Diaphorina citri psyllid: psy7023


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MCRNRSEYGWELLVLRAGFLNFGPPRGTMVRNVSIELCVEISCLPPHLSFCVWSSTKFNIFLFLIRVAVILTGSGGPAVTTTTVATPTTPAGGTTTPPNQLMGGDDDKLYKKDSWEVLRSKVTILDELGNGSFGLVYRGLIKDFRSLAEHPCAIKVANENASEREKAEFLNEASVMKAFDTHHVVKLYGVVSEGNPTLVIMELMGGGDLKNYLRSCRPDAETDVERSPPTLSRILQMAAEVADGMAYLADKKFVHRDLAARNCMVADDLTVKVGDFGMTRDIYETEYYRKGSRGFLPVRWMAPESLKDGVFTSHSDVWSYGVVLWEMATLASQPYQGLSNEQVLNWVKGKSSNEYKVNPPISLS
cccccccccEEEEEEEcccEEcccccccccccccEEEEEEECcccccccccECccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEccccccccccEEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccEEEEEccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHccccEEECcccCEEEcccccccccccccCEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccc
******EYGWELLVLRAGFLNFGPPRGTMVRNVSIELCVEISCLPPHLSFCVWSSTKFNIFLFLIRVAVILTGSGGPAVTTTTV*****************MGGDDDKLYKKDSWEVLRSKVTILDELGNGSFGLVYRGLIKDFRSLAEHPCAIKVANENASEREKAEFLNEASVMKAFDTHHVVKLYGVVSEGNPTLVIMELMGGGDLKNYLRSC***************SRILQMAAEVADGMAYLADKKFVHRDLAARNCMVADDLTVKVGDFGMTRDIYETEYYRKGSRGFLPVRWMAPESLKDGVFTSHSDVWSYGVVLWEMATLASQPYQGLSNEQVLNWVKGKSSNEYKVNP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCRNRSEYGWELLVLRAGFLNFGPPRGTMVRNVSIELCVEISCLPPHLSFCVWSSTKFNIFLFLIRVAVILTGSGGPAVTTTTVATPTTPAGGTTTPPNQLMGGDDDKLYKKDSWEVLRSKVTILDELGNGSFGLVYRGLIKDFRSLAEHPCAIKVANENASEREKAEFLNEASVMKAFDTHHVVKLYGVVSEGNPTLVIMELMGGGDLKNYLRSCRPDAETDVERSPPTLSRILQMAAEVADGMAYLADKKFVHRDLAARNCMVADDLTVKVGDFGMTRDIYETEYYRKGSRGFLPVRWMAPESLKDGVFTSHSDVWSYGVVLWEMATLASQPYQGLSNEQVLNWVKGKSSNEYKVNPPISLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Insulin receptor Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosines residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. Binding of the SH2 domains of PI3K to phosphotyrosines on IRS1 leads to the activation of PI3K and the generation of phosphatidylinositol-(3, 4, 5)-triphosphate (PIP3), a lipid second messenger, which activates several PIP3-dependent serine/threonine kinases, such as PDPK1 and subsequently AKT/PKB. The net effect of this pathway is to produce a translocation of the glucose transporter SLC2A4/GLUT4 from cytoplasmic vesicles to the cell membrane to facilitate glucose transport. Moreover, upon insulin stimulation, activated AKT/PKB is responsible for: anti-apoptotic effect of insulin by inducing phosphorylation of BAD; regulates the expression of gluconeogenic and lipogenic enzymes by controlling the activity of the winged helix or forkhead (FOX) class of transcription factors. Another pathway regulated by PI3K-AKT/PKB activation is mTORC1 signaling pathway which regulates cell growth and metabolism and integrates signals from insulin. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 thereby activating mTORC1 pathway. The Ras/RAF/MAP2K/MAPK pathway is mainly involved in mediating cell growth, survival and cellular differentiation of insulin. Phosphorylated IRS1 recruits GRB2/SOS complex, which triggers the activation of the Ras/RAF/MAP2K/MAPK pathway. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). When present in a hybrid receptor with IGF1R, binds IGF1.confidentP15127
Insulin receptor Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosines residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. Binding of the SH2 domains of PI3K to phosphotyrosines on IRS1 leads to the activation of PI3K and the generation of phosphatidylinositol-(3, 4, 5)-triphosphate (PIP3), a lipid second messenger, which activates several PIP3-dependent serine/threonine kinases, such as PDPK1 and subsequently AKT/PKB. The net effect of this pathway is to produce a translocation of the glucose transporter SLC2A4/GLUT4 from cytoplasmic vesicles to the cell membrane to facilitate glucose transport. Moreover, upon insulin stimulation, activated AKT/PKB is responsible for: anti-apoptotic effect of insulin by inducing phosphorylation of BAD; regulates the expression of gluconeogenic and lipogenic enzymes by controlling the activity of the winged helix or forkhead (FOX) class of transcription factors. Another pathway regulated by PI3K-AKT/PKB activation is mTORC1 signaling pathway which regulates cell growth and metabolism and integrates signals from insulin. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 thereby activating mTORC1 pathway. The Ras/RAF/MAP2K/MAPK pathway is mainly involved in mediating cell growth, survival and cellular differentiation of insulin. Phosphorylated IRS1 recruits GRB2/SOS complex, which triggers the activation of the Ras/RAF/MAP2K/MAPK pathway. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). When present in a hybrid receptor with IGF1R, binds IGF1.confidentP15208
Insulin receptor Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosines residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. Binding of the SH2 domains of PI3K to phosphotyrosines on IRS1 leads to the activation of PI3K and the generation of phosphatidylinositol-(3, 4, 5)-triphosphate (PIP3), a lipid second messenger, which activates several PIP3-dependent serine/threonine kinases, such as PDPK1 and subsequently AKT/PKB. The net effect of this pathway is to produce a translocation of the glucose transporter SLC2A4/GLUT4 from cytoplasmic vesicles to the cell membrane to facilitate glucose transport. Moreover, upon insulin stimulation, activated AKT/PKB is responsible for: anti-apoptotic effect of insulin by inducing phosphorylation of BAD; regulates the expression of gluconeogenic and lipogenic enzymes by controlling the activity of the winged helix or forkhead (FOX) class of transcription factors. Another pathway regulated by PI3K-AKT/PKB activation is mTORC1 signaling pathway which regulates cell growth and metabolism and integrates signals from insulin. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 thereby activating mTORC1 pathway. The Ras/RAF/MAP2K/MAPK pathway is mainly involved in mediating cell growth, survival and cellular differentiation of insulin. Phosphorylated IRS1 recruits GRB2/SOS complex, which triggers the activation of the Ras/RAF/MAP2K/MAPK pathway. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). Isoform Short has a higher affinity for IGFII binding. When present in a hybrid receptor with IGF1R, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.confidentP06213

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048009 [BP]insulin-like growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0060267 [BP]positive regulation of respiratory burstprobableGO:0060263, GO:0009893, GO:0019222, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005009 [MF]insulin-activated receptor activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004714, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0048639 [BP]positive regulation of developmental growthprobableGO:0048638, GO:0045927, GO:0051094, GO:0050793, GO:0040008, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0014070 [BP]response to organic cyclic compoundprobableGO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045840 [BP]positive regulation of mitosisprobableGO:0051130, GO:0090068, GO:0007346, GO:0045787, GO:0051726, GO:0010638, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051785, GO:0048518, GO:0051128, GO:0007088, GO:0050789, GO:0048522
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0022412 [BP]cellular process involved in reproduction in multicellular organismprobableGO:0032501, GO:0000003, GO:0032504, GO:0009987, GO:0048610, GO:0008150
GO:0043548 [MF]phosphatidylinositol 3-kinase bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045725 [BP]positive regulation of glycogen biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0032885, GO:0050789, GO:0010962, GO:0080090, GO:0043255, GO:0010604, GO:0043467, GO:0031328, GO:2000112, GO:0065007, GO:0032881, GO:0045913, GO:0060255, GO:0009889, GO:0050794, GO:0048518, GO:0008150, GO:0010675, GO:0010676, GO:0070873, GO:0070875, GO:0005979, GO:0010557, GO:0010556, GO:0006109, GO:0048522
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0031017 [BP]exocrine pancreas developmentprobableGO:0032502, GO:0055123, GO:0048856, GO:0044707, GO:0048513, GO:0032501, GO:0031016, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043423 [MF]3-phosphoinositide-dependent protein kinase bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0043559 [MF]insulin bindingprobableGO:0017046, GO:0042277, GO:0033218, GO:0003674, GO:0005488, GO:0042562
GO:0005901 [CC]caveolaprobableGO:0045121, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0019087 [BP]transformation of host cell by virusprobableGO:0065007, GO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0019048, GO:0035821, GO:0022415, GO:0022414, GO:0044764, GO:0051817, GO:0008150, GO:0016032, GO:0044792, GO:0044403, GO:0051701, GO:0065008, GO:0044003, GO:0051704
GO:0043560 [MF]insulin receptor substrate bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045740 [BP]positive regulation of DNA replicationprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0031328, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0045935, GO:0051052, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0006275, GO:0010557, GO:0010556, GO:0048522
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0042593 [BP]glucose homeostasisprobableGO:0033500, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008
GO:0051050 [BP]positive regulation of transportprobableGO:0051049, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0050789
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0042169 [MF]SH2 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0051425 [MF]PTB domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0034059 [BP]response to anoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0031994 [MF]insulin-like growth factor I bindingprobableGO:0005520, GO:0003674, GO:0019838, GO:0005515, GO:0005488
GO:0031995 [MF]insulin-like growth factor II bindingprobableGO:0005520, GO:0003674, GO:0019838, GO:0005515, GO:0005488
GO:0002376 [BP]immune system processprobableGO:0008150
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0071363 [BP]cellular response to growth factor stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0070848, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0005899 [CC]insulin receptor complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0030238 [BP]male sex determinationprobableGO:0032502, GO:0032501, GO:0000003, GO:0044707, GO:0022414, GO:0003006, GO:0008150, GO:0007275, GO:0044699, GO:0007530
GO:0051897 [BP]positive regulation of protein kinase B signaling cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0050789, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0051896, GO:0048522
GO:0045821 [BP]positive regulation of glycolysisprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031325, GO:0031323, GO:0010906, GO:0010907, GO:0050789, GO:0080090, GO:0010604, GO:0043467, GO:0065007, GO:0006110, GO:0048518, GO:0060255, GO:0031331, GO:0050794, GO:0045913, GO:0008150, GO:0010675, GO:0010676, GO:0019222, GO:0043470, GO:0043471, GO:0006109, GO:0048522
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0007276 [BP]gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0043010 [BP]camera-type eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0032148 [BP]activation of protein kinase B activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0032147, GO:0045860, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0046328 [BP]regulation of JNK cascadeprobableGO:0070302, GO:0080134, GO:0080135, GO:0048583, GO:0050794, GO:0032872, GO:0009966, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0051389 [BP]inactivation of MAPKK activityprobableGO:0033673, GO:0051348, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0009892, GO:0010646, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010605, GO:0009968, GO:0009966, GO:0043549, GO:0051246, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0071469 [BP]cellular response to alkalinityprobableGO:0009628, GO:0051716, GO:0010446, GO:0050896, GO:0009987, GO:0008150, GO:0071467, GO:0044763, GO:0009268, GO:0071214, GO:0044699
GO:0023014 [BP]signal transduction by phosphorylationprobableGO:0044700, GO:0051716, GO:0008152, GO:0016310, GO:0050896, GO:0009987, GO:0044237, GO:0050794, GO:0008150, GO:0006796, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0006793, GO:0007154, GO:0050789, GO:0044699
GO:0060429 [BP]epithelium developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0004716 [MF]receptor signaling protein tyrosine kinase activityprobableGO:0003824, GO:0016773, GO:0005057, GO:0016301, GO:0060089, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0016772
GO:0051290 [BP]protein heterotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051291, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0032318 [BP]regulation of Ras GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0031329, GO:0009966, GO:0030811, GO:0065007, GO:0046578, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0031323, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0051345 [BP]positive regulation of hydrolase activityprobableGO:0051336, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:1901681 [MF]sulfur compound bindingprobableGO:0003674, GO:0005488
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0048598 [BP]embryonic morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0003007 [BP]heart morphogenesisprobableGO:0032502, GO:0007507, GO:0009887, GO:0032501, GO:0044707, GO:0048513, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010310 [BP]regulation of hydrogen peroxide metabolic processprobableGO:0019222, GO:0031323, GO:2000377, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0048589 [BP]developmental growthprobableGO:0044767, GO:0032502, GO:0008150, GO:0040007, GO:0044699
GO:0005159 [MF]insulin-like growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005158 [MF]insulin receptor bindingprobableGO:0032403, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0048015 [BP]phosphatidylinositol-mediated signalingprobableGO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0048017
GO:0045429 [BP]positive regulation of nitric oxide biosynthetic processprobableGO:0009889, GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:0050794, GO:0045428, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045995 [BP]regulation of embryonic developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0051239, GO:2000026, GO:0050789
GO:0005010 [MF]insulin-like growth factor-activated receptor activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0004714, GO:0060089, GO:0004888, GO:0016740, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P4O, chain A
Confidence level:very confident
Coverage over the Query: 110-357
View the alignment between query and template
View the model in PyMOL
Template: 1QCF, chain A
Confidence level:very confident
Coverage over the Query: 19-360
View the alignment between query and template
View the model in PyMOL