+.||..-+.+......+..|++|-.+.++..+++-++|+.
T Consensus        32 ~kl~~kEekrrLkeEkKkAKAeqrA~EfEqRakehqErDEkElEERrK   79 (86)
T PF15437_consen   32 PKLSPKEEKRRLKEEKKKAKAEQRAREFEQRAKEHQERDEKELEERRK   79 (86)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            367788888899887777655566778999988888888777776653


No 55 
>KOG2482|consensus
Probab=65.34  E-value=2  Score=37.44  Aligned_cols=28  Identities=25%  Similarity=0.629  Sum_probs=26.0

Q ss_pred             CccccccCceecchhhHhhhhccHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQR   30 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~   30 (124)
                      .+-|-.|.+.|+|-..+.+|.+-+.|.+
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcc
Confidence            4679999999999999999999999976


No 56 
>KOG2636|consensus
Probab=65.27  E-value=5.7  Score=35.61  Aligned_cols=33  Identities=33%  Similarity=0.681  Sum_probs=28.4

Q ss_pred             CccccccC-ceecchhhHhhhhccHHHHHH---hccc
Q psy7022           3 GYYCNVCD-CVVKDSINFLDHINGKKHQRN---LGMS   35 (124)
Q Consensus         3 gfyC~vCd-~~fkDs~~~ldHlngk~H~~~---~G~s   35 (124)
                      -|-|++|+ .+|+---+|..|+|.-.|+.-   +|++
T Consensus       401 ey~CEICGNy~Y~GrkaF~RHF~EwRH~hGmrCLGIp  437 (497)
T KOG2636|consen  401 EYNCEICGNYVYKGRKAFDRHFNEWRHAHGMRCLGIP  437 (497)
T ss_pred             ccceeeccCccccCcHHHHHHhHHHHHhhcceecCCC
Confidence            48899999 999999999999999999763   4554


No 57 
>PHA00733 hypothetical protein
Probab=64.24  E-value=3.8  Score=29.98  Aligned_cols=22  Identities=27%  Similarity=0.611  Sum_probs=20.1

Q ss_pred             CccccccCceecchhhHhhhhc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHln   24 (124)
                      .|-|+.|++.|.+...+..|+.
T Consensus        73 Py~C~~Cgk~Fss~s~L~~H~r   94 (128)
T PHA00733         73 PYVCPLCLMPFSSSVSLKQHIR   94 (128)
T ss_pred             CccCCCCCCcCCCHHHHHHHHh
Confidence            5889999999999999998885


No 58 
>KOG2636|consensus
Probab=63.93  E-value=11  Score=33.76  Aligned_cols=31  Identities=16%  Similarity=0.161  Sum_probs=26.9

Q ss_pred             CCccccccCceecchhhHhhhhccHHHHHHh
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      +|-+|+-|+++|..+...+.||-++-|.+|-
T Consensus       270 gGt~~~ra~rlf~Tk~~~l~~L~~~~~~kn~  300 (497)
T KOG2636|consen  270 GGTLHERAQRLFSTKSKSLSHLDTKLFAKNP  300 (497)
T ss_pred             CCeecHHHHhhhhhcCcchhhhhhhhhccCc
Confidence            5788999999999999999999988887753


No 59 
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=60.69  E-value=5.9  Score=35.32  Aligned_cols=21  Identities=24%  Similarity=0.585  Sum_probs=19.7

Q ss_pred             ccccccCceecchhhHhhhhc
Q psy7022           4 YYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHln   24 (124)
                      |-|++|+..|.|...|..|+-
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            679999999999999999994


No 60 
>KOG2462|consensus
Probab=59.48  E-value=4.3  Score=34.02  Aligned_cols=27  Identities=19%  Similarity=0.402  Sum_probs=22.9

Q ss_pred             CccccccCceecchhhHhhhhccHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQ   29 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~   29 (124)
                      -|-|+.|++.|-|-+++-.|+....+.
T Consensus       215 PF~C~hC~kAFADRSNLRAHmQTHS~~  241 (279)
T KOG2462|consen  215 PFSCPHCGKAFADRSNLRAHMQTHSDV  241 (279)
T ss_pred             CccCCcccchhcchHHHHHHHHhhcCC
Confidence            589999999999999999998655443


No 61 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=59.40  E-value=4.4  Score=22.92  Aligned_cols=19  Identities=21%  Similarity=0.466  Sum_probs=15.0

Q ss_pred             ccccccCceecchhhHhhhh
Q psy7022           4 YYCNVCDCVVKDSINFLDHI   23 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHl   23 (124)
                      |-|.-|...| +...|..|.
T Consensus         1 ~sCiDC~~~F-~~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSHT   19 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT--
T ss_pred             CeeecCCCCc-CcCCcCCCC
Confidence            5699999999 778888885


No 62 
>KOG1144|consensus
Probab=58.80  E-value=37  Score=32.88  Aligned_cols=15  Identities=0%  Similarity=0.153  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHHHH
Q psy7022          43 LDQVKKRFDMNKKKY   57 (124)
Q Consensus        43 le~V~~rl~~lk~k~   57 (124)
                      |-.++..|+.+++..
T Consensus       216 v~~~qe~La~~qe~e  230 (1064)
T KOG1144|consen  216 VRAMQEALAKRQEEE  230 (1064)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            555566666555544


No 63 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=56.92  E-value=6.8  Score=22.87  Aligned_cols=21  Identities=33%  Similarity=0.542  Sum_probs=13.9

Q ss_pred             CccccccCceecch----hhHhhhh
Q psy7022           3 GYYCNVCDCVVKDS----INFLDHI   23 (124)
Q Consensus         3 gfyC~vCd~~fkDs----~~~ldHl   23 (124)
                      ...|..|+..++-+    +.+..||
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhh
Confidence            45799999999985    5888888


No 64 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=56.25  E-value=14  Score=32.58  Aligned_cols=30  Identities=23%  Similarity=0.495  Sum_probs=26.8

Q ss_pred             CccccccC-ceecchhhHhhhhccHHHHHHh
Q psy7022           3 GYYCNVCD-CVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         3 gfyC~vCd-~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      -|-|++|+ .++----.|..|.|...|+.-+
T Consensus       374 ef~CEICgNyvy~GR~~FdrHF~E~rHiygl  404 (470)
T COG5188         374 EFECEICGNYVYYGRDRFDRHFEEDRHIYGL  404 (470)
T ss_pred             ceeeeecccccccchHHHHhhhhhhhhhhhe
Confidence            48899999 8999999999999999998754


No 65 
>KOG2505|consensus
Probab=55.78  E-value=7.7  Score=35.35  Aligned_cols=48  Identities=15%  Similarity=0.170  Sum_probs=32.6

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhccccc-cccccHHHHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMR-VERSSLDQVKKRF   50 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~-ver~tle~V~~rl   50 (124)
                      .+.|.+|++.|.+-.....|+.+-.|.-|+-...+ ..=.|.+++-.-+
T Consensus        66 ~~~CstCq~~F~s~~eqr~HyksD~HR~N~Krkl~~~~ils~edFe~i~  114 (591)
T KOG2505|consen   66 SDQCSTCQIPFGSRQEQREHYKSDWHRFNTKRKLRGKPILSEEDFEGII  114 (591)
T ss_pred             cccccccCCccccHHHHHHHHHHHHHHHHHHHHhcCCCcccHHHHHHhh
Confidence            57899999999999999999988888776544322 1114555554333


No 66 
>PF14616 DUF4451:  Domain of unknown function (DUF4451)
Probab=55.35  E-value=5.9  Score=28.96  Aligned_cols=22  Identities=18%  Similarity=0.409  Sum_probs=17.6

Q ss_pred             cccccC--ceec-chhhHhhhhccH
Q psy7022           5 YCNVCD--CVVK-DSINFLDHINGK   26 (124)
Q Consensus         5 yC~vCd--~~fk-Ds~~~ldHlngk   26 (124)
                      +|++|.  .||. -+++|..||+-.
T Consensus        27 lCp~C~~~~wl~lKnSsY~~Hl~~~   51 (124)
T PF14616_consen   27 LCPYCPGGNWLKLKNSSYWYHLQFA   51 (124)
T ss_pred             ECCCCCCCcEeeecccchhhhhhhc
Confidence            799999  8886 477899999643


No 67 
>KOG4722|consensus
Probab=55.32  E-value=4.4  Score=36.52  Aligned_cols=47  Identities=26%  Similarity=0.579  Sum_probs=34.7

Q ss_pred             cccccCceecchhhHhhhhccHHHHHHhccc----------cccccccHHHHHHHHH
Q psy7022           5 YCNVCDCVVKDSINFLDHINGKKHQRNLGMS----------MRVERSSLDQVKKRFD   51 (124)
Q Consensus         5 yC~vCd~~fkDs~~~ldHlngk~H~~~~G~s----------~~ver~tle~V~~rl~   51 (124)
                      .|.+|+....+..-+..|+.|++|++++...          ..|+-++|+-+--++.
T Consensus       495 qcslcnvlissevylfshvkgrkhqqal~e~~~iegrel~deevehlSle~~~idi~  551 (672)
T KOG4722|consen  495 QCSLCNVLISSEVYLFSHVKGRKHQQALNELLLIEGRELEDEEVEHLSLEHLAIDIC  551 (672)
T ss_pred             ccchhhhhhhhhhhhhhhhcchhHHHHHHHHhccCcccCCccccccccHHhhhhHHH
Confidence            5999999999999999999999999876432          2355566655444433


No 68 
>KOG1842|consensus
Probab=52.91  E-value=5.2  Score=35.84  Aligned_cols=22  Identities=23%  Similarity=0.643  Sum_probs=19.5

Q ss_pred             CccccccCceecchhhHhhhhc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHln   24 (124)
                      ||.||+|-.-|..-.++.+|+-
T Consensus        15 gflCPiC~~dl~~~~~L~~H~d   36 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALNDHLD   36 (505)
T ss_pred             cccCchHhhhhhhHHHHHHHHh
Confidence            8999999999999999999983


No 69 
>COG5200 LUC7 U1 snRNP component, mediates U1 snRNP association with cap-binding complex [RNA processing and modification]
Probab=51.87  E-value=5  Score=32.94  Aligned_cols=26  Identities=31%  Similarity=0.638  Sum_probs=20.3

Q ss_pred             cccccCceecch---hhHhhhhccHHHHH
Q psy7022           5 YCNVCDCVVKDS---INFLDHINGKKHQR   30 (124)
Q Consensus         5 yC~vCd~~fkDs---~~~ldHlngk~H~~   30 (124)
                      .|.+|+..+.-+   .-+.||+||+-|+-
T Consensus       187 vC~iCgayLsrlDtdrrladHf~GklHlG  215 (258)
T COG5200         187 VCGICGAYLSRLDTDRRLADHFNGKLHLG  215 (258)
T ss_pred             hhhhhhhHHHhcchhhHHHHHhccchhhh
Confidence            599998765433   36889999999975


No 70 
>KOG4055|consensus
Probab=51.43  E-value=62  Score=26.08  Aligned_cols=30  Identities=20%  Similarity=0.380  Sum_probs=19.2

Q ss_pred             hcccHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy7022          62 KDYDIEQRMRELKEEEEKLKEYRRERRKEK   91 (124)
Q Consensus        62 ~~~~~~eRl~~~~eeEek~re~rr~kkkek   91 (124)
                      .+..|..||...+..+|..-..+|.||..+
T Consensus       108 ~daefq~r~ek~~kaaEeKTaKKRaKRqk~  137 (213)
T KOG4055|consen  108 LDAEFQIRLEKNQKAAEEKTAKKRAKRQKK  137 (213)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345577888887766666666666655443


No 71 
>PRK02224 chromosome segregation protein; Provisional
Probab=47.45  E-value=60  Score=29.96  Aligned_cols=19  Identities=21%  Similarity=0.337  Sum_probs=14.5

Q ss_pred             cccccCceecchh--hHhhhh
Q psy7022           5 YCNVCDCVVKDSI--NFLDHI   23 (124)
Q Consensus         5 yC~vCd~~fkDs~--~~ldHl   23 (124)
                      .||+|+..|.+..  .+++|+
T Consensus       453 ~Cp~C~r~~~~~~~~~~~~~~  473 (880)
T PRK02224        453 KCPECGQPVEGSPHVETIEED  473 (880)
T ss_pred             cCCCCCCcCCCcchhhhHHHH
Confidence            6999999998877  455444


No 72 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=44.47  E-value=12  Score=21.60  Aligned_cols=14  Identities=21%  Similarity=0.344  Sum_probs=11.2

Q ss_pred             CCccccccCceecc
Q psy7022           2 LGYYCNVCDCVVKD   15 (124)
Q Consensus         2 ~gfyC~vCd~~fkD   15 (124)
                      ++++|+.|+-.|-|
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            57899999987654


No 73 
>PF04988 AKAP95:  A-kinase anchoring protein 95 (AKAP95);  InterPro: IPR007071 A-kinase (or PKA)-anchoring protein AKAP95 is implicated in mitotic chromosome condensation by acting as a targeting molecule for the condensin complex. The protein contains two zinc fingers which are thought to mediate the binding of AKAP95 to DNA [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=42.88  E-value=14  Score=28.80  Aligned_cols=44  Identities=16%  Similarity=0.449  Sum_probs=31.5

Q ss_pred             ccccccCceecchhhHhhhhccHHHHHHhcc-ccccccccHHHHH
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKKHQRNLGM-SMRVERSSLDQVK   47 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~H~~~~G~-s~~ver~tle~V~   47 (124)
                      |.|.+|--.--..-....||-|+.|+--+-. .++..++|++=+.
T Consensus         1 F~Cs~CKfrtf~~~ei~~HleS~~H~E~~~~i~tkl~k~~~dFLq   45 (165)
T PF04988_consen    1 FTCSFCKFRTFEEKEIEKHLESKFHKETLKYIQTKLPKKTMDFLQ   45 (165)
T ss_pred             CccceeeeecccHHHHHHHHccchHHHHHHHHHhcCChHHHHHHH
Confidence            7899999887788899999999999753221 3455555554433


No 74 
>KOG3623|consensus
Probab=41.70  E-value=11  Score=36.04  Aligned_cols=40  Identities=25%  Similarity=0.426  Sum_probs=30.1

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHhccccccccccHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSSLDQ   45 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~ver~tle~   45 (124)
                      -|.|.-|.+.|.-|-+|-.|.|   |...+=-..+-+|++.++
T Consensus       950 PfQCdKClKRFSHSGSYSQHMN---HRYSYCKpyrEer~s~e~  989 (1007)
T KOG3623|consen  950 PFQCDKCLKRFSHSGSYSQHMN---HRYSYCKPYREERASPED  989 (1007)
T ss_pred             cchhhhhhhhcccccchHhhhc---cchhcccchhhccCChhh
Confidence            5889999999999999999999   544444445556666655


No 75 
>KOG3623|consensus
Probab=41.63  E-value=9  Score=36.60  Aligned_cols=50  Identities=20%  Similarity=0.264  Sum_probs=38.4

Q ss_pred             CccccccCceecchhhHhhhhccHHHHHHh-------------cc-----ccccccccHHHHHHHHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGKKHQRNL-------------GM-----SMRVERSSLDQVKKRFDM   52 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk~H~~~~-------------G~-----s~~ver~tle~V~~rl~~   52 (124)
                      -|-|+-|.+.|.-|-+|-.||.+|+=+-..             +-     |---.+++..+.+.+|+.
T Consensus       309 PfeCpnCkKRFSHSGSySSHmSSKKCIsli~vngr~R~~lKt~~~Sp~saSsSp~~s~~pq~r~klen  376 (1007)
T KOG3623|consen  309 PFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTLEKSPGSASSSPRRSPSPQGRGKLEN  376 (1007)
T ss_pred             CcCCcccccccccCCcccccccccchhhhhcccCcchhhhhhcccCCcccCCCCCCCCChhHhhhccC
Confidence            588999999999999999999999986221             11     112346888888888876


No 76 
>PRK10328 DNA binding protein, nucleoid-associated; Provisional
Probab=40.69  E-value=1.5e+02  Score=22.06  Aligned_cols=17  Identities=35%  Similarity=0.403  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy7022          70 MRELKEEEEKLKEYRRE   86 (124)
Q Consensus        70 l~~~~eeEek~re~rr~   86 (124)
                      |.+++++++.......+
T Consensus        37 v~er~~~~~~~~~~~~e   53 (134)
T PRK10328         37 TKERREEEEQQQRELAE   53 (134)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44444444444444433


No 77 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=40.66  E-value=15  Score=22.23  Aligned_cols=22  Identities=23%  Similarity=0.416  Sum_probs=17.1

Q ss_pred             ccccccCceecch-----hhHhhhhcc
Q psy7022           4 YYCNVCDCVVKDS-----INFLDHING   25 (124)
Q Consensus         4 fyC~vCd~~fkDs-----~~~ldHlng   25 (124)
                      -.|..|++.+.-.     ++|..||..
T Consensus        19 a~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       19 AKCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EEecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            3699999999765     478888764


No 78 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=40.33  E-value=47  Score=25.51  Aligned_cols=18  Identities=33%  Similarity=0.576  Sum_probs=11.0

Q ss_pred             ccCceecchhhHhhhhccH
Q psy7022           8 VCDCVVKDSINFLDHINGK   26 (124)
Q Consensus         8 vCd~~fkDs~~~ldHlngk   26 (124)
                      ||+..++|. +|-..|.+.
T Consensus        38 ~C~~HL~D~-~F~~p~~~~   55 (182)
T PF08432_consen   38 VCPSHLKDR-QFATPIYDE   55 (182)
T ss_pred             eCcccccCc-ccCCCCCCH
Confidence            666666666 666655444


No 79 
>KOG3993|consensus
Probab=40.08  E-value=12  Score=33.46  Aligned_cols=26  Identities=31%  Similarity=0.439  Sum_probs=21.9

Q ss_pred             CccccccCceecchhhHhhhh-ccHHH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHI-NGKKH   28 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHl-ngk~H   28 (124)
                      -|-|+.||++|.--.++-.|- |+|--
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR  321 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPR  321 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCc
Confidence            378999999999999999998 55443


No 80 
>PHA03123 dUTPase; Provisional
Probab=38.55  E-value=16  Score=32.19  Aligned_cols=14  Identities=36%  Similarity=0.541  Sum_probs=10.8

Q ss_pred             HHHhCCCCCCCCCC
Q psy7022         110 AAIMGFSGFGGGKK  123 (124)
Q Consensus       110 aamMGF~gFGssKK  123 (124)
                      -..=|.+|||||-|
T Consensus       388 pS~Rg~~GFGSTg~  401 (402)
T PHA03123        388 PSDRGNKGFGSTDK  401 (402)
T ss_pred             cccccCCCCCCCCC
Confidence            34569999999865


No 81 
>KOG2894|consensus
Probab=38.42  E-value=1.2e+02  Score=26.07  Aligned_cols=17  Identities=18%  Similarity=0.251  Sum_probs=10.7

Q ss_pred             ccHHHHHHHHHHHHHHH
Q psy7022          41 SSLDQVKKRFDMNKKKY   57 (124)
Q Consensus        41 ~tle~V~~rl~~lk~k~   57 (124)
                      +||++.+++=+.+.+..
T Consensus        67 VtL~Dmk~kqeniVreR   83 (331)
T KOG2894|consen   67 VTLDDMKAKQENIVRER   83 (331)
T ss_pred             EEHHHHHHHHHHHHHHH
Confidence            67777776666654443


No 82 
>PF08262 Lem_TRP:  Leucophaea maderae tachykinin-related peptide ;  InterPro: IPR013206 These peptides are designated Leucophaea maderae (Madeira cockroach) tachykinin-related peptides (Lem TRPs). Some were isolated from the midgut of L. maderae, whereas others appear to be brain specific. The Lem TRPs of the brain are myotropic and induce increases in the amplitude and frequency of spontaneous contractions and tonus of hindgut muscle in L. maderae []. They were also isolated from brain-corpora, cardiaca-corpora, allata-suboesophageal ganglion extracts of Locusta migratoria (Migratory locust). They stimulate visceral muscle contractions of the oviduct and the foregut of L. migratoria [].
Probab=38.08  E-value=13  Score=16.39  Aligned_cols=7  Identities=57%  Similarity=1.146  Sum_probs=5.3

Q ss_pred             HhCCCCC
Q psy7022         112 IMGFSGF  118 (124)
Q Consensus       112 mMGF~gF  118 (124)
                      .|||-|.
T Consensus         3 smgf~g~    9 (10)
T PF08262_consen    3 SMGFHGM    9 (10)
T ss_pred             ccccccc
Confidence            5999773


No 83 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=36.89  E-value=10  Score=29.94  Aligned_cols=22  Identities=23%  Similarity=0.244  Sum_probs=17.6

Q ss_pred             CccccccCceecchhhHhhhhc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHln   24 (124)
                      .+-||||+..|+.....-.++-
T Consensus         5 ~~~CPvC~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVRSGKIR   26 (214)
T ss_pred             ceECCCCCCeeeeeEEEcCCce
Confidence            4679999999998877766663


No 84 
>PF04615 Utp14:  Utp14 protein;  InterPro: IPR006709 A large ribonuclear protein complex is required for the processing of the small-ribosomal-subunit rRNA - the small-subunit (SSU) processome [, ]. This preribosomal complex contains the U3 snoRNA and at least 40 proteins, which have the following properties:   They are nucleolar. They are able to coimmunoprecipitate with the U3 snoRNA and Mpp10 (a protein specific to the SSU processome).  They are required for 18S rRNA biogenesis.  There appears to be a linkage between polymerase I transcription and the formation of the SSU processome; as some, but not all, of the SSU processome components are required for pre-rRNA transcription initiation. These SSU processome components have been termed t-Utps. They form a pre-complex with pre-18S rRNA in the absence of snoRNA U3 and other SSU processome components. It has been proposed that the t-Utp complex proteins are both rDNA and rRNA binding proteins that are involved in the initiation of pre18S rRNA transcription. Initially binding to rDNA then associating with the 5' end of the nascent pre18S rRNA. The t-Utpcomplex forms the nucleus around which the rest of the SSU processome components, including snoRNA U3, assemble []. From electron microscopy the SSU processome may correspond to the terminal knobs visualized at the 5' ends of nascent 18S rRNA.   This entry contains Utp14, a large ribonuclear protein associated with snoRNA U3 [].; GO: 0006364 rRNA processing, 0032040 small-subunit processome
Probab=36.49  E-value=1.1e+02  Score=28.16  Aligned_cols=52  Identities=23%  Similarity=0.273  Sum_probs=27.2

Q ss_pred             cccccHHHHHHHHHHHHHHHHhhhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy7022          38 VERSSLDQVKKRFDMNKKKYEQKKKDYDIEQRMRELKEEEEKLKEYRRERRKEKKRK   94 (124)
Q Consensus        38 ver~tle~V~~rl~~lk~k~~~~~~~~~~~eRl~~~~eeEek~re~rr~kkkekk~~   94 (124)
                      ...-|+++++.|...|..-..     +-|-+=.+.++..--+=+.|+|-.|+++.+.
T Consensus       194 ~~~ms~eE~~~r~~el~~~R~-----L~~~~e~KakR~kKIKSK~yhri~kk~k~k~  245 (735)
T PF04615_consen  194 LKKMSLEEAKERRAELAKMRA-----LMFYEEAKAKRIKKIKSKTYHRILKKEKEKE  245 (735)
T ss_pred             hccCCHHHHHHHHHHHHHHHH-----HHhHHHHHHHHHHhhhhhHHHHHHHHHHHHh
Confidence            345788999988888766532     1111111111222224566666666665443


No 85 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=35.68  E-value=16  Score=27.42  Aligned_cols=12  Identities=25%  Similarity=0.556  Sum_probs=9.1

Q ss_pred             CCccccccCcee
Q psy7022           2 LGYYCNVCDCVV   13 (124)
Q Consensus         2 ~gfyC~vCd~~f   13 (124)
                      |--||++|+..+
T Consensus        43 G~v~CPvC~~~~   54 (131)
T COG1645          43 GEVFCPVCGYRE   54 (131)
T ss_pred             CeEECCCCCceE
Confidence            567999999633


No 86 
>PHA02562 46 endonuclease subunit; Provisional
Probab=35.32  E-value=1.8e+02  Score=25.12  Aligned_cols=20  Identities=15%  Similarity=0.388  Sum_probs=14.5

Q ss_pred             ccccccCceecchhhHhhhh
Q psy7022           4 YYCNVCDCVVKDSINFLDHI   23 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHl   23 (124)
                      -.||+|+..|.++...+..|
T Consensus       285 ~~Cp~C~~~~~~~~~~~~~l  304 (562)
T PHA02562        285 GVCPTCTQQISEGPDRITKI  304 (562)
T ss_pred             CCCCCCCCcCCCcHHHHHHH
Confidence            37999999999984433333


No 87 
>KOG1074|consensus
Probab=35.19  E-value=17  Score=35.07  Aligned_cols=21  Identities=29%  Similarity=0.460  Sum_probs=19.1

Q ss_pred             CccccccCceecchhhHhhhh
Q psy7022           3 GYYCNVCDCVVKDSINFLDHI   23 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHl   23 (124)
                      .-||.||++.|..|.++.-|.
T Consensus       879 ~h~C~vCgk~FsSSsALqiH~  899 (958)
T KOG1074|consen  879 AHVCNVCGKQFSSSAALEIHM  899 (958)
T ss_pred             hhhhccchhcccchHHHHHhh
Confidence            359999999999999999887


No 88 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=34.77  E-value=14  Score=19.47  Aligned_cols=15  Identities=33%  Similarity=0.953  Sum_probs=11.0

Q ss_pred             cccccCceecchhhH
Q psy7022           5 YCNVCDCVVKDSINF   19 (124)
Q Consensus         5 yC~vCd~~fkDs~~~   19 (124)
                      ||+-|+....+...|
T Consensus         1 ~Cp~CG~~~~~~~~f   15 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKF   15 (23)
T ss_pred             CCcccCCCCCCcCcc
Confidence            688888777776655


No 89 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=34.65  E-value=2.9e+02  Score=23.53  Aligned_cols=16  Identities=19%  Similarity=0.331  Sum_probs=12.0

Q ss_pred             CCccccccCceecchh
Q psy7022           2 LGYYCNVCDCVVKDSI   17 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~   17 (124)
                      +...|++|...++-+.
T Consensus        42 ~~~~CP~C~~~lrk~~   57 (309)
T TIGR00570        42 GSGSCPECDTPLRKNN   57 (309)
T ss_pred             CCCCCCCCCCccchhh
Confidence            3457999998777665


No 90 
>PF06936 Selenoprotein_S:  Selenoprotein S (SelS);  InterPro: IPR009703 This family consists of several mammalian selenoprotein S (SelS) sequences. SelS is a plasma membrane protein and is present in a variety of tissues and cell types. These proteins are involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins which participate in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner []. They probably serve as a linker between DER1, which mediates the retro-translocation of misfolded proteins into the cytosol, and the ATPase complex VCP, which mediates the translocation and ubiquitination.; GO: 0008430 selenium binding, 0006886 intracellular protein transport, 0030176 integral to endoplasmic reticulum membrane; PDB: 2Q2F_A.
Probab=34.50  E-value=1.1e+02  Score=24.21  Aligned_cols=8  Identities=13%  Similarity=0.198  Sum_probs=0.0

Q ss_pred             HHHHhCCC
Q psy7022         109 LAAIMGFS  116 (124)
Q Consensus       109 maamMGF~  116 (124)
                      -.=+||=|
T Consensus       166 yNPL~G~~  173 (190)
T PF06936_consen  166 YNPLTGDG  173 (190)
T ss_dssp             --------
T ss_pred             CCCCCCCC
Confidence            34445543


No 91 
>KOG3576|consensus
Probab=34.26  E-value=15  Score=30.30  Aligned_cols=20  Identities=20%  Similarity=0.677  Sum_probs=11.0

Q ss_pred             ccccccCceecchhhHhhhh
Q psy7022           4 YYCNVCDCVVKDSINFLDHI   23 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHl   23 (124)
                      |-|.+|++.|..--++..||
T Consensus       174 ykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  174 YKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             cchhhhhHHHHhhccHHHHH
Confidence            45555555555555555554


No 92 
>PF00692 dUTPase:  dUTPase;  InterPro: IPR008180 Synonym(s): dUTP diphosphatase, Deoxyuridine-triphosphatase The essential enzyme dUTP pyrophosphatase (3.6.1.23 from EC) is specific for dUTP and is critical for the fidelity of DNA replication and repair. dUTPase hydrolyzes dUTP to dUMP and pyrophosphate, simultaneously reducing dUTP levels and providing the dUMP for dTTP biosynthesis. dUTPase decreases the intracellular concentration of dUPT so that uracil cannot be incorporated into DNA [].  The crystal structure of human dUTPase reveals that each subunit of the dUTPase trimer folds into an eight-stranded jelly-roll beta barrel, with the C-terminal beta strands interchanged among the subunits. The structure is similar to that of the Escherichia coli enzyme, despite low sequence homology between the two enzymes [].  Other enzymes like deoxycytidine triphosphate deaminase (dCTP) (3.5.4.13 from EC) that specifically bind uridine also belong to this group suggesting that the signature may recognise a putative uridine-binding motif. Some retroviruses encode dUTPases. Retroviral dUTPase is synthesised as part of POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, dUTPase and RNase H. ; GO: 0016787 hydrolase activity, 0046080 dUTP metabolic process; PDB: 4DHK_A 1DUC_A 1DUN_A 3LQW_A 2BT1_A 2WE1_A 2WE0_A 2WE2_A 2BSY_A 2WE3_A ....
Probab=33.60  E-value=21  Score=25.23  Aligned_cols=12  Identities=33%  Similarity=0.515  Sum_probs=10.1

Q ss_pred             HHHhCCCCCCCC
Q psy7022         110 AAIMGFSGFGGG  121 (124)
Q Consensus       110 aamMGF~gFGss  121 (124)
                      ...+|-+|||||
T Consensus       117 ~~~rg~~Gfgst  128 (129)
T PF00692_consen  117 NTERGEGGFGST  128 (129)
T ss_dssp             TSSSTTTSTTTT
T ss_pred             CccCCCCCCCCC
Confidence            567899999997


No 93 
>PHA03127 dUTPase; Provisional
Probab=33.06  E-value=20  Score=30.61  Aligned_cols=12  Identities=33%  Similarity=0.587  Sum_probs=9.8

Q ss_pred             HHHhCCCCCCCC
Q psy7022         110 AAIMGFSGFGGG  121 (124)
Q Consensus       110 aamMGF~gFGss  121 (124)
                      -..=|.+|||||
T Consensus       309 ~S~Rg~~GFGST  320 (322)
T PHA03127        309 SSARGDRGFGST  320 (322)
T ss_pred             cccccCCCCCCC
Confidence            456799999998


No 94 
>KOG3634|consensus
Probab=33.02  E-value=65  Score=28.02  Aligned_cols=13  Identities=31%  Similarity=0.463  Sum_probs=8.8

Q ss_pred             HHHHH-hCCCCCCC
Q psy7022         108 DLAAI-MGFSGFGG  120 (124)
Q Consensus       108 emaam-MGF~gFGs  120 (124)
                      -++.| ++|+|||.
T Consensus       181 tvakk~a~~~~fgn  194 (361)
T KOG3634|consen  181 TVAKKGAQNDGFGN  194 (361)
T ss_pred             eeecccccchhHHH
Confidence            35555 78888874


No 95 
>PTZ00373 60S Acidic ribosomal protein P2; Provisional
Probab=32.83  E-value=26  Score=25.54  Aligned_cols=7  Identities=71%  Similarity=1.322  Sum_probs=5.9

Q ss_pred             hCCCCCC
Q psy7022         113 MGFSGFG  119 (124)
Q Consensus       113 MGF~gFG  119 (124)
                      ||||=|+
T Consensus       106 mgf~LFd  112 (112)
T PTZ00373        106 LGFSLFG  112 (112)
T ss_pred             ccccccC
Confidence            8999885


No 96 
>PF03879 Cgr1:  Cgr1 family;  InterPro: IPR005579 Cgr1 is involved in nucleolar integrity and is required for processing pre-rRNA for the 60S ribosome subunit. In Saccharomyces cerevisiae, this protein is conserved and contributes to compartmentalisation of nucleolar constituents []. Cgr1 is a small hydrophilic protein and members of this family are coiled-coil proteins []. Its primary role appears to be in ribosome biogenesis [, ]. Expression of CGR1 is also associated with a cessation of yeast cell growth, which is a prerequisite for germination in this organism [].
Probab=32.14  E-value=1.4e+02  Score=21.72  Aligned_cols=17  Identities=18%  Similarity=0.153  Sum_probs=7.5

Q ss_pred             ccHHHHHHHHHHHHHHH
Q psy7022          41 SSLDQVKKRFDMNKKKY   57 (124)
Q Consensus        41 ~tle~V~~rl~~lk~k~   57 (124)
                      ..+.+|+++...|+..+
T Consensus        41 ~~~~~~K~~ekElKeEK   57 (108)
T PF03879_consen   41 LELKAIKEKEKELKEEK   57 (108)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33444444444444433


No 97 
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=31.53  E-value=13  Score=22.73  Aligned_cols=8  Identities=50%  Similarity=1.294  Sum_probs=6.8

Q ss_pred             ccccccCc
Q psy7022           4 YYCNVCDC   11 (124)
Q Consensus         4 fyC~vCd~   11 (124)
                      |||..|+.
T Consensus         2 yYCi~Cs~    9 (41)
T PF13119_consen    2 YYCINCSE    9 (41)
T ss_pred             EEEEEhHH
Confidence            89999965


No 98 
>PHA03126 dUTPase; Provisional
Probab=31.14  E-value=22  Score=30.44  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=9.9

Q ss_pred             HHHhCCCCCCCC
Q psy7022         110 AAIMGFSGFGGG  121 (124)
Q Consensus       110 aamMGF~gFGss  121 (124)
                      -..=|.+|||||
T Consensus       313 ~S~Rg~~GFGST  324 (326)
T PHA03126        313 SSLRADGGFGST  324 (326)
T ss_pred             cccccCCCCCCC
Confidence            566799999998


No 99 
>COG5067 DBF4 Protein kinase essential for the initiation of DNA replication [DNA replication, recombination, and repair / Cell division and chromosome partitioning]
Probab=30.73  E-value=13  Score=32.94  Aligned_cols=30  Identities=27%  Similarity=0.520  Sum_probs=23.8

Q ss_pred             cccccCceecchhhHhhhhccHHHHHHhccccc
Q psy7022           5 YCNVCDCVVKDSINFLDHINGKKHQRNLGMSMR   37 (124)
Q Consensus         5 yC~vCd~~fkDs~~~ldHlngk~H~~~~G~s~~   37 (124)
                      ||+-|-.-|.   +|..||-|..|.+=..-..+
T Consensus       424 YCENCreky~---~lE~Hi~s~~HrrFAEnd~N  453 (468)
T COG5067         424 YCENCREKYE---SLEQHIVSEKHRRFAENDLN  453 (468)
T ss_pred             hhHHHHHHHH---HHHHHhhhhhhhhhhhcccc
Confidence            8999999887   48899999999884443333


No 100
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=30.11  E-value=10  Score=26.70  Aligned_cols=21  Identities=14%  Similarity=0.396  Sum_probs=18.4

Q ss_pred             CccccccCceecchhhHhhhh
Q psy7022           3 GYYCNVCDCVVKDSINFLDHI   23 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHl   23 (124)
                      .|+|+.|-.++..-..++.|+
T Consensus        21 d~~Cp~C~~~~~~~~~~~~~~   41 (162)
T PF13462_consen   21 DFQCPHCAKFHEELEKLLKKY   41 (162)
T ss_dssp             -TTSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHhHHHHHHHHhhhhhhc
Confidence            489999999999988999887


No 101
>KOG2462|consensus
Probab=29.92  E-value=26  Score=29.48  Aligned_cols=23  Identities=17%  Similarity=0.354  Sum_probs=16.5

Q ss_pred             CccccccCceecchhhHhhhhcc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlng   25 (124)
                      ++-|.+|++-|...--|..||.+
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRT  209 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRT  209 (279)
T ss_pred             CcccccccccccchHHhhccccc
Confidence            46677777777777777777754


No 102
>PRK10947 global DNA-binding transcriptional dual regulator H-NS; Provisional
Probab=29.64  E-value=2.4e+02  Score=21.03  Aligned_cols=13  Identities=23%  Similarity=0.261  Sum_probs=6.4

Q ss_pred             HhhhhccHHHHHH
Q psy7022          19 FLDHINGKKHQRN   31 (124)
Q Consensus        19 ~ldHlngk~H~~~   31 (124)
                      |+..||+-.-+++
T Consensus         4 ~lk~l~niR~lra   16 (135)
T PRK10947          4 ALKILNNIRTLRA   16 (135)
T ss_pred             HHHHHHhHHHHHH
Confidence            4555554444443


No 103
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=29.45  E-value=1.6e+02  Score=23.36  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=5.9

Q ss_pred             ccccCceecchh
Q psy7022           6 CNVCDCVVKDSI   17 (124)
Q Consensus         6 C~vCd~~fkDs~   17 (124)
                      |..|+..+..++
T Consensus       126 C~~CN~~~sgn~  137 (189)
T PF05766_consen  126 CKHCNRHLSGNI  137 (189)
T ss_pred             CCccccccccCH
Confidence            555555544443


No 104
>KOG2593|consensus
Probab=29.27  E-value=21  Score=31.72  Aligned_cols=54  Identities=19%  Similarity=0.304  Sum_probs=30.0

Q ss_pred             CCccccccCceecchh--hHhhhhccHHHHHHhcccccc--ccccHHHHHHHHHHHHH
Q psy7022           2 LGYYCNVCDCVVKDSI--NFLDHINGKKHQRNLGMSMRV--ERSSLDQVKKRFDMNKK   55 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~--~~ldHlngk~H~~~~G~s~~v--er~tle~V~~rl~~lk~   55 (124)
                      +||-|+.|.+.|.+--  .+++--.+-+|=-+-|-....  ...+-.+++.+|..+-.
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gelveDe~~~~~~e~~~~l~~~~~  184 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGELVEDENKLPSKESRTALNRLME  184 (436)
T ss_pred             ccccCCccccchhhhHHHHhhcccCceEEEecCCCchhcccccCchHHHHHHHHHHHH
Confidence            6899999999987643  444444455554444443222  23444555555544433


No 105
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=28.68  E-value=22  Score=30.72  Aligned_cols=10  Identities=20%  Similarity=1.002  Sum_probs=8.2

Q ss_pred             CccccccCce
Q psy7022           3 GYYCNVCDCV   12 (124)
Q Consensus         3 gfyC~vCd~~   12 (124)
                      .|||++|+--
T Consensus        25 ~ffCPaC~~~   34 (342)
T COG4469          25 RFFCPACGSQ   34 (342)
T ss_pred             ccccCCCCCe
Confidence            5999999854


No 106
>PF05477 SURF2:  Surfeit locus protein 2 (SURF2);  InterPro: IPR008833 Surfeit locus protein 2 is part of a group of at least six sequence unrelated genes (Surf-1 to Surf-6). The six Surfeit genes have been classified as housekeeping genes, being expressed in all tissue types tested and not containing a TATA box in their promoter region. The exact function of SURF2 is unknown [].
Probab=28.57  E-value=30  Score=28.41  Aligned_cols=32  Identities=22%  Similarity=0.480  Sum_probs=23.3

Q ss_pred             CccccccCceec-chhhHhhhhccHHHHHHhcc
Q psy7022           3 GYYCNVCDCVVK-DSINFLDHINGKKHQRNLGM   34 (124)
Q Consensus         3 gfyC~vCd~~fk-Ds~~~ldHlngk~H~~~~G~   34 (124)
                      -+||.+...... +-..-+.||||+..++++-.
T Consensus        79 ~LfCkLT~~~iNk~pe~V~rHv~GKRf~kaLek  111 (244)
T PF05477_consen   79 KLFCKLTGRHINKSPEHVERHVNGKRFQKALEK  111 (244)
T ss_pred             eeEEechHhHhccCHHHHHHHhhhHHHHHHHHH
Confidence            467887766654 44588899999999886543


No 107
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=28.37  E-value=21  Score=22.27  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=8.8

Q ss_pred             CccccccCce
Q psy7022           3 GYYCNVCDCV   12 (124)
Q Consensus         3 gfyC~vCd~~   12 (124)
                      |++|+-|+-+
T Consensus         9 G~~CPgCG~t   18 (52)
T PF10825_consen    9 GIPCPGCGMT   18 (52)
T ss_pred             CCCCCCCcHH
Confidence            8999999975


No 108
>PHA03129 dUTPase; Provisional
Probab=27.90  E-value=28  Score=31.02  Aligned_cols=12  Identities=25%  Similarity=0.343  Sum_probs=9.3

Q ss_pred             HHHhCCCCCCCC
Q psy7022         110 AAIMGFSGFGGG  121 (124)
Q Consensus       110 aamMGF~gFGss  121 (124)
                      -..=|.+|||||
T Consensus       423 ~S~Rg~~GFGST  434 (436)
T PHA03129        423 TSERQEGGFGST  434 (436)
T ss_pred             cccccCCCCCCC
Confidence            456688889887


No 109
>cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p. Ribosomal proteins P1 and P2 are the eukaryotic proteins that are functionally equivalent to bacterial L7/L12. L12p is the archaeal homolog. Unlike other ribosomal proteins, the archaeal L12p and eukaryotic P1 and P2 do not share sequence similarity with their bacterial counterparts. They are part of the ribosomal stalk (called the L7/L12 stalk in bacteria), along with 28S rRNA and the proteins L11 and P0 in eukaryotes (23S rRNA, L11, and L10e in archaea). In bacterial ribosomes, L7/L12 homodimers bind the extended C-terminal helix of L10 to anchor the L7/L12 molecules to the ribosome. Eukaryotic P1/P2 heterodimers and archaeal L12p homodimers are believed to bind the L10 equivalent proteins, eukaryotic P0 and archaeal L10e, in a similar fashion. P1 and P2 (L12p, L7/L12) are the only proteins in the ribosome to occur as multimers, always appearing as sets of dimers. Recent data indicate that most archaeal species contain 
Probab=27.42  E-value=38  Score=24.18  Aligned_cols=12  Identities=17%  Similarity=0.277  Sum_probs=6.9

Q ss_pred             ccHHHHHHHHHH
Q psy7022          41 SSLDQVKKRFDM   52 (124)
Q Consensus        41 ~tle~V~~rl~~   52 (124)
                      +|.++|+.-|..
T Consensus        17 ~ta~~I~~IL~a   28 (105)
T cd04411          17 LTEDKIKELLSA   28 (105)
T ss_pred             CCHHHHHHHHHH
Confidence            566666655543


No 110
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=26.95  E-value=26  Score=19.84  Aligned_cols=11  Identities=36%  Similarity=1.014  Sum_probs=8.7

Q ss_pred             CccccccCcee
Q psy7022           3 GYYCNVCDCVV   13 (124)
Q Consensus         3 gfyC~vCd~~f   13 (124)
                      .|+|..|+..+
T Consensus        16 ~~~C~~C~v~l   26 (32)
T PF13842_consen   16 RYMCSKCDVPL   26 (32)
T ss_pred             EEEccCCCCcc
Confidence            59999998553


No 111
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=26.45  E-value=19  Score=20.75  Aligned_cols=24  Identities=21%  Similarity=0.099  Sum_probs=18.4

Q ss_pred             ccccccCceecchhhHhhhhccHH
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKK   27 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~   27 (124)
                      +.|.+|+..+.....=++||....
T Consensus        12 ~~C~~c~~~~~~~~~~v~Hi~p~~   35 (57)
T cd00085          12 GLCPYCGKPGGTEGLEVDHIIPLS   35 (57)
T ss_pred             CcCccCCCcCCCCCceEEeecchh
Confidence            689999999866666778886543


No 112
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=26.25  E-value=31  Score=19.40  Aligned_cols=15  Identities=20%  Similarity=0.432  Sum_probs=11.4

Q ss_pred             CccccccCceecchh
Q psy7022           3 GYYCNVCDCVVKDSI   17 (124)
Q Consensus         3 gfyC~vCd~~fkDs~   17 (124)
                      .|.|..|+..|.-..
T Consensus         5 ~y~C~~Cg~~fe~~~   19 (41)
T smart00834        5 EYRCEDCGHTFEVLQ   19 (41)
T ss_pred             EEEcCCCCCEEEEEE
Confidence            488999999886443


No 113
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=26.22  E-value=32  Score=23.81  Aligned_cols=17  Identities=29%  Similarity=0.718  Sum_probs=14.0

Q ss_pred             CCccccccCceecchhh
Q psy7022           2 LGYYCNVCDCVVKDSIN   18 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~   18 (124)
                      ++|+|+.|+-.|-|...
T Consensus        30 ~~~~C~~CGe~~~~~e~   46 (127)
T TIGR03830        30 PGWYCPACGEELLDPEE   46 (127)
T ss_pred             eeeECCCCCCEEEcHHH
Confidence            58999999998877654


No 114
>KOG2186|consensus
Probab=25.86  E-value=29  Score=29.13  Aligned_cols=22  Identities=14%  Similarity=0.440  Sum_probs=19.1

Q ss_pred             CCccccccCceecchhhHhhhhc
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHln   24 (124)
                      .-|-|.-|+.+|-+ ..|.+|+.
T Consensus        28 ~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen   28 AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             CeeEEeeccccccc-chhhhhhh
Confidence            35889999999999 89999973


No 115
>smart00400 ZnF_CHCC zinc finger.
Probab=25.65  E-value=44  Score=20.48  Aligned_cols=26  Identities=19%  Similarity=0.254  Sum_probs=19.2

Q ss_pred             CCccccccCceecchhhHhhhhccHHH
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKH   28 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H   28 (124)
                      ..|||-.|+..- |.+.|+.++.+...
T Consensus        22 n~~~Cf~cg~gG-d~i~fv~~~~~~sf   47 (55)
T smart00400       22 QFFHCFGCGAGG-NVISFLMKYDKLSF   47 (55)
T ss_pred             CEEEEeCCCCCC-CHHHHHHHHHCcCH
Confidence            458999998765 77888888765443


No 116
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=25.21  E-value=26  Score=19.06  Aligned_cols=13  Identities=31%  Similarity=0.654  Sum_probs=5.2

Q ss_pred             CCccccccCceec
Q psy7022           2 LGYYCNVCDCVVK   14 (124)
Q Consensus         2 ~gfyC~vCd~~fk   14 (124)
                      ..|+|..||-.+.
T Consensus        14 ~~Y~C~~Cdf~lH   26 (30)
T PF07649_consen   14 WFYRCSECDFDLH   26 (30)
T ss_dssp             -EEE-TTT-----
T ss_pred             ceEECccCCCccC
Confidence            3688999987653


No 117
>PHA03130 dUTPase; Provisional
Probab=25.21  E-value=33  Score=29.91  Aligned_cols=13  Identities=31%  Similarity=0.488  Sum_probs=10.2

Q ss_pred             HHHHhCCCCCCCC
Q psy7022         109 LAAIMGFSGFGGG  121 (124)
Q Consensus       109 maamMGF~gFGss  121 (124)
                      +-..=|++|||||
T Consensus       354 p~S~R~~~GFGST  366 (368)
T PHA03130        354 PPSERGTGGFGST  366 (368)
T ss_pred             CcccccCCCCCCC
Confidence            4556799999998


No 118
>TIGR00606 rad50 rad50. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.73  E-value=1.9e+02  Score=28.52  Aligned_cols=21  Identities=24%  Similarity=0.692  Sum_probs=15.9

Q ss_pred             cccccCceecchh---hHhhhhcc
Q psy7022           5 YCNVCDCVVKDSI---NFLDHING   25 (124)
Q Consensus         5 yC~vCd~~fkDs~---~~ldHlng   25 (124)
                      .|++|.+.|++..   .|+.||..
T Consensus       679 ~C~LC~R~f~~eee~~~f~~~L~~  702 (1311)
T TIGR00606       679 CCPVCQRVFQTEAELQEFISDLQS  702 (1311)
T ss_pred             cCCCCCCCCCChhHHHHHHHHHHH
Confidence            7999999999775   45555543


No 119
>cd05833 Ribosomal_P2 Ribosomal protein P2. This subfamily represents the eukaryotic large ribosomal protein P2. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P2 is located in the L12 stalk, with proteins P1, P0, L11, and 28S rRNA. P1 and P2 are the only proteins in the ribosome to occur as multimers, always appearing as sets of heterodimers. Recent data indicate that eukaryotes have four copies (two heterodimers), while most archaeal species contain six copies of L12p (three homodimers). Bacteria may have four or six copies of L7/L12 (two or three homodimers) depending on the species. Experiments using S. cerevisiae P1 and P2 indicate that P1 proteins are positioned more internally with limited reactivity in the C-terminal domains, while P2 proteins seem to be more externally located and are more likely to interact with other cellular components. In lower eukaryotes, P1 and P2 are further subdivided into P1A, P1B, P2
Probab=24.44  E-value=49  Score=23.84  Aligned_cols=7  Identities=57%  Similarity=0.999  Sum_probs=5.5

Q ss_pred             hCCCCCC
Q psy7022         113 MGFSGFG  119 (124)
Q Consensus       113 MGF~gFG  119 (124)
                      ||||=|.
T Consensus       103 mGf~LFd  109 (109)
T cd05833         103 MGFGLFD  109 (109)
T ss_pred             cCCCCCC
Confidence            7998774


No 120
>PF01418 HTH_6:  Helix-turn-helix domain, rpiR family;  InterPro: IPR000281 This domain contains a helix-turn-helix motif []. Every member of this family is N-terminal to a SIS domain IPR001347 from INTERPRO. Members of this family are probably regulators of genes involved in phosphosugar metobolism.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2O3F_B 3IWF_B.
Probab=24.11  E-value=33  Score=22.42  Aligned_cols=12  Identities=42%  Similarity=0.855  Sum_probs=9.4

Q ss_pred             HHHHHhCCCCCC
Q psy7022         108 DLAAIMGFSGFG  119 (124)
Q Consensus       108 emaamMGF~gFG  119 (124)
                      -++.-+||.||-
T Consensus        53 Rf~kkLG~~gf~   64 (77)
T PF01418_consen   53 RFCKKLGFSGFK   64 (77)
T ss_dssp             HHHHHCTTTCHH
T ss_pred             HHHHHhCCCCHH
Confidence            468889999983


No 121
>PF15005 IZUMO:  Izumo sperm-egg fusion
Probab=23.81  E-value=3.2e+02  Score=21.02  Aligned_cols=81  Identities=21%  Similarity=0.235  Sum_probs=45.8

Q ss_pred             CCccccccCceecchhhHhhhhccHHH-----HHHh------cc-------------ccccccccHHHHHHHHHHHHHH-
Q psy7022           2 LGYYCNVCDCVVKDSINFLDHINGKKH-----QRNL------GM-------------SMRVERSSLDQVKKRFDMNKKK-   56 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~~~ldHlngk~H-----~~~~------G~-------------s~~ver~tle~V~~rl~~lk~k-   56 (124)
                      +++=|-.||-.|......+.|---|.|     +..+      +|             -..|...||+.|..-|..--++ 
T Consensus         2 ~a~GCL~CDp~v~eal~~L~~~~lP~~~~~~~~~~~~~rl~~~m~~~~~~~~~~~a~~g~vd~~~L~~va~~~~~~lkrl   81 (160)
T PF15005_consen    2 GARGCLQCDPSVVEALKSLRHDYLPSHLHVEGLQARAQRLLLEMEDFFFLPYAEDAFMGVVDEDTLDKVAWSFKNQLKRL   81 (160)
T ss_pred             CCCeeeeCCHHHHHHHHHHHHHhCccccCcchHHHHHHHHHHHhhCccccccchhhhhhhccHHHHHHHHHHHHHHHHHH
Confidence            577799999999999988776655555     2222      22             1247778888887555422222 


Q ss_pred             HHhhhh-cccHHHHHHHHHHHHHHHHH
Q psy7022          57 YEQKKK-DYDIEQRMRELKEEEEKLKE   82 (124)
Q Consensus        57 ~~~~~~-~~~~~eRl~~~~eeEek~re   82 (124)
                      ..+.-+ ..=|++=+..++......++
T Consensus        82 ~~s~~kg~~ll~EL~~~r~~~~~~lk~  108 (160)
T PF15005_consen   82 TDSDLKGEPLLKELVWMRQNQKKELKK  108 (160)
T ss_pred             hcCCcccchHHHHHHHHHHHHHHHHHH
Confidence            222222 23355555555555444433


No 122
>PF00558 Vpu:  Vpu protein;  InterPro: IPR008187 The Human immunodeficiency virus 1 (HIV-1) Vpu protein acts in the degradation of CD4 in the endoplasmic reticulum and in the enhancement of virion release from the plasma membrane of infected cells [].; GO: 0019076 release of virus from host; PDB: 2JPX_A 1PI8_A 2GOH_A 2GOF_A 1PI7_A 1PJE_A 1VPU_A 2K7Y_A.
Probab=23.73  E-value=39  Score=23.46  Aligned_cols=8  Identities=38%  Similarity=0.713  Sum_probs=4.1

Q ss_pred             HHHhCCCC
Q psy7022         110 AAIMGFSG  117 (124)
Q Consensus       110 aamMGF~g  117 (124)
                      ..-|||-.
T Consensus        69 v~~~G~~~   76 (81)
T PF00558_consen   69 VESMGFDN   76 (81)
T ss_dssp             HH-GCCSS
T ss_pred             HHHcCCCC
Confidence            33478753


No 123
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=23.55  E-value=19  Score=20.71  Aligned_cols=23  Identities=22%  Similarity=0.390  Sum_probs=12.5

Q ss_pred             ccccCceecch-hhHhhhhccHHH
Q psy7022           6 CNVCDCVVKDS-INFLDHINGKKH   28 (124)
Q Consensus         6 C~vCd~~fkDs-~~~ldHlngk~H   28 (124)
                      |++|+..|... ..-++||....+
T Consensus         1 C~~C~~~~~~~~~~~v~Hi~~~~~   24 (47)
T PF01844_consen    1 CQYCGKPGSDNESLHVHHIIPRSK   24 (47)
T ss_dssp             -TTT--B--GG-GEEEEESS-TTT
T ss_pred             CCCCCCcCccCcceEeECcCchhc
Confidence            89999999887 556788865554


No 124
>COG5509 Uncharacterized small protein containing a coiled-coil domain [Function unknown]
Probab=23.55  E-value=1.5e+02  Score=19.80  Aligned_cols=25  Identities=28%  Similarity=0.446  Sum_probs=18.9

Q ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHH
Q psy7022          64 YDIEQRMRELKEEEEKLKEYRRERR   88 (124)
Q Consensus        64 ~~~~eRl~~~~eeEek~re~rr~kk   88 (124)
                      ..+++||...+.+-++.++++..|.
T Consensus        28 ~El~eRIalLq~EIeRlkAe~~kK~   52 (65)
T COG5509          28 AELEERIALLQAEIERLKAELAKKK   52 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            3478899998888888877766554


No 125
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=23.48  E-value=30  Score=23.42  Aligned_cols=16  Identities=25%  Similarity=0.650  Sum_probs=13.5

Q ss_pred             CCccccccCceecchh
Q psy7022           2 LGYYCNVCDCVVKDSI   17 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~   17 (124)
                      ++..|.+|++++.|+.
T Consensus        48 ~~~~C~~C~R~L~d~~   63 (72)
T PF04640_consen   48 SGNICETCHRSLQDPY   63 (72)
T ss_pred             CCCccCCCCCCCCCCC
Confidence            4678999999999873


No 126
>KOG2893|consensus
Probab=22.99  E-value=37  Score=28.66  Aligned_cols=44  Identities=25%  Similarity=0.568  Sum_probs=30.0

Q ss_pred             ccccccCceecchhhHhhhhccHH------HHHH---hccc---cccccccHHHHH
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKK------HQRN---LGMS---MRVERSSLDQVK   47 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~------H~~~---~G~s---~~ver~tle~V~   47 (124)
                      -||=+|++-|.|.-.++.|-.-+.      |.+.   -|.+   |.|-+-|+|-|-
T Consensus        11 pwcwycnrefddekiliqhqkakhfkchichkkl~sgpglsihcmqvhketid~ip   66 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLFSGPGLSIHCMQVHKETIDKIP   66 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhccceeeeehhhhccCCCceeehhhhhhhhhhccc
Confidence            489999999999999988765443      2221   1333   667777776664


No 127
>KOG3608|consensus
Probab=22.57  E-value=27  Score=30.84  Aligned_cols=20  Identities=20%  Similarity=0.629  Sum_probs=18.4

Q ss_pred             cccccCceecchhhHhhhhc
Q psy7022           5 YCNVCDCVVKDSINFLDHIN   24 (124)
Q Consensus         5 yC~vCd~~fkDs~~~ldHln   24 (124)
                      -|+.|+..|.....|.|||-
T Consensus       209 ACp~Cg~~F~~~tkl~DH~r  228 (467)
T KOG3608|consen  209 ACPHCGELFRTKTKLFDHLR  228 (467)
T ss_pred             ecchHHHHhccccHHHHHHH
Confidence            59999999999999999984


No 128
>KOG2635|consensus
Probab=22.46  E-value=1.3e+02  Score=27.33  Aligned_cols=11  Identities=27%  Similarity=0.474  Sum_probs=6.6

Q ss_pred             ccHHHHHHHHH
Q psy7022          41 SSLDQVKKRFD   51 (124)
Q Consensus        41 ~tle~V~~rl~   51 (124)
                      .+|-||+.-++
T Consensus       125 v~laQikty~e  135 (512)
T KOG2635|consen  125 VNLAQIKTYLE  135 (512)
T ss_pred             ccHHHhhhhhc
Confidence            56677765444


No 129
>KOG0801|consensus
Probab=22.31  E-value=37  Score=26.97  Aligned_cols=14  Identities=43%  Similarity=0.762  Sum_probs=11.4

Q ss_pred             CCccccccCceecc
Q psy7022           2 LGYYCNVCDCVVKD   15 (124)
Q Consensus         2 ~gfyC~vCd~~fkD   15 (124)
                      .||-|+||.++.-.
T Consensus       137 ~g~KCPvC~K~V~s  150 (205)
T KOG0801|consen  137 SGMKCPVCHKVVPS  150 (205)
T ss_pred             CCccCCccccccCC
Confidence            48999999997643


No 130
>PF07043 DUF1328:  Protein of unknown function (DUF1328);  InterPro: IPR009760 This entry represents several hypothetical bacterial proteins of around 50 residues in length. The function of this family is unknown but is thought to be a membrane protein.; GO: 0005886 plasma membrane
Probab=21.84  E-value=48  Score=20.02  Aligned_cols=11  Identities=36%  Similarity=1.020  Sum_probs=8.8

Q ss_pred             HHHHhCCCCCC
Q psy7022         109 LAAIMGFSGFG  119 (124)
Q Consensus       109 maamMGF~gFG  119 (124)
                      +|.+.||+|-.
T Consensus         9 iAg~lGF~Gia   19 (39)
T PF07043_consen    9 IAGVLGFGGIA   19 (39)
T ss_pred             HHHHcCcccHH
Confidence            68899999854


No 131
>KOG3576|consensus
Probab=21.79  E-value=33  Score=28.32  Aligned_cols=23  Identities=17%  Similarity=0.332  Sum_probs=18.3

Q ss_pred             CccccccCceecchhhHhhhhcc
Q psy7022           3 GYYCNVCDCVVKDSINFLDHING   25 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlng   25 (124)
                      -|-|.||.+.|.=.--+..||.-
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~kc  139 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLKC  139 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhhh
Confidence            47888888888888888888743


No 132
>COG5487 Small integral membrane protein [Function unknown]
Probab=21.62  E-value=49  Score=21.35  Aligned_cols=12  Identities=33%  Similarity=0.717  Sum_probs=9.4

Q ss_pred             HHHHHhCCCCCC
Q psy7022         108 DLAAIMGFSGFG  119 (124)
Q Consensus       108 emaamMGF~gFG  119 (124)
                      =+|+..||||--
T Consensus        13 lIa~~lGFgGia   24 (54)
T COG5487          13 LIAGALGFGGIA   24 (54)
T ss_pred             HHHHHhCcccHH
Confidence            368899999854


No 133
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=21.59  E-value=37  Score=29.61  Aligned_cols=30  Identities=23%  Similarity=0.383  Sum_probs=18.9

Q ss_pred             CCCccccccCce----------ecchhhHhhhh-ccHHHHH
Q psy7022           1 MLGYYCNVCDCV----------VKDSINFLDHI-NGKKHQR   30 (124)
Q Consensus         1 ~~gfyC~vCd~~----------fkDs~~~ldHl-ngk~H~~   30 (124)
                      .|||+|++|.-.          +.-.+.+-.|| .|..|+.
T Consensus       306 ~gGy~CP~CktkVCsLPi~CP~Csl~LilsthLarSyhhL~  346 (421)
T COG5151         306 GGGYECPVCKTKVCSLPISCPICSLQLILSTHLARSYHHLY  346 (421)
T ss_pred             cCceeCCcccceeecCCccCcchhHHHHHHHHHHHHHHhhc
Confidence            379999988632          23345666788 5566654


No 134
>PLN00138 large subunit ribosomal protein LP2; Provisional
Probab=21.43  E-value=59  Score=23.61  Aligned_cols=8  Identities=63%  Similarity=0.791  Sum_probs=6.3

Q ss_pred             HhCCCCCC
Q psy7022         112 IMGFSGFG  119 (124)
Q Consensus       112 mMGF~gFG  119 (124)
                      -||||=|+
T Consensus       106 DmGfgLFd  113 (113)
T PLN00138        106 DMGFSLFD  113 (113)
T ss_pred             cccccccC
Confidence            48999875


No 135
>PF09712 PHA_synth_III_E:  Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E)
Probab=21.15  E-value=1.1e+02  Score=25.44  Aligned_cols=21  Identities=5%  Similarity=0.169  Sum_probs=14.9

Q ss_pred             hhHhhhhccHHHHHHhccccc
Q psy7022          17 INFLDHINGKKHQRNLGMSMR   37 (124)
Q Consensus        17 ~~~ldHlngk~H~~~~G~s~~   37 (124)
                      .+|...+.++.+....|...+
T Consensus       226 ~~~~~~~~S~ef~~~~g~~~~  246 (293)
T PF09712_consen  226 EAYEELFRSEEFAQAYGQLVN  246 (293)
T ss_pred             HHHHHHHCCHHHHHHHHHHHH
Confidence            367777888888887776443


No 136
>KOG1029|consensus
Probab=21.06  E-value=2.8e+02  Score=27.22  Aligned_cols=8  Identities=13%  Similarity=0.659  Sum_probs=3.7

Q ss_pred             cccHHHHH
Q psy7022          63 DYDIEQRM   70 (124)
Q Consensus        63 ~~~~~eRl   70 (124)
                      ...++.+|
T Consensus       370 qlElekqL  377 (1118)
T KOG1029|consen  370 QLELEKQL  377 (1118)
T ss_pred             HHHHHHHH
Confidence            34455444


No 137
>KOG3792|consensus
Probab=21.03  E-value=38  Score=32.24  Aligned_cols=29  Identities=24%  Similarity=0.634  Sum_probs=27.0

Q ss_pred             ccccccCceecchhhHhhhhccHHHHHHh
Q psy7022           4 YYCNVCDCVVKDSINFLDHINGKKHQRNL   32 (124)
Q Consensus         4 fyC~vCd~~fkDs~~~ldHlngk~H~~~~   32 (124)
                      -||.+|-.+..-..+|..||-+..|+.+.
T Consensus       194 ~~~kw~k~~a~G~qs~re~lr~~r~l~kr  222 (816)
T KOG3792|consen  194 HYCKWCKISAAGPQTYREHLRGQKHLKKE  222 (816)
T ss_pred             hhhHHHHHhccccHHHHHHHHHHHHHHhc
Confidence            39999999999999999999999998865


No 138
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=21.01  E-value=48  Score=19.78  Aligned_cols=11  Identities=27%  Similarity=0.815  Sum_probs=9.3

Q ss_pred             CCccccccCce
Q psy7022           2 LGYYCNVCDCV   12 (124)
Q Consensus         2 ~gfyC~vCd~~   12 (124)
                      .||+|+-|+-.
T Consensus        17 ~g~~CP~Cg~~   27 (46)
T PF12760_consen   17 DGFVCPHCGST   27 (46)
T ss_pred             CCCCCCCCCCe
Confidence            58999999964


No 139
>PF03992 ABM:  Antibiotic biosynthesis monooxygenase;  InterPro: IPR007138 This domain is found in monooxygenases involved in the biosynthesis of several antibiotics by Streptomyces species, which can carry out oxygenation without the assistance of any of the prosthetic groups, metal ions or cofactors normally associated with activation of molecular oxygen. The structure of ActVA-Orf6 monooxygenase from Streptomyces coelicolor (Q53908 from SWISSPROT), which is involved in actinorhodin biosynthesis, reveals a dimeric alpha+beta barrel topology []. There is also a conserved histidine that is likely to be an active site residue. In S. coelicolor SCO1909 (Q9X9W3 from SWISSPROT) this domain occurs as a repeat. This domain is also found in protein LsrG, involved in the degradation of quorum-sensing molecule autoinducer-2 [], and in several uncharacterised proteins.; PDB: 1X7V_A 3F44_A 4DN9_B 1N5T_B 1LQ9_A 1N5Q_B 1N5V_A 1N5S_A 2GFF_B 3BM7_A ....
Probab=20.74  E-value=87  Score=18.97  Aligned_cols=18  Identities=11%  Similarity=0.206  Sum_probs=15.4

Q ss_pred             ecchhhHhhhhccHHHHH
Q psy7022          13 VKDSINFLDHINGKKHQR   30 (124)
Q Consensus        13 fkDs~~~ldHlngk~H~~   30 (124)
                      +.|..+|.+|++++.|..
T Consensus        57 W~s~~a~~~~~~s~~~~~   74 (78)
T PF03992_consen   57 WESEEAFQAHFKSPEFKA   74 (78)
T ss_dssp             ESSHHHHHHHHTSHHHHH
T ss_pred             ECCHHHHHHHHcCHHHHH
Confidence            567779999999999876


No 140
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=20.70  E-value=44  Score=24.60  Aligned_cols=16  Identities=19%  Similarity=0.197  Sum_probs=12.8

Q ss_pred             CCccccccCceecchh
Q psy7022           2 LGYYCNVCDCVVKDSI   17 (124)
Q Consensus         2 ~gfyC~vCd~~fkDs~   17 (124)
                      ..|.|+.|+..|...-
T Consensus        98 ~~Y~Cp~C~~~y~~~e  113 (147)
T smart00531       98 AYYKCPNCQSKYTFLE  113 (147)
T ss_pred             cEEECcCCCCEeeHHH
Confidence            4688999999998544


No 141
>KOG2807|consensus
Probab=20.65  E-value=40  Score=29.36  Aligned_cols=10  Identities=40%  Similarity=1.089  Sum_probs=6.6

Q ss_pred             CCCccccccC
Q psy7022           1 MLGYYCNVCD   10 (124)
Q Consensus         1 ~~gfyC~vCd   10 (124)
                      .+||+|+.|.
T Consensus       274 ~~Gy~CP~Ck  283 (378)
T KOG2807|consen  274 GGGYFCPQCK  283 (378)
T ss_pred             cCceeCCccc
Confidence            3678877654


No 142
>KOG1280|consensus
Probab=20.64  E-value=48  Score=28.98  Aligned_cols=24  Identities=17%  Similarity=0.386  Sum_probs=20.9

Q ss_pred             CccccccCceecchhhHhhhhccH
Q psy7022           3 GYYCNVCDCVVKDSINFLDHINGK   26 (124)
Q Consensus         3 gfyC~vCd~~fkDs~~~ldHlngk   26 (124)
                      .|-|++|++|=-....|..|+.+.
T Consensus        79 SftCPyC~~~Gfte~~f~~Hv~s~  102 (381)
T KOG1280|consen   79 SFTCPYCGIMGFTERQFGTHVLSQ  102 (381)
T ss_pred             cccCCcccccccchhHHHHHhhhc
Confidence            588999999999999999999653


No 143
>PF04504 DUF573:  Protein of unknown function, DUF573;  InterPro: IPR007592 This is a family of uncharacterised proteins.
Probab=20.61  E-value=1e+02  Score=21.49  Aligned_cols=17  Identities=35%  Similarity=0.399  Sum_probs=15.0

Q ss_pred             ccHHHHHHHHHHHHHHH
Q psy7022          41 SSLDQVKKRFDMNKKKY   57 (124)
Q Consensus        41 ~tle~V~~rl~~lk~k~   57 (124)
                      +|..||..+|..|+++=
T Consensus        49 ~s~~Ql~~KirrLK~Ky   65 (98)
T PF04504_consen   49 VSKNQLYDKIRRLKKKY   65 (98)
T ss_pred             CCHHHHHHHHHHHHHHH
Confidence            78899999999999883


No 144
>KOG2963|consensus
Probab=20.55  E-value=5.4e+02  Score=22.80  Aligned_cols=10  Identities=10%  Similarity=0.125  Sum_probs=5.0

Q ss_pred             ccHHHHHHHH
Q psy7022          41 SSLDQVKKRF   50 (124)
Q Consensus        41 ~tle~V~~rl   50 (124)
                      -|-|++++-.
T Consensus       316 Kt~eEi~~l~  325 (405)
T KOG2963|consen  316 KTEEEIKALR  325 (405)
T ss_pred             CCHHHHHHHH
Confidence            3556665433


No 145
>PF10186 Atg14:  UV radiation resistance protein and autophagy-related subunit 14;  InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking. In yeast, two distinct PI3-kinase complexes are known: complex I (Vps34, Vps15, Vps30/Atg6, and Atg14) is involved in autophagy, and complex II (Vps34, Vps15, Vps30/Atg6, and Vps38) functions in the vacuolar protein sorting pathway. In mammals, the counterparts of Vps34, Vps15, and Vps30/Atg6 are Vps34, p150, and Beclin 1, respectively. Mammalian UV irradiation resistance-associated gene (UVRAG) has been identified as identical to yeast Vps38 [].  The Atg14 (autophagy-related protein 14) proteins are hydrophilic proteins and have a coiled-coil motif at the N terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole []. This entry represents Atg14 and UVRAG, which bind Beclin 1 to forms two distinct PI3-kinase complexes. This entry also includes Bakor (beclin-1-associated autophagy-related key regulator), also known as autophagy-related protein 14-like protein, which share sequence similarity to the yeast Atg14 protein []. Barkor positively regulates autophagy through its interaction with Beclin-1, with decreased levels of autophagosome formation observed when Barkor expression is eliminated []. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. ; GO: 0010508 positive regulation of autophagy
Probab=20.39  E-value=3.9e+02  Score=20.73  Aligned_cols=10  Identities=30%  Similarity=0.849  Sum_probs=6.5

Q ss_pred             CccccccCce
Q psy7022           3 GYYCNVCDCV   12 (124)
Q Consensus         3 gfyC~vCd~~   12 (124)
                      .|||..|=..
T Consensus        11 ~~~C~~C~~~   20 (302)
T PF10186_consen   11 RFYCANCVNN   20 (302)
T ss_pred             CeECHHHHHH
Confidence            5777777544


Done!