RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy7025
         (205 letters)



>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine
           Kinase, Insulin Receptor.  Protein Tyrosine Kinase (PTK)
           family; Insulin Receptor (InsR); catalytic (c) domain.
           The PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. InsR is a
           receptor tyr kinase (RTK) that is composed of two
           alphabeta heterodimers. Binding of the insulin ligand to
           the extracellular alpha subunit activates the
           intracellular tyr kinase domain of the transmembrane
           beta subunit. Receptor activation leads to
           autophosphorylation, stimulating downstream kinase
           activities, which initiate signaling cascades and
           biological function. InsR signaling plays an important
           role in many cellular processes including glucose
           homeostasis, glycogen synthesis, lipid and protein
           metabolism, ion and amino acid transport, cell cycle and
           proliferation, cell differentiation, gene transcription,
           and nitric oxide synthesis. Insulin resistance, caused
           by abnormalities in InsR signaling, has been described
           in diabetes, hypertension, cardiovascular disease,
           metabolic syndrome, heart failure, and female
           infertility.
          Length = 288

 Score = 75.0 bits (184), Expect = 2e-16
 Identities = 29/52 (55%), Positives = 40/52 (76%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSY 113
           GG L +PDNCP+R+ +LMR CWQF P+ RPTF+EI+  L+ D+  SF +VS+
Sbjct: 237 GGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSF 288


>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like
           Protein Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
           family; Insulin Receptor (InsR) subfamily; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). The InsR subfamily
           is composed of InsR, Insulin-like Growth Factor-1
           Receptor (IGF-1R), and similar proteins. PTKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. InsR and
           IGF-1R are receptor tyr kinases (RTKs) composed of two
           alphabeta heterodimers. Binding of the ligand (insulin,
           IGF-1, or IGF-2) to the extracellular alpha subunit
           activates the intracellular tyr kinase domain of the
           transmembrane beta subunit. Receptor activation leads to
           autophosphorylation, stimulating downstream kinase
           activities, which initiate signaling cascades and
           biological function. InsR and IGF-1R, which share 84%
           sequence identity in their kinase domains, display
           physiologically distinct yet overlapping functions in
           cell growth, differentiation, and metabolism. InsR
           activation leads primarily to metabolic effects while
           IGF-1R activation stimulates mitogenic pathways. In
           cells expressing both receptors, InsR/IGF-1R hybrids are
           found together with classical receptors. Both receptors
           can interact with common adaptor molecules such as IRS-1
           and IRS-2.
          Length = 277

 Score = 68.1 bits (167), Expect = 6e-14
 Identities = 23/42 (54%), Positives = 31/42 (73%)

Query: 61  GGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
            GG L  P+NCPD+L  LMR CWQ+ P+ RPTF+EI++ L+ 
Sbjct: 236 DGGHLDLPENCPDKLLELMRMCWQYNPKMRPTFLEIVSSLKD 277


>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine
           Kinase, Insulin-like Growth Factor-1 Receptor.  Protein
           Tyrosine Kinase (PTK) family; Insulin-like Growth
           Factor-1 Receptor (IGF-1R); catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. IGF-1R is
           a receptor tyr kinases (RTK) that is composed of two
           alphabeta heterodimers. Binding of the ligand (IGF-1 or
           IGF-2) to the extracellular alpha subunit activates the
           intracellular tyr kinase domain of the transmembrane
           beta subunit. Receptor activation leads to
           autophosphorylation, which stimulates downstream kinase
           activities and biological function. IGF-1R signaling is
           important in the differentiation, growth, and survival
           of normal cells. In cancer cells, where it is frequently
           overexpressed, IGF-1R is implicated in proliferation,
           the suppression of apoptosis, invasion, and metastasis.
           IGF-1R is being developed as a therapeutic target in
           cancer treatment.
          Length = 277

 Score = 65.8 bits (160), Expect = 4e-13
 Identities = 23/40 (57%), Positives = 33/40 (82%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           GG+L +PDNCPD LF LMR CWQ+ P+ RP+F+EI++ ++
Sbjct: 237 GGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIK 276


>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase. 
          Length = 258

 Score = 64.1 bits (157), Expect = 1e-12
 Identities = 21/39 (53%), Positives = 28/39 (71%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           G  L RP+NCPD L+ LM +CW + P+ RPTF E++ DL
Sbjct: 220 GYRLPRPENCPDELYELMLQCWAYDPEDRPTFSELVEDL 258


>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases.
           Protein Tyrosine Kinase (PTK) family, catalytic domain.
           This PTKc family is part of a larger superfamily that
           includes the catalytic domains of protein
           serine/threonine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. They can be classified
           into receptor and non-receptor tyr kinases. PTKs play
           important roles in many cellular processes including,
           lymphocyte activation, epithelium growth and
           maintenance, metabolism control, organogenesis
           regulation, survival, proliferation, differentiation,
           migration, adhesion, motility, and morphogenesis.
           Receptor tyr kinases (RTKs) are integral membrane
           proteins which contain an extracellular ligand-binding
           region, a transmembrane segment, and an intracellular
           tyr kinase domain. RTKs are usually activated through
           ligand binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain, leading to intracellular signaling.
           Some RTKs are orphan receptors with no known ligands.
           Non-receptor (or cytoplasmic) tyr kinases are
           distributed in different intracellular compartments and
           are usually multi-domain proteins containing a catalytic
           tyr kinase domain as well as various regulatory domains
           such as SH3 and SH2. PTKs are usually autoinhibited and
           require a mechanism for activation. In many PTKs, the
           phosphorylation of tyr residues in the activation loop
           is essential for optimal activity. Aberrant expression
           of PTKs is associated with many development
           abnormalities and cancers.
          Length = 262

 Score = 59.9 bits (146), Expect = 5e-11
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           G  L +P+ CPD L+ LM  CWQ  P+ RPTF E++  LE
Sbjct: 223 GYRLPKPEYCPDELYELMLSCWQLDPEDRPTFSELVERLE 262


>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain.
           Phosphotransferases. Tyrosine-specific kinase subfamily.
          Length = 257

 Score = 57.5 bits (140), Expect = 3e-10
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           G  L +P NCP  L++LM +CW   P+ RPTF E++  L
Sbjct: 219 GYRLPQPPNCPPELYDLMLQCWAEDPEDRPTFSELVEIL 257


>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine
           Kinase, Activated Cdc42-associated kinase.  Protein
           Tyrosine Kinase (PTK) family; Activated Cdc42-associated
           kinase (Ack) subfamily; catalytic (c) domain. Ack
           subfamily members include Ack1, thirty-eight-negative
           kinase 1 (Tnk1), and similar proteins. The PTKc family
           is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ack
           subfamily members are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal catalytic domain, an
           SH3 domain, a Cdc42-binding CRIB domain, and a
           proline-rich region. They are mainly expressed in brain
           and skeletal tissues and are involved in the regulation
           of cell adhesion and growth, receptor degradation, and
           axonal guidance. Ack1 is also associated with
           androgen-independent  prostate cancer progression. Tnk1
           regulates TNFalpha signaling and may play an important
           role in cell death.
          Length = 257

 Score = 57.4 bits (139), Expect = 3e-10
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           L RP+ CP  ++N+M +CW   P  RPTF  +   L
Sbjct: 220 LERPEACPQDIYNVMLQCWAHNPADRPTFAALREFL 255


>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity.
           Phosphotransferases. The specificity of this class of
           kinases can not be predicted. Possible dual-specificity
           Ser/Thr/Tyr kinase.
          Length = 258

 Score = 56.4 bits (137), Expect = 7e-10
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           G  L +P NCP  L+ LM +CW   P+ RPTF E++  L
Sbjct: 220 GYRLPKPPNCPPELYKLMLQCWAEDPEDRPTFSELVEIL 258


>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine
           Kinase, Muscle-specific kinase.  Protein Tyrosine Kinase
           (PTK) family; Muscle-specific kinase (Musk); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Musk is a receptor tyr kinase (RTK) containing an
           extracellular region with four immunoglobulin-like
           domains and a cysteine-rich cluster, a transmembrane
           segment, and an intracellular catalytic domain. Musk is
           expressed and concentrated in the postsynaptic membrane
           in skeletal muscle. It is essential for the
           establishment of the neuromuscular junction (NMJ), a
           peripheral synapse that conveys signals from motor
           neurons to muscle cells. Agrin, a large proteoglycan
           released from motor neurons, stimulates Musk
           autophosphorylation and activation, leading to the
           clustering of acetylcholine receptors (AChRs). To date,
           there is no evidence to suggest that agrin binds
           directly to Musk. Mutations in AChR, Musk and other
           partners are responsible for diseases of the NMJ, such
           as the autoimmune syndrome myasthenia gravis.
          Length = 288

 Score = 56.4 bits (136), Expect = 1e-09
 Identities = 21/41 (51%), Positives = 25/41 (60%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G +L  PDNCP  L+NLMR CW   P  RP+F  I   L+R
Sbjct: 248 GNVLSCPDNCPLELYNLMRLCWSKLPSDRPSFASINRILQR 288


>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinase, Janus kinase 1.  Protein Tyrosine
           Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic
           (c) domain (repeat 2). The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Jak1 is a member of the
           Janus kinase (Jak) subfamily of proteins, which are
           cytoplasmic (or nonreceptor) tyr kinases containing an
           N-terminal FERM domain, followed by a Src homology 2
           (SH2) domain, a pseudokinase domain, and a C-terminal
           tyr kinase domain. Jaks are crucial for cytokine
           receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Jak1 is widely expressed in many tissues. Many cytokines
           are dependent on Jak1 for signaling, including those
           that use the shared receptor subunits common gamma chain
           (IL-2, IL-4, IL-7, IL-9, IL-15, IL-21) and gp130 (IL-6,
           IL-11, oncostatin M, G-CSF, and IFNs, among others). The
           many varied interactions of Jak1 and its ubiquitous
           expression suggest many biological roles. Jak1 is
           important in neurological development, as well as in
           lymphoid development and function. It also plays a role
           in the pathophysiology of cardiac hypertrophy and heart
           failure. A mutation in the ATP-binding site of Jak1 was
           identified in a human uterine leiomyosarcoma cell line,
           resulting in defective cytokine induction and antigen
           presentation, thus allowing the tumor to evade the
           immune system.
          Length = 284

 Score = 55.7 bits (134), Expect = 2e-09
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           G  L RP NCP+ ++ LMR+CW+F+P  R TF  ++   E
Sbjct: 242 GKRLPRPPNCPEEVYQLMRKCWEFQPSKRTTFQNLIEGFE 281


>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinases, Janus kinases.  Protein Tyrosine
           Kinase (PTK) family; Janus kinase (Jak) subfamily;
           catalytic (c) domain (repeat 2). The Jak subfamily is
           composed of Jak1, Jak2, Jak3, TYK2, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Jak subfamily proteins are cytoplasmic (or nonreceptor)
           tyr kinases containing an N-terminal FERM domain,
           followed by a Src homology 2 (SH2) domain, a
           pseudokinase domain, and a C-terminal tyr kinase
           catalytic domain. Most Jaks are expressed in a wide
           variety of tissues, except for Jak3, which is expressed
           only in hematopoietic cells. Jaks are crucial for
           cytokine receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Jaks are also involved in regulating the surface
           expression of some cytokine receptors. The Jak-STAT
           pathway is involved in many biological processes
           including hematopoiesis, immunoregulation, host defense,
           fertility, lactation, growth, and embryogenesis.
          Length = 284

 Score = 55.5 bits (134), Expect = 2e-09
 Identities = 17/41 (41%), Positives = 30/41 (73%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L RP +CPD +++LM+ CW+ +PQ RP+F +++  ++R
Sbjct: 242 GERLPRPPSCPDEVYDLMKLCWEAEPQDRPSFADLILIVDR 282


>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine
           Kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
           Kinase (PTK) family; Spleen Tyrosine Kinase (Syk)
           subfamily; catalytic (c) domain. The Syk subfamily is
           composed of Syk, ZAP-70, Shark, and similar proteins.
           The PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Syk
           subfamily kinases are cytoplasmic (or nonreceptor) tyr
           kinases containing two Src homology 2 (SH2) domains
           N-terminal to the catalytic tyr kinase domain. They are
           involved in the signaling downstream of activated
           receptors (including B-cell, T-cell, and Fc receptors)
           that contain ITAMs (immunoreceptor tyr activation
           motifs), leading to processes such as cell
           proliferation, differentiation, survival, adhesion,
           migration, and phagocytosis. Syk is important in B-cell
           receptor (BCR) signaling, while Zap-70 is primarily
           expressed in T-cells and NK cells, and is a crucial
           component in T-cell receptor (TCR) signaling. Syk also
           plays a central role in Fc receptor-mediated
           phagocytosis in the adaptive immune system. Shark is
           exclusively expressed in ectodermally derived epithelia,
           and is localized preferentially to the apical surface of
           the epithelial cells, it may play a role in a signaling
           pathway for epithelial cell polarity.
          Length = 257

 Score = 54.3 bits (131), Expect = 4e-09
 Identities = 17/44 (38%), Positives = 28/44 (63%)

Query: 61  GGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
            G  L RP+ CP  ++++M  CW+++P+ RPTF E+ +   RD 
Sbjct: 213 SGERLPRPEECPQEIYSIMLSCWKYRPEDRPTFSELESTFRRDP 256


>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Fibroblast Growth Factor Receptors.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor (FGFR) subfamily; catalytic (c) domain. The
           FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4,
           and similar proteins. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K).PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. FGFR subfamily members
           are receptor tyr kinases (RTKs) containing an
           extracellular ligand-binding region with three
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding of
           FGFRs to their ligands, the FGFs, and to heparin/heparan
           sulfate (HS) results in the formation of a ternary
           complex, which leads to receptor dimerization and
           activation, and intracellular signaling. There are at
           least 23 FGFs and four types of FGFRs. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. FGF/FGFR signaling is
           important in the regulation of embryonic development,
           homeostasis, and regenerative processes. Depending on
           the cell type and stage, FGFR signaling produces diverse
           cellular responses including proliferation, growth
           arrest, differentiation, and apoptosis. Aberrant
           signaling leads to many human diseases such as skeletal,
           olfactory, and metabolic disorders, as well as cancer.
          Length = 293

 Score = 54.3 bits (131), Expect = 5e-09
 Identities = 17/39 (43%), Positives = 25/39 (64%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIA 105
           +P NC   L++LMR CW   P  RPTF +++ DL+R + 
Sbjct: 255 KPQNCTQELYHLMRDCWHEVPSQRPTFKQLVEDLDRMLT 293


>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase,
           Focal Adhesion Kinase.  Protein Tyrosine Kinase (PTK)
           family; Focal Adhesion Kinase (FAK); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FAK is a
           cytoplasmic (or nonreceptor) tyr kinase that contains an
           autophosphorylation site and a FERM domain at the
           N-terminus, a central tyr kinase domain, proline-rich
           regions, and a C-terminal FAT (focal adhesion targeting)
           domain. FAK activity is dependent on integrin-mediated
           cell adhesion, which facilitates N-terminal
           autophosphorylation. Full activation is achieved by the
           phosphorylation of its two adjacent A-loop tyrosines.
           FAK is important in mediating signaling initiated at
           sites of cell adhesions and at growth factor receptors.
           Through diverse molecular interactions, FAK functions as
           a biosensor or integrator to control cell motility. It
           is a key regulator of cell survival, proliferation,
           migration and invasion, and thus plays an important role
           in the development and progression of cancer. Src binds
           to autophosphorylated FAK forming the FAK-Src dual
           kinase complex, which is activated in a wide variety of
           tumor cells and generates signals promoting growth and
           metastasis. FAK is being developed as a target for
           cancer therapy.
          Length = 270

 Score = 54.0 bits (130), Expect = 5e-09
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 47  VLGKILQSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           V+G+I          G  L  P NCP  L++LM +CW + P  RP F E+ A L 
Sbjct: 217 VIGRIEN--------GERLPMPPNCPPTLYSLMTKCWAYDPSKRPRFTELKAQLS 263


>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine
           Kinases, Lymphocyte-specific kinase and Blk.  Protein
           Tyrosine Kinase (PTK) family; Lck and Blk kinases;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Lck (lymphocyte-specific
           kinase) and Blk are members of the Src subfamily of
           proteins, which are cytoplasmic (or non-receptor) tyr
           kinases. Src kinases contain an N-terminal SH4 domain
           with a myristoylation site, followed by SH3 and SH2
           domains, a tyr kinase domain, and a regulatory
           C-terminal region containing a conserved tyr. They are
           activated by autophosphorylation at the tyr kinase
           domain, but are negatively regulated by phosphorylation
           at the C-terminal tyr by Csk (C-terminal Src Kinase).
           Src proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Lck is expressed in T-cells and natural
           killer (NK) cells. It plays a critical role in T-cell
           maturation, activation, and T-cell receptor (TCR)
           signaling. Lck phosphorylates ITAM (immunoreceptor tyr
           activation motif) sequences on several subunits of TCRs,
           leading to the activation of different second messenger
           cascades. Phosphorylated ITAMs serve as binding sites
           for other signaling factor such as Syk and ZAP-70,
           leading to their activation and propagation of
           downstream events. In addition, Lck regulates
           drug-induced apoptosis by interfering with the
           mitochondrial death pathway. The apototic role of Lck is
           independent of its primary function in T-cell signaling.
           Blk is expressed specifically in B-cells. It is involved
           in pre-BCR (B-cell receptor) signaling.
          Length = 260

 Score = 53.7 bits (129), Expect = 8e-09
 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 1/39 (2%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERD 103
           + RPDNCP+ L+ LMR CW+ KP+ RPTF E L  +  D
Sbjct: 222 MPRPDNCPEELYELMRLCWKEKPEERPTF-EYLRSVLED 259


>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase,
           Fes.  Protein Tyrosine Kinase (PTK) family; Fes (or Fps)
           kinase subfamily; catalytic (c) domain. The PTKc family
           is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Fes
           subfamily proteins are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal region with FCH
           (Fes/Fer/CIP4 homology) and coiled-coil domains,
           followed by a SH2 domain, and a C-terminal catalytic
           domain. The genes for Fes (feline sarcoma) and Fps
           (Fujinami poultry sarcoma) were first isolated from
           tumor-causing retroviruses. The viral oncogenes encode
           chimeric Fes proteins consisting of Gag sequences at the
           N-termini, resulting in unregulated tyr kinase activity.
           Fes kinase is expressed in myeloid, vascular
           endothelial, epithelial, and neuronal cells. It plays
           important roles in cell growth and differentiation,
           angiogenesis, inflammation and immunity, and
           cytoskeletal regulation. A recent study implicates Fes
           kinase as a tumor suppressor in colorectal cancer.
          Length = 252

 Score = 53.1 bits (127), Expect = 1e-08
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 53  QSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           Q T  ++  G  L  P+ CPD ++ LM RCW++ P  RP+F  +  +L
Sbjct: 203 QQTREAIEQGVRLPCPELCPDAVYRLMERCWEYDPGQRPSFSTVHQEL 250


>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase,
           REarranged during Transfection protein.  Protein
           Tyrosine Kinase (PTK) family; RET (REarranged during
           Transfection) protein; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. RET is a
           receptor tyr kinase (RTK) containing an extracellular
           region with four cadherin-like repeats, a
           calcium-binding site, and a cysteine-rich domain, a
           transmembrane segment, and an intracellular catalytic
           domain. It is part of a multisubunit complex that binds
           glial-derived neurotropic factor (GDNF) family ligands
           (GFLs) including GDNF, neurturin, artemin, and
           persephin. GFLs bind RET along with four GPI-anchored
           coreceptors, bringing two RET molecules together,
           leading to autophosphorylation, activation, and
           intracellular signaling. RET is essential for the
           development of the sympathetic, parasympathetic and
           enteric nervous systems, and the kidney. RET disruption
           by germline mutations causes diseases in humans
           including congenital aganglionosis of the
           gastrointestinal tract (Hirschsprung's disease) and
           three related inherited cancers: multiple endocrine
           neoplasia type 2A (MEN2A), MEN2B, and familial medullary
           thyroid carcinoma (FMTC).
          Length = 290

 Score = 52.7 bits (126), Expect = 2e-08
 Identities = 17/36 (47%), Positives = 26/36 (72%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           RP+NC + ++NLM  CW+ +P  RPTF +I  +LE+
Sbjct: 250 RPENCSEEMYNLMLTCWKQEPDKRPTFADISKELEK 285


>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine
           Kinases, Anaplastic Lymphoma Kinase and Leukocyte
           Tyrosine Kinase.  Protein Tyrosine Kinase (PTK) family;
           Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine
           (tyr) Kinase (LTK); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to tyr
           residues in protein substrates. ALK and LTK are orphan
           receptor tyr kinases (RTKs) whose ligands are not yet
           well-defined. RTKs contain an extracellular
           ligand-binding domain, a transmembrane region, and an
           intracellular tyr kinase domain. They are usually
           activated through ligand binding, which causes
           dimerization and autophosphorylation of the
           intracellular tyr kinase catalytic domain. ALK appears
           to play an important role in mammalian neural
           development as well as visceral muscle differentiation
           in Drosophila. ALK is aberrantly expressed as fusion
           proteins, due to chromosomal translocations, in about
           60% of anaplastic large cell lymphomas (ALCLs). ALK
           fusion proteins are also found in rare cases of diffuse
           large B cell lymphomas (DLBCLs). LTK is mainly expressed
           in B lymphocytes and neuronal tissues. It is important
           in cell proliferation and survival. Transgenic mice
           expressing TLK display retarded growth and high
           mortality rate. In addition, a polymorphism in mouse and
           human LTK is implicated in the pathogenesis of systemic
           lupus erythematosus.
          Length = 277

 Score = 52.4 bits (126), Expect = 3e-08
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 59  MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           + GGG L  P  CP  ++ +M  CWQ  P+ RP F  IL  ++
Sbjct: 234 VTGGGRLDPPKGCPGPVYRIMTDCWQHTPEDRPNFATILERIQ 276


>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine
           Kinases, Discoidin Domain Receptors.  Protein Tyrosine
           Kinase (PTK) family; Discoidin Domain Receptor (DDR)
           subfamily; catalytic (c) domain. The DDR subfamily
           consists of homologs of mammalian DDR1, DDR2, and
           similar proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           DDR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular discoidin homology domain, a
           transmembrane segment, an extended juxtamembrane region,
           and an intracellular catalytic domain. The binding of
           the ligand, collagen, to DDRs results in a slow but
           sustained receptor activation. DDRs regulate cell
           adhesion, proliferation, and extracellular matrix
           remodeling. They have been linked to a variety of human
           cancers including breast, colon, ovarian, brain, and
           lung. There is no evidence showing that DDRs act as
           transforming oncogenes. They are more likely to play a
           role in the regulation of tumor growth and metastasis.
          Length = 296

 Score = 52.0 bits (125), Expect = 3e-08
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 64  ILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
            L RP NCP  ++ LM  CW+   + RPTF EI
Sbjct: 258 YLPRPPNCPKDIYELMLECWRRDEEDRPTFREI 290


>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Src kinase subfamily; catalytic (c) domain. Src
           subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr,
           Fyn, Yrk, and Yes. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Src (or c-Src) proteins are cytoplasmic (or
           non-receptor) tyr kinases which are anchored to the
           plasma membrane. They contain an N-terminal SH4 domain
           with a myristoylation site, followed by SH3 and SH2
           domains, a tyr kinase domain, and a regulatory
           C-terminal region containing a conserved tyr. They are
           activated by autophosphorylation at the tyr kinase
           domain, but are negatively regulated by phosphorylation
           at the C-terminal tyr by Csk (C-terminal Src Kinase).
           Src proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. They were identified as the first
           proto-oncogene products, and they regulate cell
           adhesion, invasion, and motility in cancer cells and
           tumor vasculature, contributing to cancer progression
           and metastasis. Src kinases are overexpressed in a
           variety of human cancers, making them attractive targets
           for therapy. They are also implicated in acute
           inflammatory responses and osteoclast function. Src,
           Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
           Hck, Fgr, and Lyn show a limited expression pattern.
          Length = 261

 Score = 50.4 bits (121), Expect = 1e-07
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTF 93
           + RP NCP+ L++LM +CW   P+ RPTF
Sbjct: 223 MPRPPNCPEELYDLMLQCWDKDPEERPTF 251


>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine
           Kinases, Met and Ron.  Protein Tyrosine Kinase (PTK)
           family; Met and Ron; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Met and
           Ron are receptor tyr kinases (RTKs) composed of an
           alpha-beta heterodimer. The extracellular alpha chain is
           disulfide linked to the beta chain, which contains an
           extracellular ligand-binding region with a sema domain,
           a PSI domain and four IPT repeats, a transmembrane
           segment, and an intracellular catalytic domain. Binding
           to their ligands leads to receptor dimerization,
           autophosphorylation, activation, and intracellular
           signaling. Met binds to the ligand, hepatocyte growth
           factor/scatter factor (HGF/SF), and is also called the
           HGF receptor. HGF/Met signaling plays a role in growth,
           transformation, cell motility, invasion, metastasis,
           angiogenesis, wound healing, and tissue regeneration.
           Aberrant expression of Met through mutations or gene
           amplification is associated with many human cancers
           including hereditary papillary renal and gastric
           carcinomas. The ligand for Ron is macrophage stimulating
           protein (MSP). Ron signaling is important in regulating
           cell motility, adhesion, proliferation, and apoptosis.
           Aberrant Ron expression is implicated in tumorigenesis
           and metastasis.
          Length = 262

 Score = 50.2 bits (120), Expect = 1e-07
 Identities = 17/37 (45%), Positives = 27/37 (72%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           L++P+ CPD L+ +M  CW  KP+ RPTF E+++ +E
Sbjct: 221 LLQPEYCPDPLYEVMLSCWHPKPEMRPTFSELVSRIE 257


>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine
           Kinase, Colon Carcinoma Kinase 4.  Protein Tyrosine
           Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4);
           pseudokinase domain. The PTKc (catalytic domain) family,
           to which this subfamily belongs, includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. CCK4,
           also called protein tyrosine kinase 7 (PTK7), is an
           orphan receptor tyr kinase (RTK) containing an
           extracellular region with seven immunoglobulin domains,
           a transmembrane segment, and an intracellular inactive
           pseudokinase domain. Studies in mice reveal that CCK4 is
           essential for neural development. Mouse embryos
           containing a truncated CCK4 die perinatally and display
           craniorachischisis, a severe form of neural tube defect.
           The mechanism of action of the CCK4 pseudokinase is
           still unknown. Other pseudokinases such as HER3 rely on
           the activity of partner RTKs.
          Length = 275

 Score = 50.2 bits (120), Expect = 1e-07
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           P+ CP RL+ LM RCW   P+ RP+F E+++ L 
Sbjct: 241 PEGCPSRLYKLMTRCWAVNPKDRPSFSELVSALG 274


>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 1.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 1 (FGFR1); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR1 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Alternative splicing of
           FGFR1 transcripts produces a variety of isoforms, which
           are differentially expressed in cells. FGFR1 binds the
           ligands, FGF1 and FGF2, with high affinity and has also
           been reported to bind FGF4, FGF6, and FGF9. FGFR1
           signaling is critical in the control of cell migration
           during embryo development. It promotes cell
           proliferation in fibroblasts. Nuclear FGFR1 plays a role
           in the regulation of transcription. Mutations,
           insertions or deletions of FGFR1 have been identified in
           patients with Kallman's syndrome (KS), an inherited
           disorder characterized by hypogonadotropic hypogonadism
           and loss of olfaction. Aberrant FGFR1 expression has
           been found in some human cancers including 8P11
           myeloproliferative syndrome (EMS), breast cancer, and
           pancreatic adenocarcinoma.
          Length = 307

 Score = 49.6 bits (118), Expect = 2e-07
 Identities = 18/44 (40%), Positives = 28/44 (63%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQ 110
           +P NC + L+ +MR CW   P  RPTF +++ DL+R +A +  Q
Sbjct: 263 KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILALTSNQ 306


>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase,
           Abelson kinase.  Protein Tyrosine Kinase (PTK) family;
           Abelson (Abl) kinase; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Abl (or
           c-Abl) is a ubiquitously-expressed cytoplasmic (or
           nonreceptor) tyr kinase that contains SH3, SH2, and tyr
           kinase domains in its N-terminal region, as well as
           nuclear localization motifs, a putative DNA-binding
           domain, and F- and G-actin binding domains in its
           C-terminal tail. It also contains a short autoinhibitory
           cap region in its N-terminus. Abl is normally inactive
           and requires phosphorylation and myristoylation for
           activation. Abl function depends on its subcellular
           localization. In the cytoplasm, Abl plays a role in cell
           proliferation and survival. In response to DNA damage or
           oxidative stress, Abl is transported to the nucleus
           where it induces apoptosis. In chronic myelogenous
           leukemia (CML) patients, an aberrant translocation
           results in the replacement of the first exon of Abl with
           the BCR (breakpoint cluster region) gene. The resulting
           BCR-Abl fusion protein is constitutively active and
           associates into tetramers, resulting in a hyperactive
           kinase sending a continuous signal. This leads to
           uncontrolled proliferation, morphological transformation
           and anti-apoptotic effects. BCR-Abl is the target of
           selective inhibitors, such as imatinib (Gleevec), used
           in the treatment of CML. Abl2, also known as ARG
           (Abelson-related gene), is thought to play a cooperative
           role with Abl in the proper development of the nervous
           system. The Tel-ARG fusion protein, resulting from
           reciprocal translocation between chromosomes 1 and 12,
           is associated with acute myeloid leukemia (AML). The TEL
           gene is a frequent fusion partner of other tyr kinase
           oncogenes, including Tel/Abl, Tel/PDGFRbeta, and
           Tel/Jak2, found in patients with leukemia and
           myeloproliferative disorders.
          Length = 263

 Score = 49.5 bits (118), Expect = 2e-07
 Identities = 17/35 (48%), Positives = 23/35 (65%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           RP+ CP +++ LMR CWQ+ P  RP+F EI    E
Sbjct: 226 RPEGCPPKVYELMRACWQWNPSDRPSFAEIHQAFE 260


>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Axl subfamily; catalytic (c) domain. The PTKc family is
           part of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). The Axl subfamily
           consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and
           similar proteins. PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Axl subfamily members
           are receptor tyr kinases (RTKs) containing an
           extracellular ligand-binding region with two
           immunoglobulin-like domains followed by two fibronectin
           type III repeats, a transmembrane segment, and an
           intracellular catalytic domain. Binding to their
           ligands, Gas6 and protein S, leads to receptor
           dimerization, autophosphorylation, activation, and
           intracellular signaling. Axl subfamily members are
           implicated in a variety of cellular effects including
           survival, proliferation, migration, and phagocytosis.
           They are also associated with several types of cancer as
           well as inflammatory, autoimmune, vascular, and kidney
           diseases. Mer is named after its original reported
           expression pattern (monocytes, epithelial, and
           reproductive tissues). It is required for the ingestion
           of apoptotic cells by phagocytes such as macrophages,
           retinal pigment epithelial cells, and dendritic cells.
           Mer is also important in maintaining immune homeostasis.
          Length = 273

 Score = 49.4 bits (118), Expect = 2e-07
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 59  MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           +  G  L +P++C D L++LM  CW+  P+ RPTF ++   LE 
Sbjct: 228 LRHGNRLKQPEDCLDELYDLMYSCWRADPKDRPTFTKLREVLEN 271


>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine
           Kinase, C-ros.  Protein Tyrosine Kinases (PTK) family;
           C-ros and Drosophila Sevenless proteins; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. The
           proto-oncogene c-ros encodes an orphan receptor tyr
           kinase (RTK) with an unknown ligand. RTKs contain an
           extracellular ligand-binding domain, a transmembrane
           region, and an intracellular tyr kinase domain. RTKs are
           usually activated through ligand binding, which causes
           dimerization and autophosphorylation of the
           intracellular tyr kinase catalytic domain. C-ros is
           expressed in embryonic cells of the kidney, intestine
           and lung, but disappears soon after birth. It persists
           only in the adult epididymis. Male mice bearing inactive
           mutations of c-ros lack the initial segment of the
           epididymis and are infertile. The Drosophila protein,
           Sevenless, is required for the specification of the R7
           photoreceptor cell during eye development.
          Length = 269

 Score = 49.5 bits (118), Expect = 3e-07
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           GG L +P+NCPD+++ LM  CW   P  RPTF  I
Sbjct: 229 GGRLQKPENCPDKIYQLMTNCWAQDPSERPTFDRI 263


>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase,
           Fer.  Protein Tyrosine Kinase (PTK) family; Fer kinase;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Fer kinase is a member
           of the Fes subfamily of proteins which are cytoplasmic
           (or nonreceptor) tyr kinases containing an N-terminal
           region with FCH (Fes/Fer/CIP4 homology) and coiled-coil
           domains, followed by a SH2 domain, and a C-terminal
           catalytic domain. Fer kinase is expressed in a wide
           variety of tissues, and is found to reside in both the
           cytoplasm and the nucleus. It plays important roles in
           neuronal polarization and neurite development,
           cytoskeletal reorganization, cell migration, growth
           factor signaling, and the regulation of cell-cell
           interactions mediated by adherens junctions and focal
           adhesions. Fer kinase also regulates cell cycle
           progression in malignant cells.
          Length = 250

 Score = 48.8 bits (116), Expect = 3e-07
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           P  CPD ++ +M+RCW +KP+ RP F E+  +L
Sbjct: 216 PQKCPDDVYKVMQRCWDYKPENRPKFSELQKEL 248


>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine
           Kinase, Tie2.  Protein Tyrosine Kinase (PTK) family;
           Tie2; catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tie2 is a receptor tyr
           kinase (RTK) containing an extracellular region, a
           transmembrane segment, and an intracellular catalytic
           domain. The extracellular region contains an
           immunoglobulin (Ig)-like domain, three epidermal growth
           factor (EGF)-like domains, a second Ig-like domain, and
           three fibronectin type III repeats. Tie2 is expressed
           mainly in endothelial cells and hematopoietic stem
           cells. It is also found in a subset of tumor-associated
           monocytes and eosinophils. The angiopoietins (Ang-1 to
           Ang-4) serve as ligands for Tie2. The binding of Ang-1
           to Tie2 leads to receptor autophosphorylation and
           activation, promoting cell migration and survival. In
           contrast, Ang-2 binding to Tie2 does not result in the
           same response, suggesting that Ang-2 may function as an
           antagonist. Tie2 signaling plays key regulatory roles in
           vascular integrity and quiescence, and in inflammation.
          Length = 303

 Score = 48.5 bits (115), Expect = 5e-07
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           L +P NC D +++LMR+CW+ KP  RP+F +IL  L R
Sbjct: 242 LEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNR 279


>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase,
           Lyn.  Protein Tyrosine Kinase (PTK) family; Lyn kinase;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Lyn is a member of the
           Src subfamily of proteins, which are cytoplasmic (or
           non-receptor) tyr kinases. Src kinases contain an
           N-terminal SH4 domain with a myristoylation site,
           followed by SH3 and SH2 domains, a tyr kinase domain,
           and a regulatory C-terminal region containing a
           conserved tyr. They are activated by autophosphorylation
           at the tyr kinase domain, but are negatively regulated
           by phosphorylation at the C-terminal tyr by Csk
           (C-terminal Src Kinase). Src proteins are involved in
           signaling pathways that regulate cytokine and growth
           factor responses, cytoskeleton dynamics, cell
           proliferation, survival, and differentiation. Lyn is
           expressed in B lymphocytes and myeloid cells. It
           exhibits both positive and negative regulatory roles in
           B cell receptor (BCR) signaling. Lyn, as well as Fyn and
           Blk, promotes B cell activation by phosphorylating ITAMs
           (immunoreceptor tyr activation motifs) in CD19 and in Ig
           components of BCR. It negatively regulates signaling by
           its unique ability to phosphorylate ITIMs
           (immunoreceptor tyr inhibition motifs) in cell surface
           receptors like CD22 and CD5. Lyn also plays an important
           role in G-CSF receptor signaling by phosphorylating a
           variety of adaptor molecules.
          Length = 261

 Score = 47.7 bits (113), Expect = 8e-07
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 9/64 (14%)

Query: 39  WLLGLLRY---VLGKIL---QSTGASMVG---GGILVRPDNCPDRLFNLMRRCWQFKPQA 89
           W  G+L Y     GKI     S    M     G  + R +NCPD L+++M+ CW+ K + 
Sbjct: 188 WSFGILLYEIVTYGKIPYPGMSNSDVMSALQRGYRMPRMENCPDELYDIMKTCWKEKAEE 247

Query: 90  RPTF 93
           RPTF
Sbjct: 248 RPTF 251


>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 4.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 4 (FGFR4); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR4 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Unlike other FGFRs,
           there is only one splice form of FGFR4. It binds FGF1,
           FGF2, FGF6, FGF19, and FGF23. FGF19 is a selective
           ligand for FGFR4. Although disruption of FGFR4 in mice
           causes no obvious phenotype, in vivo inhibition of FGFR4
           in cultured skeletal muscle cells resulted in an arrest
           of muscle progenitor differentiation. FGF6 and FGFR4 are
           uniquely expressed in myofibers and satellite cells.
           FGF6/FGFR4 signaling appears to play a key role in the
           regulation of muscle regeneration. A polymorphism in
           FGFR4 is found in head and neck squamous cell carcinoma.
          Length = 314

 Score = 47.7 bits (113), Expect = 1e-06
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAA 106
           +P NC   L+ LMR CW   P  RPTF +++  L++ +AA
Sbjct: 257 KPSNCTHELYMLMRECWHAVPTQRPTFKQLVEALDKVLAA 296


>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like
           Protein Tyrosine Kinases.  Protein Tyrosine Kinase (PTK)
           family; Human Fyn-related kinase (Frk) and similar
           proteins; catalytic (c) domain. The PTKc family is part
           of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Frk and
           Srk are members of the Src subfamily of proteins, which
           are cytoplasmic (or non-receptor) tyr kinases. Src
           kinases contain an N-terminal SH4 domain with a
           myristoylation site, followed by SH3 and SH2 domains, a
           tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr. They are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). Src
           proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Frk, also known as Rak, is specifically
           expressed in liver, lung, kidney, intestine, mammary
           glands, and the islets of Langerhans. Rodent homologs
           were previously referred to as GTK (gastrointestinal tyr
           kinase), BSK (beta-cell Src-like kinase), or IYK
           (intestinal tyr kinase). Studies in mice reveal that Frk
           is not essential for viability. It plays a role in the
           signaling that leads to cytokine-induced beta-cell death
           in Type I diabetes. It also regulates beta-cell number
           during embryogenesis and early in life.
          Length = 261

 Score = 47.4 bits (113), Expect = 1e-06
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTF 93
           P  CP  L+++M  CW+  P  RPTF
Sbjct: 226 PPGCPKELYDIMLDCWKEDPDDRPTF 251


>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the
           Protein Tyrosine Kinases, Janus kinases 2 and 3.
           Protein Tyrosine Kinase (PTK) family; Janus kinase 2
           (Jak2) and Jak3; catalytic (c) domain (repeat 2). The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Jak2 and
           Jak3 are members of the Janus kinase (Jak) subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal FERM domain, followed
           by a Src homology 2 (SH2) domain, a pseudokinase domain,
           and a C-terminal catalytic tyr kinase domain. Jaks are
           crucial for cytokine receptor signaling. They are
           activated by autophosphorylation upon cytokine-induced
           receptor aggregation, and subsequently trigger
           downstream signaling events such as the phosphorylation
           of signal transducers and activators of transcription
           (STATs). Jak2 is widely expressed in many tissues while
           Jak3 is expressed only in hematopoietic cells. Jak2 is
           essential for the signaling of hormone-like cytokines
           such as growth hormone, erythropoietin, thrombopoietin,
           and prolactin, as well as some IFNs and cytokines that
           signal through the IL-3 and gp130 receptors. Jak3 binds
           the shared receptor subunit common gamma chain and thus,
           is essential in the signaling of cytokines that use it
           such as IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21.
           Disruption of Jak2 in mice results in an embryonic
           lethal phenotype with multiple defects including
           erythropoietic and cardiac abnormalities. It is the only
           Jak gene that results in a lethal phenotype when
           disrupted in mice. A mutation in the pseudokinase domain
           of Jak2, V617F, is present in many myeloproliferative
           diseases, including almost all patients with
           polycythemia vera, and 50% of patients with essential
           thrombocytosis and myelofibrosis. Jak3 is important in
           lymphoid development and myeloid cell differentiation.
           Inactivating mutations in Jak3 have been reported in
           humans with severe combined immunodeficiency (SCID).
          Length = 284

 Score = 47.1 bits (112), Expect = 2e-06
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
            G L  P  CP  ++ +M+ CW   P  RP+F E+   +E
Sbjct: 242 NGRLPAPPGCPAEIYAIMKECWNNDPSQRPSFSELALQVE 281


>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Fes subfamily; catalytic (c) domain. Fes subfamily
           members include Fes (or Fps), Fer, and similar proteins.
           The PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Fes
           subfamily proteins are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal region with FCH
           (Fes/Fer/CIP4 homology) and coiled-coil domains,
           followed by a SH2 domain, and a C-terminal catalytic
           domain. The genes for Fes (feline sarcoma) and Fps
           (Fujinami poultry sarcoma) were first isolated from
           tumor-causing retroviruses. The viral oncogenes encode
           chimeric Fes proteins consisting of Gag sequences at the
           N-termini, resulting in unregulated tyr kinase activity.
           Fes and Fer kinases play roles in haematopoiesis,
           inflammation and immunity, growth factor signaling,
           cytoskeletal regulation, cell migration and adhesion,
           and the regulation of cell-cell interactions. Fes and
           Fer show redundancy in their biological functions.
          Length = 251

 Score = 46.7 bits (111), Expect = 2e-06
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           G  +  P  CP+ ++ LM +CW + P+ RP+F EI  +L+
Sbjct: 211 GYRMPAPQLCPEEIYRLMLQCWAYDPENRPSFSEIYNELQ 250


>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to
           tyrosine kinase).  Protein Tyrosine Kinase (PTK) family;
           Receptor related to tyrosine kinase (Ryk); pseudokinase
           domain. The PTKc (catalytic domain) family to which this
           subfamily belongs, is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ryk is a
           receptor tyr kinase (RTK) containing an extracellular
           region with two leucine-rich motifs, a transmembrane
           segment, and an intracellular inactive pseudokinase
           domain. The extracellular region of Ryk shows homology
           to the N-terminal domain of Wnt inhibitory factor-1
           (WIF) and serves as the ligand (Wnt) binding domain of
           Ryk. Ryk is expressed in many different tissues both
           during development and in adults, suggesting a
           widespread function. It acts as a chemorepulsive axon
           guidance receptor of Wnt glycoproteins and is
           responsible for the establishment of axon tracts during
           the development of the central nervous system. In
           addition, studies in mice reveal that Ryk is essential
           in skeletal, craniofacial, and cardiac development.
           Thus, it appears Ryk is involved in signal transduction
           despite its lack of kinase activity. Ryk may function as
           an accessory protein that modulates the signals coming
           from catalytically active partner RTKs such as the Eph
           receptors.
          Length = 280

 Score = 46.6 bits (111), Expect = 2e-06
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           L +P NCPD LF +M  CW   P+ RP+F +++  L
Sbjct: 238 LAQPINCPDELFAVMACCWALDPEERPSFSQLVQCL 273


>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase,
           Axl.  Protein Tyrosine Kinase (PTK) family; Axl;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Axl is a member of the
           Axl subfamily, which is composed of receptor tyr kinases
           (RTKs) containing an extracellular ligand-binding region
           with two immunoglobulin-like domains followed by two
           fibronectin type III repeats, a transmembrane segment,
           and an intracellular catalytic domain. Binding to their
           ligands, Gas6 and protein S, leads to receptor
           dimerization, autophosphorylation, activation, and
           intracellular signaling. Axl is widely expressed in a
           variety of organs and cells including epithelial,
           mesenchymal, hematopoietic, as well as non-transformed
           cells. Axl signaling is important in many cellular
           functions such as survival, anti-apoptosis,
           proliferation, migration, and adhesion. Axl was
           originally isolated from patients with chronic
           myelogenous leukemia and a chronic myeloproliferative
           disorder. Axl is overexpressed in many human cancers
           including colon, squamous cell, thyroid, breast, and
           lung carcinomas.
          Length = 272

 Score = 46.6 bits (110), Expect = 2e-06
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L +P +C D L++LM  CW   P+ RP+F  +  +LE+
Sbjct: 230 GNRLKQPPDCLDGLYSLMSSCWLLNPKDRPSFETLRCELEK 270


>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src
           kinase-like Protein Tyrosine Kinases.  Protein Tyrosine
           Kinase (PTK) family; C-terminal Src kinase (Csk)
           subfamily; catalytic (c) domain. The Csk subfamily is
           composed of Csk, Chk, and similar proteins. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Csk
           subfamily kinases are cytoplasmic (or nonreceptor) tyr
           kinases containing the Src homology domains, SH3 and
           SH2, N-terminal to the catalytic tyr kinase domain. They
           negatively regulate the activity of Src kinases that are
           anchored to the plasma membrane. To inhibit Src kinases,
           Csk and Chk are translocated to the membrane via binding
           to specific transmembrane proteins, G-proteins, or
           adaptor proteins near the membrane. Csk catalyzes the
           tyr phosphorylation of the regulatory C-terminal tail of
           Src kinases, resulting in their inactivation. Chk
           inhibit Src kinases using a noncatalytic mechanism by
           simply binding to them. As negative regulators of Src
           kinases, Csk and Chk play important roles in cell
           proliferation, survival, and differentiation, and
           consequently, in cancer development and progression.
          Length = 256

 Score = 45.5 bits (108), Expect = 4e-06
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           P+ CP  ++ +M+ CW+  P  RPTF ++   L  
Sbjct: 221 PEGCPPEVYKVMKDCWELDPAKRPTFKQLREQLAL 255


>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 2.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 2 (FGFR2); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR2 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. There are many splice
           variants of FGFR2 which show differential expression and
           binding to FGF ligands. Disruption of either FGFR2 or
           FGFR2b is lethal in mice, due to defects in the placenta
           or severe impairment of tissue development including
           lung, limb, and thyroid, respectively. Disruption of
           FGFR2c in mice results in defective bone and skull
           development. Genetic alterations of FGFR2 are associated
           with many human skeletal disorders including Apert
           syndrome, Crouzon syndrome, Jackson-Weiss syndrome, and
           Pfeiffer syndrome.
          Length = 304

 Score = 45.8 bits (108), Expect = 5e-06
 Identities = 16/36 (44%), Positives = 24/36 (66%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           +P NC + L+ +MR CW   P  RPTF +++ DL+R
Sbjct: 260 KPANCTNELYMMMRDCWHAIPSHRPTFKQLVEDLDR 295


>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine
           Kinase, Fibroblast Growth Factor Receptor 3.  Protein
           Tyrosine Kinase (PTK) family; Fibroblast Growth Factor
           Receptor 3 (FGFR3); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. FGFR3 is
           part of the FGFR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular
           ligand-binding region with three immunoglobulin-like
           domains, a transmembrane segment, and an intracellular
           catalytic domain. The binding of FGFRs to their ligands,
           the FGFs, results in receptor dimerization and
           activation, and intracellular signaling. The binding of
           FGFs to FGFRs is promiscuous, in that a receptor may be
           activated by several ligands and a ligand may bind to
           more that one type of receptor. Many FGFR3 splice
           variants have been reported with the IIIb and IIIc
           isoforms being the predominant forms. FGFR3 IIIc is the
           isoform expressed in chondrocytes, the cells affected in
           dwarfism, while IIIb is expressed in epithelial cells.
           FGFR3 ligands include FGF1, FGF2, FGF4, FGF8, FGF9, and
           FGF23. It is a negative regulator of long bone growth.
           In the cochlear duct and in the lens, FGFR3 is involved
           in differentiation while it appears to have a role in
           cell proliferation in epithelial cells. Germline
           mutations in FGFR3 are associated with skeletal
           disorders including several forms of dwarfism. Some
           missense mutations are associated with multiple myeloma
           and carcinomas of the bladder and cervix. Overexpression
           of FGFR3 is found in thyroid carcinoma.
          Length = 334

 Score = 45.4 bits (107), Expect = 6e-06
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 11/57 (19%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER-----------DIAASFRQVS 112
           +P NC   L+ +MR CW   P  RPTF +++ DL+R           D++  F Q S
Sbjct: 257 KPANCTHELYMIMRECWHAVPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSVPFEQYS 313


>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase,
           Hematopoietic cell kinase.  Protein Tyrosine Kinase
           (PTK) family; Hematopoietic cell kinase (Hck); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Hck is a member of the Src subfamily of proteins, which
           are cytoplasmic (or non-receptor) tyr kinases. Src
           kinases contain an N-terminal SH4 domain with a
           myristoylation site, followed by SH3 and SH2 domains, a
           tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr. They are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). Src
           proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Hck is present in myeloid and lymphoid
           cells that play a role in the development of cancer. It
           may be important in the oncogenic signaling of the
           protein Tel-Abl, which induces a chronic myelogenous
           leukemia (CML)-like disease. Hck also acts as a negative
           regulator of granulocyte colony-stimulating factor
           (G-CSF)-induced proliferation of granulocytic
           precursors, suggesting a possible role in the
           development of acute myeloid leukemia (AML). In
           addition, Hck is essential in regulating the
           degranulation of polymorphonuclear leukocytes (PMNs).
           Genetic polymorphisms affect the expression level of
           Hck, which affects PMN mediator release and influences
           the development of chronic obstructive pulmonary disease
           (COPD).
          Length = 260

 Score = 45.0 bits (106), Expect = 7e-06
 Identities = 18/35 (51%), Positives = 27/35 (77%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           RP+NCP+ L+N+M RCW+ +P+ RPTF  I + L+
Sbjct: 224 RPENCPEELYNIMMRCWKNRPEERPTFEYIQSVLD 258


>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine
           Kinase, Tyro3.  Protein Tyrosine Kinase (PTK) family;
           Tyro3; catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tyro3 (or Sky) is a
           member of the Axl subfamily, which is composed of
           receptor tyr kinases (RTKs) containing an extracellular
           ligand-binding region with two immunoglobulin-like
           domains followed by two fibronectin type III repeats, a
           transmembrane segment, and an intracellular catalytic
           domain. Binding to their ligands, Gas6 and protein S,
           leads to receptor dimerization, autophosphorylation,
           activation, and intracellular signaling. Tyro3 is
           predominantly expressed in the central nervous system
           and the brain, and functions as a neurotrophic factor.
           It is also expressed in osteoclasts and has a role in
           bone resorption.
          Length = 273

 Score = 44.9 bits (106), Expect = 8e-06
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 59  MVGGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           ++ G  L +P +C + ++ LM +CW  +P+ RP+F  +   LE
Sbjct: 228 LIKGNRLKQPPDCLEDVYELMCQCWSPEPKCRPSFQHLRDQLE 270


>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Tyrosine kinase expressed in hepatocellular carcinoma
           (Tec) subfamily; catalytic (c) domain. The Tec subfamily
           is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk
           (Txk), and similar proteins. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tec kinases are
           cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with
           similarity to Src kinases in that they contain Src
           homology protein interaction domains (SH3, SH2)
           N-terminal to the catalytic tyr kinase domain. Unlike
           Src kinases, most Tec subfamily members (except Rlk)
           also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. In addition, some
           members contain the Tec homology (TH) domain, which
           contains proline-rich and zinc-binding regions. Tec
           kinases form the second largest subfamily of nRTKs and
           are expressed mainly by haematopoietic cells, although
           Tec and Bmx are also found in endothelial cells. B-cells
           express Btk and Tec, while T-cells express Itk, Txk, and
           Tec. Collectively, Tec kinases are expressed in a
           variety of myeloid cells such as mast cells, platelets,
           macrophages, and dendritic cells. Each Tec kinase shows
           a distinct cell-type pattern of expression. The function
           of Tec kinases in lymphoid cells have been studied
           extensively. They play important roles in the
           development, differentiation, maturation, regulation,
           survival, and function of B-cells and T-cells. Mutations
           in Btk cause the severe B-cell immunodeficiency,
           X-linked agammaglobulinaemia (XLA).
          Length = 256

 Score = 44.4 bits (105), Expect = 1e-05
 Identities = 15/39 (38%), Positives = 22/39 (56%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           G  L RP   P  ++ +M  CW  KP+ RP F ++L+ L
Sbjct: 217 GYRLYRPKLAPTEVYTIMYSCWHEKPEDRPAFKKLLSQL 255


>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein
           Tyrosine Kinases.  Protein Tyrosine Kinase (PTK) family;
           Ephrin Receptor (EphR) subfamily; catalytic (c) domain.
           The PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. EphRs
           comprise the largest subfamily of receptor tyr kinases
           (RTKs). They can be classified into two classes (EphA
           and EphB), according to their extracellular sequences,
           which largely correspond to binding preferences for
           either GPI-anchored ephrin-A ligands or transmembrane
           ephrin-B ligands. Vertebrates have ten EphA and six EhpB
           receptors, which display promiscuous ligand interactions
           within each class. EphRs contain an ephrin binding
           domain and two fibronectin repeats extracellularly, a
           transmembrane segment, and a cytoplasmic tyr kinase
           domain. Binding of the ephrin ligand to EphR requires
           cell-cell contact since both are anchored to the plasma
           membrane. This allows ephrin/EphR dimers to form,
           leading to the activation of the intracellular tyr
           kinase domain. The resulting downstream signals occur
           bidirectionally in both EphR-expressing cells (forward
           signaling) and ephrin-expressing cells (reverse
           signaling). The main effect of ephrin/EphR interaction
           is cell-cell repulsion or adhesion. Ephrin/EphR
           signaling is important in neural development and
           plasticity, cell morphogenesis and proliferation,
           cell-fate determination, embryonic development, tissue
           patterning, and angiogenesis.
          Length = 266

 Score = 44.3 bits (105), Expect = 1e-05
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
           P +CP  L+ LM  CWQ     RPTF +I++ L++ I
Sbjct: 230 PMDCPSALYQLMLDCWQKDRNERPTFSQIVSTLDKMI 266


>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase,
           C-terminal Src kinase.  Protein Tyrosine Kinase (PTK)
           family; C-terminal Src kinase (Csk); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. The Csk
           subfamily kinases are cytoplasmic (or nonreceptor) tyr
           kinases containing the Src homology domains, SH3 and
           SH2, N-terminal to the catalytic tyr kinase domain. They
           negatively regulate the activity of Src kinases that are
           anchored to the plasma membrane. To inhibit Src kinases,
           Csk is translocated to the membrane via binding to
           specific transmembrane proteins, G-proteins, or adaptor
           proteins near the membrane. Csk catalyzes the tyr
           phosphorylation of the regulatory C-terminal tail of Src
           kinases, resulting in their inactivation. Csk is
           expressed in a wide variety of tissues. As a negative
           regulator of Src, Csk plays a role in cell
           proliferation, survival, and differentiation, and
           consequently, in cancer development and progression. In
           addition, Csk also shows Src-independent functions. It
           is a critical component in G-protein signaling, and
           plays a role in cytoskeletal reorganization and cell
           migration.
          Length = 256

 Score = 44.2 bits (104), Expect = 1e-05
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           PD CP  ++++M++CW      RP+F+++   LE
Sbjct: 221 PDGCPPVVYDVMKQCWHLDAATRPSFLQLREQLE 254


>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine
           Kinase, Tie1.  Protein Tyrosine Kinase (PTK) family;
           Tie1; catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tie1 is a receptor tyr
           kinase (RTK) containing an extracellular region, a
           transmembrane segment, and an intracellular catalytic
           domain. The extracellular region contains an
           immunoglobulin (Ig)-like domain, three epidermal growth
           factor (EGF)-like domains, a second Ig-like domain, and
           three fibronectin type III repeats. Tie receptors are
           specifically expressed in endothelial cells and
           hematopoietic stem cells. No specific ligand has been
           identified for Tie1, although the angiopoietin, Ang-1,
           binds to Tie1 through integrins at high concentrations.
           In vivo studies of Tie1 show that it is critical in
           vascular development.
          Length = 297

 Score = 44.2 bits (104), Expect = 1e-05
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAA 106
           +P NC D ++ LMR+CW+ +P  RP F +I   L R + A
Sbjct: 239 KPRNCDDEVYELMRQCWRDRPYERPPFAQISVQLSRMLEA 278


>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine
           Kinases, Tropomyosin Related Kinases.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase (Trk)
           subfamily; catalytic (c) domain. The Trk subfamily
           consists of TrkA, TrkB, TrkC, and similar proteins. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Trk
           subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular region with arrays of
           leucine-rich motifs flanked by two cysteine-rich
           clusters followed by two immunoglobulin-like domains, a
           transmembrane segment, and an intracellular catalytic
           domain. Binding to their ligands, the nerve growth
           factor (NGF) family of neutrotrophins, leads to Trk
           receptor oligomerization and activation of the catalytic
           domain. Trk receptors are mainly expressed in the
           peripheral and central nervous systems. They play
           important roles in cell fate determination, neuronal
           survival and differentiation, as well as in the
           regulation of synaptic plasticity. Altered expression of
           Trk receptors is associated with many human diseases.
          Length = 280

 Score = 43.6 bits (103), Expect = 2e-05
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           G +L RP  CP  ++++M  CW+  PQ R    +I   L+
Sbjct: 240 GRLLQRPRTCPSEVYDIMLGCWKRDPQQRINIKDIHERLQ 279


>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase,
           Csk homologous kinase.  Protein Tyrosine Kinase (PTK)
           family; Csk homologous kinase (Chk); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Csk
           subfamily kinases are cytoplasmic (or nonreceptor) tyr
           kinases containing the Src homology domains, SH3 and
           SH2, N-terminal to the catalytic tyr kinase domain. They
           negatively regulate the activity of Src kinases that are
           anchored to the plasma membrane. Chk is also referred to
           as megakaryocyte-associated tyrosine kinase (Matk). To
           inhibit Src kinases, Chk is translocated to the membrane
           via binding to specific transmembrane proteins,
           G-proteins, or adaptor proteins near the membrane. Chk
           inhibit Src kinases using a noncatalytic mechanism by
           simply binding to them. As a negative regulator of Src
           kinases, Chk may play important roles in cell
           proliferation, survival, and differentiation, and
           consequently, in cancer development and progression. Chk
           is expressed in brain and hematopoietic cells. Studies
           in mice reveal that Chk is not functionally redundant
           with Csk and that it plays an important role as a
           regulator of immune responses. Chk also plays a role in
           neural differentiation in a manner independent of Src by
           enhancing Mapk activation via Ras-mediated signaling.
          Length = 254

 Score = 43.4 bits (102), Expect = 3e-05
 Identities = 13/36 (36%), Positives = 24/36 (66%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERD 103
           P+ CP  ++ LM  CW+ +P+ RP+F ++   LE++
Sbjct: 219 PEGCPADVYVLMTSCWETEPKKRPSFHKLREKLEKE 254


>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein
           Tyrosine Kinase, Tyrosine kinase 2.  Protein Tyrosine
           Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic
           (c) domain (repeat 2). The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tyk2 is a member of the
           Janus kinase (Jak) subfamily of proteins, which are
           cytoplasmic (or nonreceptor) tyr kinases containing an
           N-terminal FERM domain, followed by a Src homology 2
           (SH2) domain, a pseudokinase domain, and a C-terminal
           tyr kinase catalytic domain. Jaks are crucial for
           cytokine receptor signaling. They are activated by
           autophosphorylation upon cytokine-induced receptor
           aggregation, and subsequently trigger downstream
           signaling events such as the phosphorylation of signal
           transducers and activators of transcription (STATs).
           Tyk2 is widely expressed in many tissues. It is involved
           in signaling via the cytokine receptors IFN-alphabeta,
           IL-6, IL-10, IL-12, IL-13, and IL-23. It mediates cell
           surface urokinase receptor (uPAR) signaling and plays a
           role in modulating vascular smooth muscle cell (VSMC)
           functional behavior in response to injury. Tyk2 is also
           important in dendritic cell function and T helper (Th)1
           cell differentiation. A homozygous mutation of Tyk2 was
           found in a patient with hyper-IgE syndrome (HIES), a
           primary immunodeficiency characterized by recurrent skin
           abscesses, pneumonia, and elevated serum IgE. This
           suggests that Tyk2 may play important roles in multiple
           cytokine signaling involved in innate and adaptive
           immunity.
          Length = 283

 Score = 43.3 bits (102), Expect = 3e-05
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           L  P NCP  ++ LM+ CW+ + + RPTF  ++  L+
Sbjct: 243 LPCPKNCPQEVYILMKNCWETEAKFRPTFRSLIPILK 279


>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine
           Kinases.  Protein Tyrosine Kinase (PTK) family; Tie
           subfamily; catalytic (c) domain. The Tie subfamily
           consists of Tie1 and Tie2. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Tie proteins are
           receptor tyr kinases (RTKs) containing an extracellular
           region, a transmembrane segment, and an intracellular
           catalytic domain. The extracellular region contains an
           immunoglobulin (Ig)-like domain, three epidermal growth
           factor (EGF)-like domains, a second Ig-like domain, and
           three fibronectin type III repeats. Tie receptors are
           specifically expressed in endothelial cells and
           hematopoietic stem cells. The angiopoietins (Ang-1 to
           Ang-4) serve as ligands for Tie2, while no specific
           ligand has been identified for Tie1. The binding of
           Ang-1 to Tie2 leads to receptor autophosphorylation and
           activation, promoting cell migration and survival. In
           contrast, Ang-2 binding to Tie2 does not result in the
           same response, suggesting that Ang-2 may function as an
           antagonist. In vivo studies of Tie1 show that it is
           critical in vascular development.
          Length = 270

 Score = 43.1 bits (101), Expect = 3e-05
 Identities = 18/36 (50%), Positives = 26/36 (72%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           +P NC D +++LMR+CW+ KP  RP+F +IL  L R
Sbjct: 232 KPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNR 267


>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine
           Kinases, Receptor tyrosine kinase-like Orphan Receptors.
            Protein Tyrosine Kinase (PTK) family; Receptor tyrosine
           kinase-like Orphan Receptor (Ror) subfamily; catalytic
           (c) domain. The Ror subfamily consists of Ror1, Ror2,
           and similar proteins. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Ror proteins are orphan
           receptor tyr kinases (RTKs) containing an extracellular
           region with immunoglobulin-like, cysteine-rich, and
           kringle domains, a transmembrane segment, and an
           intracellular catalytic domain. Ror RTKs are unrelated
           to the nuclear receptor subfamily called
           retinoid-related orphan receptors (RORs). RTKs are
           usually activated through ligand binding, which causes
           dimerization and autophosphorylation of the
           intracellular tyr kinase catalytic domain. Ror kinases
           are expressed in many tissues during development. They
           play important roles in bone and heart formation.
           Mutations in human Ror2 result in two different bone
           development genetic disorders, recessive Robinow
           syndrome and brachydactyly type B. Drosophila Ror is
           expressed only in the developing nervous system during
           neurite outgrowth and neuronal differentiation,
           suggesting a role for Drosophila Ror in neural
           development. More recently, mouse Ror1 and Ror2 have
           also been found to play an important role in regulating
           neurite growth in central neurons. Ror1 and Ror2 are
           believed to have some overlapping and redundant
           functions.
          Length = 283

 Score = 42.8 bits (101), Expect = 5e-05
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 64  ILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           +L  P++CP R++ LM  CW   P  RP F +I
Sbjct: 244 LLPCPEDCPARVYALMIECWNEIPARRPRFKDI 276


>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase,
           Yes.  Protein Tyrosine Kinase (PTK) family; Yes kinase;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Yes (or c-Yes) is a
           member of the Src subfamily of proteins, which are
           cytoplasmic (or non-receptor) tyr kinases. Src kinases
           contain an N-terminal SH4 domain with a myristoylation
           site, followed by SH3 and SH2 domains, a tyr kinase
           domain, and a regulatory C-terminal region containing a
           conserved tyr. They are activated by autophosphorylation
           at the tyr kinase domain, but are negatively regulated
           by phosphorylation at the C-terminal tyr by Csk
           (C-terminal Src Kinase). Src proteins are involved in
           signaling pathways that regulate cytokine and growth
           factor responses, cytoskeleton dynamics, cell
           proliferation, survival, and differentiation. c-Yes
           kinase is the cellular homolog of the oncogenic protein
           (v-Yes) encoded by the Yamaguchi 73 and Esh sarcoma
           viruses. It displays functional overlap with other Src
           subfamily members, particularly Src. It also shows some
           unique functions such as binding to occludins,
           transmembrane proteins that regulate extracellular
           interactions in tight junctions. Yes also associates
           with a number of proteins in different cell types that
           Src does not interact with, like JAK2 and gp130 in
           pre-adipocytes, and Pyk2 in treated pulmonary vein
           endothelial cells. Although the biological function of
           Yes remains unclear, it appears to have a role in
           regulating cell-cell interactions and vesicle
           trafficking in polarized cells.
          Length = 260

 Score = 42.0 bits (98), Expect = 8e-05
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           P  CP+ L  LM+ CW+  P  RPTF  I + LE
Sbjct: 225 PQGCPESLHELMKLCWKKDPDERPTFEYIQSFLE 258


>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine
           Kinases, Bruton's tyrosine kinase and Bone marrow kinase
           on the X chromosome.  Protein Tyrosine Kinase (PTK)
           family; Bruton's tyrosine kinase (Btk) and Bone marrow
           kinase on the X chromosome (Bmx); catalytic (c) domain.
           The PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Btk and
           Bmx (also named Etk) are members of the Tec subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases with similarity to Src kinases in that they
           contain Src homology protein interaction domains (SH3,
           SH2) N-terminal to the catalytic tyr kinase domain.
           Unlike Src kinases, most Tec subfamily members (except
           Rlk) also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. In addition, Btk
           contains the Tec homology (TH) domain with proline-rich
           and zinc-binding regions. Tec kinases are expressed
           mainly by haematopoietic cells. Btk is expressed in
           B-cells, and a variety of myeloid cells including mast
           cells, platelets, neutrophils, and dendrictic cells. It
           interacts with a variety of partners, from cytosolic
           proteins to nuclear transcription factors, suggesting a
           diversity of functions. Stimulation of a diverse array
           of cell surface receptors, including antigen engagement
           of the B-cell receptor (BCR), leads to PH-mediated
           membrane translocation of Btk and subsequent
           phosphorylation by Src kinase and activation. Btk plays
           an important role in the life cycle of B-cells including
           their development, differentiation, proliferation,
           survival, and apoptosis. Mutations in Btk cause the
           primary immunodeficiency disease, X-linked
           agammaglobulinaemia (XLA) in humans. Bmx is primarily
           expressed in bone marrow and the arterial endothelium,
           and plays an important role in ischemia-induced
           angiogenesis. It facilitates arterial growth, capillary
           formation, vessel maturation, and bone marrow-derived
           endothelial progenitor cell mobilization.
          Length = 256

 Score = 41.8 bits (98), Expect = 9e-05
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 9/72 (12%)

Query: 39  WLLGLLR---YVLGKIL------QSTGASMVGGGILVRPDNCPDRLFNLMRRCWQFKPQA 89
           W  G+L    Y LGK+         T   +  G  L RP    ++++ +M  CW  K + 
Sbjct: 185 WAFGVLMWEVYSLGKMPYERFNNSETVEKVSQGLRLYRPHLASEKVYAIMYSCWHEKAEE 244

Query: 90  RPTFMEILADLE 101
           RPTF ++L+ +E
Sbjct: 245 RPTFQQLLSSIE 256


>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase A.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase A
           (TrkA); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkA is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkA
           to its ligand, nerve growth factor (NGF), results in
           receptor oligomerization and activation of the catalytic
           domain. TrkA is expressed mainly in neural-crest-derived
           sensory and sympathetic neurons of the peripheral
           nervous system, and in basal forebrain cholinergic
           neurons of the central nervous system. It is critical
           for neuronal growth, differentiation and survival.
           Alternative TrkA splicing has been implicated as a
           pivotal regulator of neuroblastoma (NB) behavior. Normal
           TrkA expression is associated with better NB prognosis,
           while the hypoxia-regulated TrkAIII splice variant
           promotes NB pathogenesis and progression. Aberrant TrkA
           expression has also been demonstrated in non-neural
           tumors including prostate, breast, lung, and pancreatic
           cancers.
          Length = 280

 Score = 41.5 bits (97), Expect = 1e-04
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           L RP  CP  ++ +M+ CWQ +PQ R    +I + L+ 
Sbjct: 243 LERPRTCPPEVYAIMQGCWQREPQQRMVIKDIHSRLQA 280


>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine
           Kinase, Discoidin Domain Receptor 2.  Protein Tyrosine
           Kinase (PTK) family; mammalian Discoidin Domain Receptor
           2 (DDR2) and homologs; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. DDR2 is a
           member of the DDR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular discoidin
           homology domain, a transmembrane segment, an extended
           juxtamembrane region, and an intracellular catalytic
           domain. The binding of the ligand, collagen, to DDRs
           results in a slow but sustained receptor activation.
           DDR2 binds mostly to fibrillar collagens. More recently,
           it has been reported to also bind collagen X. DDR2 is
           widely expressed in many tissues with the highest levels
           found in skeletal muscle, skin, kidney and lung. It is
           important in cell proliferation and development. Mice,
           with a deletion of DDR2, suffer from dwarfism and
           delayed healing of epidermal wounds. DDR2 also
           contributes to collagen (type I) regulation by
           inhibiting fibrillogenesis and altering the morphology
           of collagen fibers. It is also expressed in immature
           dendritic cells (DCs), where it plays a role in DC
           activation and function.
          Length = 296

 Score = 41.0 bits (96), Expect = 2e-04
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           L +P  CPD L+ LM  CW+   + RP+F EI A L
Sbjct: 259 LPKPALCPDSLYKLMLSCWRRNAKERPSFQEIHATL 294


>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine
           Kinases, Tyrosine kinase expressed in hepatocellular
           carcinoma and Resting lymphocyte kinase.  Protein
           Tyrosine Kinase (PTK) family; Tyrosine kinase expressed
           in hepatocellular carcinoma (Tec) and Resting lymphocyte
           kinase (Rlk); catalytic (c) domain. The PTKc family is
           part of a larger superfamily, that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Tec and
           Rlk (also named Txk) are members of the Tec subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases with similarity to Src kinases in that they
           contain Src homology protein interaction domains (SH3,
           SH2) N-terminal to the catalytic tyr kinase domain.
           Unlike Src kinases, most Tec subfamily members (except
           Rlk) also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. Instead of PH, Rlk
           contains an N-terminal cysteine-rich region. In addition
           to PH, Tec also contains the Tec homology (TH) domain
           with proline-rich and zinc-binding regions. Tec kinases
           are expressed mainly by haematopoietic cells. Tec is
           more widely-expressed than other Tec subfamily kinases.
           It is found in endothelial cells, both B- and T-cells,
           and a variety of myeloid cells including mast cells,
           erythroid cells, platelets, macrophages and neutrophils.
           Rlk is expressed in T-cells and mast cell lines. Tec and
           Rlk are both key components of T-cell receptor (TCR)
           signaling. They are important in TCR-stimulated
           proliferation, IL-2 production and phopholipase C-gamma1
           activation.
          Length = 256

 Score = 40.6 bits (95), Expect = 2e-04
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEIL 97
           G  L RP      ++ +M  CW  KP+ RPTF E+L
Sbjct: 217 GFRLYRPKLASMTVYEVMYSCWHEKPEGRPTFAELL 252


>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine
           Kinase, Receptor tyrosine kinase-like Orphan Receptor 1.
            Protein Tyrosine Kinase (PTK) family; Receptor tyrosine
           kinase-like Orphan Receptor 1 (Ror1); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ror
           proteins are orphan receptor tyr kinases (RTKs)
           containing an extracellular region with
           immunoglobulin-like, cysteine-rich, and kringle domains,
           a transmembrane segment, and an intracellular catalytic
           domain. Ror RTKs are unrelated to the nuclear receptor
           subfamily called retinoid-related orphan receptors
           (RORs). RTKs are usually activated through ligand
           binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain. Ror kinases are expressed in many
           tissues during development. Avian Ror1 was found to be
           involved in late limb development. Studies in mice
           reveal that Ror1 is important in the regulation of
           neurite growth in central neurons, as well as in
           respiratory development. Loss of Ror1 also enhances the
           heart and skeletal abnormalities found in Ror2-deficient
           mice.
          Length = 283

 Score = 40.8 bits (95), Expect = 2e-04
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
            ++CP R+++LM  CWQ  P  RP F +I
Sbjct: 248 SEDCPPRMYSLMTECWQEGPSRRPRFKDI 276


>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine
           Kinase, Colony-Stimulating Factor-1 Receptor.  Protein
           Tyrosine Kinase (PTK) family; Colony-Stimulating
           Factor-1 Receptor (CSF-1R); catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. CSF-1R,
           also called c-Fms, is a member of the Platelet Derived
           Growth Factor Receptor (PDGFR) subfamily of proteins,
           which are receptor tyr kinases (RTKs) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding of
           CSF-1R to its ligand, CSF-1, leads to receptor
           dimerization, trans phosphorylation and activation, and
           intracellular signaling. CSF-1R signaling is critical in
           the regulation of macrophages and osteoclasts. It leads
           to increases in gene transcription and protein
           translation, and induces cytoskeletal remodeling. CSF-1R
           signaling leads to a variety of cellular responses
           including survival, proliferation, and differentiation
           of target cells. It plays an important role in innate
           immunity, tissue development and function, and the
           pathogenesis of some diseases including atherosclerosis
           and cancer. CSF-1R signaling is also implicated in
           mammary gland development during pregnancy and
           lactation. Aberrant CSF-1/CSF-1R expression correlates
           with tumor cell invasiveness, poor clinical prognosis,
           and bone metastasis in breast cancer. Although the
           structure of the human CSF-1R catalytic domain is known,
           it is excluded from this specific alignment model
           because it contains a deletion in its sequence.
          Length = 374

 Score = 39.8 bits (93), Expect = 5e-04
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 58  SMVGGGI-LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
            MV  G  + RPD  P  ++++M+ CW  +P  RPTF +I   ++R +
Sbjct: 326 KMVKRGYQMSRPDFAPPEIYSIMKMCWNLEPTERPTFSQISQLIQRQL 373


>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase,
           Spleen tyrosine kinase.  Protein Tyrosine Kinase (PTK)
           family; Spleen tyrosine kinase (Syk); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Syk,
           together with Zap-70, form the Syk subfamily of kinases
           which are cytoplasmic (or nonreceptor) tyr kinases
           containing two Src homology 2 (SH2) domains N-terminal
           to the catalytic tyr kinase domain. Syk was first cloned
           from the spleen, and its function in hematopoietic cells
           is well-established. Syk is involved in the signaling
           downstream of activated receptors (including B-cell and
           Fc receptors) that contain ITAMs (immunoreceptor tyr
           activation motifs), leading to processes such as cell
           proliferation, differentiation, survival, adhesion,
           migration, and phagocytosis. More recently, Syk
           expression has been detected in other cell types
           (including epithelial cells, vascular endothelial cells,
           neurons, hepatocytes, and melanocytes), suggesting a
           variety of biological functions in non-immune cells. Syk
           plays a critical role in maintaining vascular integrity
           and in wound healing during embryogenesis. It also
           regulates Vav3, which is important in osteoclast
           function including bone development. In breast
           epithelial cells, where Syk acts as a negative regulator
           for epidermal growth factor receptor (EGFR) signaling,
           loss of Syk expression is associated with abnormal
           proliferation during cancer development suggesting a
           potential role as a tumor suppressor. In mice, Syk has
           been shown to inhibit malignant transformation of
           mammary epithelial cells induced with murine mammary
           tumor virus (MMTV).
          Length = 257

 Score = 39.6 bits (92), Expect = 5e-04
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTF 93
           P  CP  +++LM+ CW +    RP F
Sbjct: 220 PQRCPPEMYDLMKLCWTYGVDERPGF 245


>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine
           Kinases, Srm and Brk.  Protein Tyrosine Kinase (PTK)
           family; Src-related kinase lacking C-terminal regulatory
           tyrosine and N-terminal myristylation sites (Srm) and
           breast tumor kinase (Brk, also called protein tyrosine
           kinase 6); catalytic (c) domains. The PTKc family is
           part of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Srm and
           Brk are a member of the Src subfamily of proteins, which
           are cytoplasmic (or non-receptor) tyr kinases. Src
           kinases in general contain an N-terminal SH4 domain with
           a myristoylation site, followed by SH3 and SH2 domains,
           a tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr; they are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). Srm and
           Brk however, lack the N-terminal myristylation sites.
           Src proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Brk has been found to be overexpressed
           in a majority of breast tumors.
          Length = 261

 Score = 39.0 bits (91), Expect = 7e-04
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTF 93
           +  P  CP  ++ +M  CW  +P+ RP+F
Sbjct: 223 MPCPAKCPQEIYKIMLECWAAEPEDRPSF 251


>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase,
           Src.  Protein Tyrosine Kinase (PTK) family; Src kinase;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Src (or c-Src) is a
           cytoplasmic (or non-receptor) tyr kinase, containing an
           N-terminal SH4 domain with a myristoylation site,
           followed by SH3 and SH2 domains, a tyr kinase domain,
           and a regulatory C-terminal region with a conserved tyr.
           It is activated by autophosphorylation at the tyr kinase
           domain, and is negatively regulated by phosphorylation
           at the C-terminal tyr by Csk (C-terminal Src Kinase).
           c-Src is the vertebrate homolog of the oncogenic protein
           (v-Src) from Rous sarcoma virus. Together with other Src
           subfamily proteins, it is involved in signaling pathways
           that regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Src also play a role in regulating cell
           adhesion, invasion, and motility in cancer cells and
           tumor vasculature, contributing to cancer progression
           and metastasis. Elevated levels of Src kinase activity
           have been reported in a variety of human cancers.
           Several inhibitors of Src have been developed as
           anti-cancer drugs. Src is also implicated in acute
           inflammatory responses and osteoclast function.
          Length = 262

 Score = 38.9 bits (90), Expect = 7e-04
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           P  CP+ L +LM +CW+ +P+ RPTF  + A LE
Sbjct: 225 PPECPESLHDLMCQCWRKEPEERPTFEYLQAFLE 258


>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase C.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase C
           (TrkC); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkC is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkC
           to its ligand, neurotrophin 3 (NT3), results in receptor
           oligomerization and activation of the catalytic domain.
           TrkC is broadly expressed in the nervous system and in
           some non-neural tissues including the developing heart.
           NT3/TrkC signaling plays an important role in the
           innervation of the cardiac conducting system and the
           development of smooth muscle cells. Mice deficient with
           NT3 and TrkC have multiple heart defects. NT3/TrkC
           signaling is also critical for the development and
           maintenance of enteric neurons that are important for
           the control of gut peristalsis.
          Length = 291

 Score = 38.4 bits (89), Expect = 0.001
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           G +L RP  CP  ++++M  CWQ +PQ R    EI
Sbjct: 241 GRVLERPRVCPKEVYDIMLGCWQREPQQRLNIKEI 275


>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine
           Kinase, Ephrin Receptor A10.  Protein Tyrosine Kinase
           (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10
           receptor; catalytic (c) domain. The PTKc family is part
           of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. EphRs
           comprise the largest subfamily of receptor tyr kinases
           (RTKs). In general, class EphA receptors bind
           GPI-anchored ephrin-A ligands. There are ten vertebrate
           EphA receptors (EphA1-10), which display promiscuous
           interactions with six ephrin-A ligands. EphRs contain an
           ephrin binding domain and two fibronectin repeats
           extracellularly, a transmembrane segment, and a
           cytoplasmic tyr kinase domain. Binding of the ephrin
           ligand to EphR requires cell-cell contact since both are
           anchored to the plasma membrane. The resulting
           downstream signals occur bidirectionally in both
           EphR-expressing cells (forward signaling) and
           ephrin-expressing cells (reverse signaling). EphA10,
           which contains an inactive tyr kinase domain, may
           function to attenuate signals of co-clustered active
           receptors. EphA10 is mainly expressed in the testis.
           Ephrin/EphR interaction results in cell-cell repulsion
           or adhesion, making it important in neural development
           and plasticity, cell morphogenesis, cell-fate
           determination, embryonic development, tissue patterning,
           and angiogenesis.
          Length = 266

 Score = 38.4 bits (89), Expect = 0.001
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
           P NCP+ L  LM  CWQ +   RP F +I + L + +
Sbjct: 230 PRNCPNLLHQLMLDCWQKERGERPRFSQIHSILSKMV 266


>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Platelet Derived Growth Factor Receptors.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) subfamily; catalytic (c)
           domain. The PDGFR subfamily consists of PDGFR alpha,
           PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           PDGFR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           five immunoglobulin-like domains, a transmembrane
           segment, and an intracellular catalytic domain. PDGFR
           kinase domains are autoinhibited by their juxtamembrane
           regions containing tyr residues. The binding to their
           ligands leads to receptor dimerization, trans
           phosphorylation and activation, and intracellular
           signaling. PDGFR subfamily receptors are important in
           the development of a variety of cells. PDGFRs are
           expressed in a many cells including fibroblasts,
           neurons, endometrial cells, mammary epithelial cells,
           and vascular smooth muscle cells. PDGFR signaling is
           critical in normal embryonic development, angiogenesis,
           and wound healing. PDGFRs transduce mitogenic signals
           for connective tissue cells and are important for cell
           shape and motility. Kit is important in the development
           of melanocytes, germ cells, mast cells, hematopoietic
           stem cells, the interstitial cells of Cajal, and the
           pacemaker cells of the GI tract. CSF-1R signaling is
           critical in the regulation of macrophages and
           osteoclasts. Mammalian FLT3 plays an important role in
           the survival, proliferation, and differentiation of stem
           cells.
          Length = 302

 Score = 38.2 bits (89), Expect = 0.001
 Identities = 11/32 (34%), Positives = 21/32 (65%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           + +P++ P  ++++M+ CW   P  RPTF +I
Sbjct: 263 MAQPEHAPAEIYDIMKTCWDADPLKRPTFKQI 294


>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor alpha.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) alpha; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           alpha is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR alpha forms homodimers or heterodimers
           with PDGFR beta, depending on the nature of the PDGF
           ligand. PDGF-AA, PDGF-AB, and PDGF-CC induce PDGFR alpha
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           alpha signaling is important in the formation of lung
           alveoli, intestinal villi, mesenchymal dermis, and hair
           follicles, as well as in the development of
           oligodendrocytes, retinal astrocytes, neural crest
           cells, and testicular cells. Aberrant PDGFR alpha
           expression is associated with some human cancers.
           Mutations in PDGFR alpha have been found within a subset
           of gastrointestinal stromal tumors (GISTs). An active
           fusion protein FIP1L1-PDGFR alpha, derived from
           interstitial deletion, is associated with idiopathic
           hypereosinophilic syndrome (HES) and chronic
           eosinophilic leukemia (CEL).
          Length = 400

 Score = 38.5 bits (89), Expect = 0.002
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 49  GKILQSTGASMVGGGI-LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           G I+ ST  + +  G  + +PD+    ++++M +CW  +P+ RP+F+ +
Sbjct: 342 GMIVDSTFYNKIKSGYRMAKPDHATQEVYDIMVKCWNSEPEKRPSFLHL 390


>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine
           Kinase, Vascular Endothelial Growth Factor Receptor 3.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR3 (or Flt4) is a member of the VEGFR subfamily of
           proteins, which are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. In
           VEGFR3, the fifth Ig-like domain is replaced by a
           disulfide bridge. The binding of VEGFRs to their
           ligands, the VEGFs, leads to receptor dimerization,
           activation, and intracellular signaling. VEGFR3
           preferentially binds the ligands VEGFC and VEGFD. VEGFR3
           is essential for lymphatic endothelial cell (EC)
           development and function. It has been shown to regulate
           adaptive immunity during corneal transplantation. VEGFR3
           is upregulated on blood vascular ECs in pathological
           conditions such as vascular tumors and the periphery of
           solid tumors. It plays a role in cancer progression and
           lymph node metastasis. Missense mutations in the VEGFR3
           gene are associated with primary human lymphedema.
          Length = 338

 Score = 37.7 bits (87), Expect = 0.002
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTF---MEILADL 100
           P+N    ++ +M  CWQ  P+ RPTF   +EIL DL
Sbjct: 299 PENATPEIYRIMLACWQGDPKERPTFSALVEILGDL 334


>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine
           Kinase, HER2.  Protein Tyrosine Kinase (PTK) family;
           HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. HER2 is a
           member of the EGFR (HER, ErbB) subfamily of proteins,
           which are receptor tyr kinases (RTKs) containing an
           extracellular EGF-related ligand-binding region, a
           transmembrane helix, and a cytoplasmic region with a tyr
           kinase domain and a regulatory C-terminal tail. Unlike
           other tyr kinases, phosphorylation of the activation
           loop of EGFR proteins is not critical to their
           activation. Instead, they are activated by
           ligand-induced dimerization, leading to the
           phosphorylation of tyr residues in the C-terminal tail,
           which serve as binding sites for downstream signaling
           molecules. HER2 does not bind to any known EGFR
           subfamily ligands, but contributes to the kinase
           activity of all possible heterodimers. It acts as the
           preferred partner with other ligand-bound EGFR proteins
           and functions as a signal amplifier, with the HER2-HER3
           heterodimer being the most potent pair in mitogenic
           signaling. HER2 plays an important role in cell
           development, proliferation, survival and motility.
           Overexpression of HER2 results in its activation and
           downstream signaling, even in the absence of ligand.
           HER2 overexpression, mainly due to gene amplification,
           has been shown in a variety of human cancers. Its role
           in breast cancer is especially well-documented. HER2 is
           up-regulated in about 25% of breast tumors and is
           associated with increases in tumor aggressiveness,
           recurrence and mortality. HER2 is a target for
           monoclonal antibodies and small molecule inhibitors,
           which are being developed as treatments for cancer. The
           first humanized antibody approved for clinical use is
           Trastuzumab (Herceptin), which is being used in
           combination with other therapies to improve the survival
           rates of patients with HER2-overexpressing breast
           cancer.
          Length = 279

 Score = 37.7 bits (87), Expect = 0.002
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L +P  C   ++ +M +CW    + RP F E++ +  R
Sbjct: 227 GERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVDEFSR 267


>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine
           Kinase, Discoidin Domain Receptor 1.  Protein Tyrosine
           Kinase (PTK) family; mammalian Discoidin Domain Receptor
           1 (DDR1) and homologs; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. DDR1 is a
           member of the DDR subfamily, which are receptor tyr
           kinases (RTKs) containing an extracellular discoidin
           homology domain, a transmembrane segment, an extended
           juxtamembrane region, and an intracellular catalytic
           domain. The binding of the ligand, collagen, to DDRs
           results in a slow but sustained receptor activation.
           DDR1 binds to all collagens tested to date (types I-IV).
           It is widely expressed in many tissues. It is abundant
           in the brain and is also found in keratinocytes, colonic
           mucosa epithelium, lung epithelium, thyroid follicles,
           and the islets of Langerhans. During embryonic
           development, it is found in the developing
           neuroectoderm. DDR1 is a key regulator of cell
           morphogenesis, differentiation and proliferation. It is
           important in the development of the mammary gland, the
           vasculator and the kidney. DDR1 is also found in human
           leukocytes, where it facilitates cell adhesion,
           migration, maturation, and cytokine production.
          Length = 304

 Score = 37.6 bits (87), Expect = 0.002
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           L RP  CP  L+ LM +CW    + RP+F +I
Sbjct: 267 LFRPPPCPQGLYELMLQCWSRDCRERPSFSDI 298


>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase,
           Kit.  Protein Tyrosine Kinase (PTK) family; Kit (or
           c-Kit); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. Kit is a member of the
           Platelet Derived Growth Factor Receptor (PDGFR)
           subfamily of proteins, which are receptor tyr kinases
           (RTKs) containing an extracellular ligand-binding region
           with five immunoglobulin-like domains, a transmembrane
           segment, and an intracellular catalytic domain. The
           binding of Kit to its ligand, the stem-cell factor
           (SCF), leads to receptor dimerization, trans
           phosphorylation and activation, and intracellular
           signaling. Kit is important in the development of
           melanocytes, germ cells, mast cells, hematopoietic stem
           cells, the interstitial cells of Cajal, and the
           pacemaker cells of the GI tract. Kit signaling is
           involved in major cellular functions including cell
           survival, proliferation, differentiation, adhesion, and
           chemotaxis. Mutations in Kit, which result in
           constitutive ligand-independent activation, are found in
           human cancers such as gastrointestinal stromal tumor
           (GIST) and testicular germ cell tumor (TGCT). The
           aberrant expression of Kit and/or SCF is associated with
           other tumor types such as systemic mastocytosis and
           cancers of the breast, neurons, lung, prostate, colon,
           and rectum.  Although the structure of the human Kit
           catalytic domain is known, it is excluded from this
           specific alignment model because it contains a deletion
           in its sequence.
          Length = 375

 Score = 37.6 bits (87), Expect = 0.002
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
           P+  P  ++++M+ CW   P  RPTF +I+  +E+ +
Sbjct: 339 PECAPSEMYDIMKSCWDADPLKRPTFKQIVQLIEQQL 375


>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine
           Kinase, Receptor tyrosine kinase-like Orphan Receptor 2.
            Protein Tyrosine Kinase (PTK) family; Receptor tyrosine
           kinase-like Orphan Receptor 2 (Ror2); catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Ror
           proteins are orphan receptor tyr kinases (RTKs)
           containing an extracellular region with
           immunoglobulin-like, cysteine-rich, and kringle domains,
           a transmembrane segment, and an intracellular catalytic
           domain. Ror RTKs are unrelated to the nuclear receptor
           subfamily called retinoid-related orphan receptors
           (RORs). RTKs are usually activated through ligand
           binding, which causes dimerization and
           autophosphorylation of the intracellular tyr kinase
           catalytic domain. Ror2 plays important roles in skeletal
           and heart formation. Ror2-deficient mice show widespread
           bone abnormalities, ventricular defects in the heart,
           and respiratory dysfunction. Mutations in human Ror2
           result in two different bone development genetic
           disorders, recessive Robinow syndrome and brachydactyly
           type B. Ror2 is also implicated in neural development.
          Length = 283

 Score = 37.3 bits (86), Expect = 0.003
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 64  ILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           +L  PD+CP  ++ LM  CW   P  RP F +I
Sbjct: 244 VLPCPDDCPAWVYTLMLECWNEFPSRRPRFKDI 276


>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase,
           Interleukin-2-inducible T-cell Kinase.  Protein Tyrosine
           Kinase (PTK) family; Interleukin-2 (IL-2)-inducible
           T-cell kinase (Itk); catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Itk (also
           known as Tsk or Emt) is a member of the Tec subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases with similarity to Src kinases in that they
           contain Src homology protein interaction domains (SH3,
           SH2) N-terminal to the catalytic tyr kinase domain.
           Unlike Src kinases, most Tec subfamily members (except
           Rlk) also contain an N-terminal pleckstrin homology (PH)
           domain, which binds the products of PI3K and allows
           membrane recruitment and activation. In addition, Itk
           contains the Tec homology (TH) domain containing one
           proline-rich region and a zinc-binding region. Tec
           kinases are expressed mainly by haematopoietic cells.
           Itk is expressed in T-cells and mast cells, and is
           important in their development and differentiation. Of
           the three Tec kinases expressed in T-cells, Itk plays
           the predominant role in T-cell receptor (TCR) signaling.
           It is activated by phosphorylation upon TCR crosslinking
           and is involved in the pathway resulting in
           phospholipase C-gamma1 activation and actin
           polymerization. It also plays a role in the downstream
           signaling of the T-cell costimulatory receptor CD28, the
           T-cell surface receptor CD2, and the chemokine receptor
           CXCR4. In addition, Itk is crucial for the development
           of T-helper(Th)2 effector responses.
          Length = 256

 Score = 37.2 bits (86), Expect = 0.003
 Identities = 12/36 (33%), Positives = 21/36 (58%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           L +P      ++ LM+ CW+ +P+ RP+F  +L  L
Sbjct: 220 LYKPRLASQSVYELMQHCWKERPEDRPSFSLLLHQL 255


>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine
           Kinases, Fyn and Yrk.  Protein Tyrosine Kinase (PTK)
           family; Fyn and Yrk kinases; catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Fyn and
           Yrk are members of the Src subfamily of proteins, which
           are cytoplasmic (or non-receptor) tyr kinases. Src
           kinases contain an N-terminal SH4 domain with a
           myristoylation site, followed by SH3 and SH2 domains, a
           tyr kinase domain, and a regulatory C-terminal region
           containing a conserved tyr. They are activated by
           autophosphorylation at the tyr kinase domain, but are
           negatively regulated by phosphorylation at the
           C-terminal tyr by Csk (C-terminal Src Kinase). Src
           proteins are involved in signaling pathways that
           regulate cytokine and growth factor responses,
           cytoskeleton dynamics, cell proliferation, survival, and
           differentiation. Fyn, together with Lck, plays a
           critical role in T-cell signal transduction by
           phosphorylating ITAM (immunoreceptor tyr activation
           motif) sequences on T-cell receptors, ultimately leading
           to the proliferation and differentiation of T-cells. In
           addition, Fyn is involved in the myelination of neurons,
           and is implicated in Alzheimer's and Parkinson's
           diseases. Yrk has been detected only in chickens. It is
           primarily found in neuronal and epithelial cells and in
           macrophages. It may play a role in inflammation and in
           response to injury.
          Length = 260

 Score = 37.3 bits (86), Expect = 0.003
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLE 101
           P +CP  L  LM +CW+  P+ RPTF  + + LE
Sbjct: 225 PQDCPISLHELMLQCWKKDPEERPTFEYLQSFLE 258


>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine
           Kinase, Tropomyosin Related Kinase B.  Protein Tyrosine
           Kinase (PTK) family; Tropomyosin Related Kinase B
           (TrkB); catalytic (c) domain. The PTKc family is part of
           a larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. TrkB is a member of the
           Trk subfamily of proteins, which are receptor tyr
           kinases (RTKs) containing an extracellular region with
           arrays of leucine-rich motifs flanked by two
           cysteine-rich clusters followed by two
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. Binding of TrkB
           to its ligands, brain-derived neurotrophic factor (BDNF)
           or neurotrophin 4 (NT4), results in receptor
           oligomerization and activation of the catalytic domain.
           TrkB is broadly expressed in the nervous system and in
           some non-neural tissues. It plays important roles in
           cell proliferation, differentiation, and survival.
           BDNF/Trk signaling plays a key role in regulating
           activity-dependent synaptic plasticity. TrkB also
           contributes to protection against gp120-induced neuronal
           cell death. TrkB overexpression is associated with poor
           prognosis in neuroblastoma (NB) and other human cancers.
           It acts as a suppressor of anoikis (detachment-induced
           apoptosis) and contributes to tumor metastasis.
          Length = 288

 Score = 37.0 bits (85), Expect = 0.004
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAAS 107
           G +L RP  CP  +++LM  CWQ +P  R    EI + L+    AS
Sbjct: 238 GRVLQRPRTCPKEVYDLMLGCWQREPHMRLNIKEIHSLLQNLAKAS 283


>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine
           Kinases, Class EphB Ephrin Receptors.  Protein Tyrosine
           Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
           class EphB receptors; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. EphRs
           comprise the largest subfamily of receptor tyr kinases
           (RTKs). Class EphB receptors bind to transmembrane
           ephrin-B ligands. There are six vertebrate EhpB
           receptors (EphB1-6), which display promiscuous
           interactions with three ephrin-B ligands. One exception
           is EphB2, which also interacts with ephrin A5. EphRs
           contain an ephrin-binding domain and two fibronectin
           repeats extracellularly, a transmembrane segment, and a
           cytoplasmic tyr kinase domain. Binding of the ephrin
           ligand to EphR requires cell-cell contact since both are
           anchored to the plasma membrane. The resulting
           downstream signals occur bidirectionally in both
           EphR-expressing cells (forward signaling) and
           ephrin-expressing cells (reverse signaling). Ephrin/EphR
           interaction mainly results in cell-cell repulsion or
           adhesion. EphBRs play important roles in synapse
           formation and plasticity, spine morphogenesis, axon
           guidance, and angiogenesis. In the intestinal
           epithelium, EphBRs are Wnt signaling target genes that
           control cell compartmentalization. They function as
           suppressors of color cancer progression.
          Length = 269

 Score = 36.8 bits (85), Expect = 0.004
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
           P +CP  L  LM  CWQ    ARP F +I++ L++ I
Sbjct: 233 PMDCPTALHQLMLDCWQKDRNARPKFGQIVSTLDKMI 269


>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine
           Kinase, Zeta-chain-associated protein of 70kDa.  Protein
           Tyrosine Kinase (PTK) family; Zeta-chain-associated
           protein of 70kDa (Zap-70); catalytic (c) domain. The
           PTKc family is part of a larger superfamily that
           includes the catalytic domains of other kinases such as
           protein serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Zap-70 is
           a member of the Syk subfamily of kinases, which are
           cytoplasmic (or nonreceptor) tyr kinases containing two
           Src homology 2 (SH2) domains N-terminal to the catalytic
           tyr kinase domain. Zap-70 is primarily expressed in
           T-cells and NK cells, and is a crucial component in
           T-cell receptor (TCR) signaling. Zap-70 binds the
           phosphorylated ITAM (immunoreceptor tyr activation
           motif) sequences of the activated TCR zeta-chain through
           its SH2 domains, leading to its phosphorylation and
           activation. It then phosphorylates target proteins,
           which propagate the signals to downstream pathways.
           Zap-70 is hardly detected in normal peripheral B-cells,
           but is present in some B-cell malignancies. It is used
           as a diagnostic marker for chronic lymphocytic leukemia
           (CLL) as it is associated with the more aggressive
           subtype of the disease.
          Length = 257

 Score = 36.9 bits (85), Expect = 0.004
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 61  GGGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
            G  L  P  CP  ++ LM+ CW +K + RP F ++
Sbjct: 213 QGKRLDCPAECPPEMYALMKDCWIYKWEDRPNFAKV 248


>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine
           Kinase, Ephrin Receptor A2.  Protein Tyrosine Kinase
           (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2
           receptor; catalytic (c) domain. The PTKc family is part
           of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. EphRs
           comprise the largest subfamily of receptor tyr kinases
           (RTKs). In general, class EphA receptors bind
           GPI-anchored ephrin-A ligands. There are ten vertebrate
           EphA receptors (EphA1-10), which display promiscuous
           interactions with six ephrin-A ligands. EphRs contain an
           ephrin binding domain and two fibronectin repeats
           extracellularly, a transmembrane segment, and a
           cytoplasmic tyr kinase domain. Binding of the ephrin
           ligand to EphR requires cell-cell contact since both are
           anchored to the plasma membrane. The resulting
           downstream signals occur bidirectionally in both
           EphR-expressing cells (forward signaling) and
           ephrin-expressing cells (reverse signaling). Ephrin/EphR
           interaction mainly results in cell-cell repulsion or
           adhesion, making it important in neural development and
           plasticity, cell morphogenesis, cell-fate determination,
           embryonic development, tissue patterning, and
           angiogenesis. The EphA2 receptor is overexpressed in
           tumor cells and tumor blood vessels in a variety of
           cancers including breast, prostate, lung, and colon. As
           a result, it is an attractive target for drug design
           since its inhibition could affect several aspects of
           tumor progression.
          Length = 268

 Score = 36.5 bits (84), Expect = 0.005
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           L  P +CP  ++ LM +CWQ     RP F++I+  L++
Sbjct: 229 LPAPMDCPSAVYQLMLQCWQQDRARRPRFVDIVNLLDK 266


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 36.4 bits (85), Expect = 0.006
 Identities = 7/33 (21%), Positives = 12/33 (36%)

Query: 67  RPDNCPDRLFNLMRRCWQFKPQARPTFMEILAD 99
              +      +L+R+     P+ R T  E L  
Sbjct: 219 PEWDISPEAKDLIRKLLVKDPEKRLTAEEALQH 251


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 36.1 bits (84), Expect = 0.007
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 73  DRLFNLMRRCWQFKPQARPTFMEILADL 100
             L +L+R+  Q  P+ RP+  EIL  L
Sbjct: 188 PELKDLIRKMLQKDPEKRPSAKEILEHL 215


>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the
           Protein Tyrosine Kinases, Janus kinases.  Protein
           Tyrosine Kinase (PTK) family; Janus kinase (Jak)
           subfamily; pseudokinase domain (repeat1). The Jak
           subfamily is composed of Jak1, Jak2, Jak3, TYK2, and
           similar proteins. The PTKc (catalytic domain) family to
           which this subfamily belongs, is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           Jak subfamily proteins are cytoplasmic (or nonreceptor)
           tyr kinases containing an N-terminal FERM domain,
           followed by a Src homology 2 (SH2) domain, a
           pseudokinase domain, and a C-terminal catalytic tyr
           kinase domain. The pseudokinase domain shows similarity
           to tyr kinases but lacks crucial residues for catalytic
           activity and ATP binding. It modulates the kinase
           activity of the C-terminal catalytic domain. Most Jaks
           are expressed in a wide variety of tissues, except for
           Jak3, which is expressed only in hematopoietic cells.
           Jaks are crucial for cytokine receptor signaling. They
           are activated by autophosphorylation upon
           cytokine-induced receptor aggregation, and subsequently
           trigger downstream signaling events such as the
           phosphorylation of signal transducers and activators of
           transcription (STATs). Jaks are also involved in
           regulating the surface expression of some cytokine
           receptors. The Jak-STAT pathway is involved in many
           biological processes including hematopoiesis,
           immunoregulation, host defense, fertility, lactation,
           growth, and embryogenesis.
          Length = 259

 Score = 35.9 bits (83), Expect = 0.008
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
              L  PD     L NL+ +CW + P  RP+F  IL DL
Sbjct: 222 QHRLPMPDCAE--LANLINQCWTYDPTKRPSFRAILRDL 258


>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine
           Kinases, Class EphA Ephrin Receptors.  Protein Tyrosine
           Kinase (PTK) family; Ephrin Receptor (EphR) subfamily;
           most class EphA receptors including EphA3, EphA4, EphA5,
           and EphA7, but excluding EphA1, EphA2 and EphA10;
           catalytic (c) domain. The PTKc family is part of a
           larger superfamily that includes the catalytic domains
           of other kinases such as protein serine/threonine
           kinases, RIO kinases, and phosphoinositide 3-kinase
           (PI3K). PTKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to tyrosine (tyr)
           residues in protein substrates. EphRs comprise the
           largest subfamily of receptor tyr kinases (RTKs). In
           general, class EphA receptors bind GPI-anchored ephrin-A
           ligands. There are ten vertebrate EphA receptors
           (EphA1-10), which display promiscuous interactions with
           six ephrin-A ligands. One exception is EphA4, which also
           binds ephrins-B2/B3. EphRs contain an ephrin-binding
           domain and two fibronectin repeats extracellularly, a
           transmembrane segment, and a cytoplasmic tyr kinase
           domain. Binding of the ephrin ligand to EphR requires
           cell-cell contact since both are anchored to the plasma
           membrane. The resulting downstream signals occur
           bidirectionally in both EphR-expressing cells (forward
           signaling) and ephrin-expressing cells (reverse
           signaling). Ephrin/EphR interaction mainly results in
           cell-cell repulsion or adhesion, making it important in
           neural development and plasticity, cell morphogenesis,
           cell-fate determination, embryonic development, tissue
           patterning, and angiogenesis. EphARs and ephrin-A
           ligands are expressed in multiple areas of the
           developing brain, especially in the retina and tectum.
           They are part of a system controlling retinotectal
           mapping.
          Length = 267

 Score = 36.0 bits (83), Expect = 0.008
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDI 104
           P +CP  L  LM  CWQ     RP F +I++ L++ I
Sbjct: 231 PMDCPAALHQLMLDCWQKDRNERPKFEQIVSILDKLI 267


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 35.7 bits (83), Expect = 0.009
 Identities = 9/32 (28%), Positives = 15/32 (46%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILAD 99
             +  +   +L+++C    P  RPT  EIL  
Sbjct: 226 WSSGSEEAKDLIKKCLNKDPSKRPTAEEILQH 257


>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain
           Receptor-like Protein Tyrosine Kinases.  Protein
           Tyrosine Kinase (PTK) family; Discoidin Domain Receptor
           (DDR)-like proteins; catalytic (c) domain. The PTKc
           family is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. DDR-like
           proteins are members of the DDR subfamily, which are
           receptor tyr kinases (RTKs) containing an extracellular
           discoidin homology domain, a transmembrane segment, an
           extended juxtamembrane region, and an intracellular
           catalytic domain. The binding of the ligand, collagen,
           to DDRs results in a slow but sustained receptor
           activation. DDRs regulate cell adhesion, proliferation,
           and extracellular matrix remodeling. They have been
           linked to a variety of human cancers including breast,
           colon, ovarian, brain, and lung. There is no evidence
           showing that DDRs act as transforming oncogenes. They
           are more likely to play a role in the regulation of
           tumor growth and metastasis.
          Length = 295

 Score = 35.0 bits (80), Expect = 0.016
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEI 96
           L +   CP  +F LM RCW    + RPTF +I
Sbjct: 258 LSQTPLCPSPVFKLMMRCWSRDIKDRPTFNKI 289


>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth
           Factor Receptor-like Protein Tyrosine Kinases.  Protein
           Tyrosine Kinase (PTK) family; Epidermal Growth Factor
           Receptor (EGFR) subfamily; catalytic (c) domain. EGFR
           (HER, ErbB) subfamily members include EGFR (HER1,
           ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and
           similar proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           The EGFR proteins are receptor tyr kinases (RTKs)
           containing an extracellular EGF-related ligand-binding
           region, a transmembrane helix, and a cytoplasmic region
           with a tyr kinase domain and a regulatory C-terminal
           tail. Unlike other tyr kinases, phosphorylation of the
           activation loop of EGFR proteins is not critical to
           their activation. Instead, they are activated by
           ligand-induced dimerization, resulting in the
           phosphorylation of tyr residues in the C-terminal tail,
           which serve as binding sites for downstream signaling
           molecules. Collectively, they can recognize a variety of
           ligands including EGF, TGFalpha, and neuregulins, among
           others. All four subfamily members can form homo- or
           heterodimers. HER3 contains an impaired kinase domain
           and depends on its heterodimerization partner for
           activation. EGFR subfamily members are involved in
           signaling pathways leading to a broad range of cellular
           responses including cell proliferation, differentiation,
           migration, growth inhibition, and apoptosis. Gain of
           function alterations, through their overexpression,
           deletions, or point mutations in their kinase domains,
           have been implicated in various cancers. These receptors
           are targets of many small molecule inhibitors and
           monoclonal antibodies used in cancer therapy.
          Length = 279

 Score = 33.5 bits (77), Expect = 0.045
 Identities = 11/41 (26%), Positives = 23/41 (56%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L +P  C   ++ ++ +CW    ++RPTF E++ +  +
Sbjct: 227 GERLPQPPICTIDVYMVLVKCWMIDAESRPTFKELINEFSK 267


>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine
           Kinase, Platelet Derived Growth Factor Receptor beta.
           Protein Tyrosine Kinase (PTK) family; Platelet Derived
           Growth Factor Receptor (PDGFR) beta; catalytic (c)
           domain. The PTKc family is part of a larger superfamily
           that includes the catalytic domains of other kinases
           such as protein serine/threonine kinases, RIO kinases,
           and phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. PDGFR
           beta is a receptor tyr kinase (RTK) containing an
           extracellular ligand-binding region with five
           immunoglobulin-like domains, a transmembrane segment,
           and an intracellular catalytic domain. The binding to
           its ligands, the PDGFs, leads to receptor dimerization,
           trans phosphorylation and activation, and intracellular
           signaling. PDGFR beta forms homodimers or heterodimers
           with PDGFR alpha, depending on the nature of the PDGF
           ligand. PDGF-BB and PDGF-DD induce PDGFR beta
           homodimerization. PDGFR signaling plays many roles in
           normal embryonic development and adult physiology. PDGFR
           beta signaling leads to a variety of cellular effects
           including the stimulation of cell growth and chemotaxis,
           as well as the inhibition of apoptosis and GAP
           junctional communication. It is critical in normal
           angiogenesis as it is involved in the recruitment of
           pericytes and smooth muscle cells essential for vessel
           stability. Aberrant PDGFR beta expression is associated
           with some human cancers. The continuously-active fusion
           proteins of PDGFR beta with COL1A1 and TEL are
           associated with dermatofibrosarcoma protuberans (DFSP)
           and a subset of chronic myelomonocytic leukemia (CMML),
           respectively.
          Length = 401

 Score = 33.4 bits (76), Expect = 0.061
 Identities = 9/38 (23%), Positives = 23/38 (60%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           + +P +  D ++ +M++CW+ K + RP F +++  +  
Sbjct: 361 MAKPAHASDEIYEIMQKCWEEKFEIRPDFSQLVHLVGD 398


>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine
           Kinases, Vascular Endothelial Growth Factor Receptors.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor (VEGFR) subfamily;
           catalytic (c) domain. The VEGFR subfamily consists of
           VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar
           proteins. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR subfamily members are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. In
           VEGFR3, the fifth Ig-like domain is replaced by a
           disulfide bridge. The binding of VEGFRs to their
           ligands, the VEGFs, leads to receptor dimerization,
           activation, and intracellular signaling. There are five
           VEGF ligands in mammals, which bind, in an overlapping
           pattern to the three VEGFRs, which can form homo or
           heterodimers. VEGFRs regulate the cardiovascular system.
           They are critical for vascular development during
           embryogenesis and blood vessel formation in adults. They
           induce cellular functions common to other growth factor
           receptors such as cell migration, survival, and
           proliferation. VEGFR1 binds VEGFA, VEGFB, and placenta
           growth factor (PLGF). It regulates monocyte and
           macrophage migration, vascular permeability,
           haematopoiesis, and the recruitment of haematopietic
           progenitor cells from the bone marrow.
          Length = 337

 Score = 32.9 bits (75), Expect = 0.079
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTF---MEILADL 100
           P+     ++++M  CW   P+ RPTF   +EIL DL
Sbjct: 298 PEYATPEIYSIMLDCWHNNPEDRPTFSELVEILGDL 333


>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine
           Kinase, Epidermal Growth Factor Receptor.  Protein
           Tyrosine Kinase (PTK) family; Epidermal Growth Factor
           Receptor (EGFR); catalytic (c) domain. The PTKc family
           is part of a larger superfamily that includes the
           catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. EGFR
           (HER1, ErbB1) is a member of the EGFR (HER, ErbB)
           subfamily of proteins, which are receptor tyr kinases
           (RTKs) containing an extracellular EGF-related
           ligand-binding region, a transmembrane helix, and a
           cytoplasmic region with a tyr kinase domain and a
           regulatory C-terminal tail. Unlike other tyr kinases,
           phosphorylation of the activation loop of EGFR proteins
           is not critical to their activation. Instead, they are
           activated by ligand-induced dimerization, leading to the
           phosphorylation of tyr residues in the C-terminal tail,
           which serve as binding sites for downstream signaling
           molecules. Ligands for EGFR include EGF, heparin binding
           EGF-like growth factor (HBEGF), epiregulin,
           amphiregulin, TGFalpha, and betacellulin. Upon ligand
           binding, EGFR can form homo- or heterodimers with other
           EGFR subfamily members. The EGFR signaling pathway is
           one of the most important pathways regulating cell
           proliferation, differentiation, survival, and growth.
           Overexpression and mutation in the kinase domain of EGFR
           have been implicated in the development and progression
           of a variety of cancers. A number of monoclonal
           antibodies and small molecule inhibitors have been
           developed that target EGFR, including the antibodies
           Cetuximab and Panitumumab, which are used in combination
           with other therapies for the treatment of colorectal
           cancer and non-small cell lung carcinoma (NSCLC). The
           small molecule inhibitors Gefitinib (Iressa) and
           Erlotinib (Tarceva), already used for NSCLC, are
           undergoing clinical trials for other types of cancer
           including gastrointestinal, breast, head and neck, and
           bladder.
          Length = 316

 Score = 32.7 bits (74), Expect = 0.11
 Identities = 11/41 (26%), Positives = 21/41 (51%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L +P  C   ++ +M +CW     +RP F E++ +  +
Sbjct: 227 GERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSK 267


>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine
           Kinase, HER4.  Protein Tyrosine Kinase (PTK) family;
           HER4 (ErbB4); catalytic (c) domain. The PTKc family is
           part of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. HER4 is a
           member of the EGFR (HER, ErbB) subfamily of proteins,
           which are receptor tyr kinases (RTKs) containing an
           extracellular EGF-related ligand-binding region, a
           transmembrane helix, and a cytoplasmic region with a tyr
           kinase domain and a regulatory C-terminal tail. Unlike
           other tyr kinases, phosphorylation of the activation
           loop of EGFR proteins is not critical to their
           activation. Instead, they are activated by
           ligand-induced dimerization, leading to the
           phosphorylation of tyr residues in the C-terminal tail,
           which serve as binding sites for downstream signaling
           molecules. Ligands that bind HER4 fall into two groups,
           the neuregulins (or heregulins) and some EGFR (HER1)
           ligands including betacellulin, HBEGF, and epiregulin.
           All four neuregulins (NRG1-4) interact with HER4. Upon
           ligand binding, HER4 forms homo- or heterodimers with
           other HER proteins. HER4 is essential in embryonic
           development. It is implicated in mammary gland, cardiac,
           and neural development. As a postsynaptic receptor of
           NRG1, HER4 plays an important role in synaptic
           plasticity and maturation. The impairment of NRG1/HER4
           signaling may contribute to schizophrenia.
          Length = 303

 Score = 32.3 bits (73), Expect = 0.12
 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAASFRQVSYYHSAACAE 121
           G  L +P  C   ++ +M +CW     +RP F E+ A+  R      R +         +
Sbjct: 227 GERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYL-----VIQGD 281

Query: 122 NKLRLAAKAETRTSSTTLDEQ 142
           ++++L +  +++     LDE+
Sbjct: 282 DRMKLPSPNDSKFFQNLLDEE 302


>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine
           Kinase, Vascular Endothelial Growth Factor Receptor 2.
           Protein Tyrosine Kinase (PTK) family; Vascular
           Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic
           (c) domain. The PTKc family is part of a larger
           superfamily that includes the catalytic domains of other
           kinases such as protein serine/threonine kinases, RIO
           kinases, and phosphoinositide 3-kinase (PI3K). PTKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to tyrosine (tyr) residues in protein substrates.
           VEGFR2 (or Flk1) is a member of the VEGFR subfamily of
           proteins, which are receptor tyr kinases (RTKs)
           containing an extracellular ligand-binding region with
           seven immunoglobulin (Ig)-like domains, a transmembrane
           segment, and an intracellular catalytic domain. The
           binding of VEGFRs to their ligands, the VEGFs, leads to
           receptor dimerization, activation, and intracellular
           signaling. The carboxyl terminus of VEGFR2 plays an
           important role in its autophosphorylation and
           activation. VEGFR2 binds the ligands VEGFA, VEGFC, VEGFD
           and VEGFE. VEGFR2 signaling is implicated in all aspects
           of normal and pathological vascular endothelial cell
           biology. It induces a variety of cellular effects
           including migration, survival, and proliferation. It is
           critical in regulating embryonic vascular development
           and angiogenesis. VEGFR2 is the major signal transducer
           in pathological angiogenesis including cancer and
           diabetic retinopathy, and is a target for inhibition in
           cancer therapy.
          Length = 343

 Score = 31.9 bits (72), Expect = 0.17
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 68  PDNCPDRLFNLMRRCWQFKPQARPTFMEILADLERDIAAS 107
           PD     ++  M  CW  +P  RPTF E++  L   + A+
Sbjct: 304 PDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQAN 343


>gnl|CDD|217007 pfam02383, Syja_N, SacI homology domain.  This Pfam family
          represents a protein domain which shows homology to the
          yeast protein SacI. The SacI homology domain is most
          notably found at the amino terminal of the inositol
          5'-phosphatase synaptojanin.
          Length = 298

 Score = 31.8 bits (73), Expect = 0.21
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 7  LLGLLRYVLGKILCIATGASMVAT 30
          +LGL+R + G  L + T AS V T
Sbjct: 4  ILGLIRLLGGSYLIVITKASKVGT 27


>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine
           Kinase, HER3.  Protein Tyrosine Kinase (PTK) family;
           HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic
           domain) family to which this subfamily belongs, is part
           of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. HER3 is a
           member of the EGFR (HER, ErbB) subfamily of proteins,
           which are receptor tyr kinases (RTKs) containing an
           extracellular EGF-related ligand-binding region, a
           transmembrane helix, and a cytoplasmic region with a tyr
           kinase domain and a regulatory C-terminal tail. Unlike
           other tyr kinases, phosphorylation of the activation
           loop of EGFR proteins is not critical to their
           activation. Instead, they are activated by
           ligand-induced dimerization, leading to the
           phosphorylation of tyr residues in the C-terminal tail,
           which serve as binding sites for downstream signaling
           molecules. HER3 binds the neuregulin ligands, NRG1 and
           NRG2. HER3 contains an impaired tyr kinase domain and
           relies on its heterodimerization partners for activity
           following ligand binding. The HER2-HER3 heterodimer
           constitutes a high affinity co-receptor capable of
           potent mitogenic signaling. HER3 participates in a
           signaling pathway involved in the proliferation,
           survival, adhesion, and motility of tumor cells.
          Length = 279

 Score = 31.5 bits (71), Expect = 0.22
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 62  GGILVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADLER 102
           G  L +P  C   ++ +M +CW      RPTF E+  +  R
Sbjct: 227 GERLAQPQICTIDVYMVMVKCWMIDENVRPTFKELANEFTR 267


>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the
           Protein Tyrosine Kinase, Janus kinase 1.  Protein
           Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1);
           pseudokinase domain (repeat 1). The PTKc (catalytic
           domain) family to which this subfamily belongs, is part
           of a larger superfamily that includes the catalytic
           domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Jak1 is a
           member of the Janus kinase (Jak) subfamily of proteins,
           which are cytoplasmic (or nonreceptor) tyr kinases
           containing an N-terminal FERM domain, followed by a Src
           homology 2 (SH2) domain, a pseudokinase domain, and a
           C-terminal tyr kinase domain. The pseudokinase domain
           shows similarity to tyr kinases but lacks crucial
           residues for catalytic activity and ATP binding. It
           modulates the kinase activity of the C-terminal
           catalytic domain. Jaks are crucial for cytokine receptor
           signaling. They are activated by autophosphorylation
           upon cytokine-induced receptor aggregation, and
           subsequently trigger downstream signaling events such as
           the phosphorylation of signal transducers and activators
           of transcription (STATs). Jak1 is widely expressed in
           many tissues. Many cytokines are dependent on Jak1 for
           signaling, including those that use the shared receptor
           subunits common gamma chain (IL-2, IL-4, IL-7, IL-9,
           IL-15, IL-21) and gp130 (IL-6, IL-11, oncostatin M,
           G-CSF, and IFNs, among others). The many varied
           interactions of Jak1 and its ubiquitous expression
           suggest many biological roles. Jak1 is important in
           neurological development, as well as in lymphoid
           development and function. It also plays a role in the
           pathophysiology of cardiac hypertrophy and heart
           failure. A mutation in the ATP-binding site of Jak1 was
           identified in a human uterine leiomyosarcoma cell line,
           resulting in defective cytokine induction and antigen
           presentation, thus allowing the tumor to evade the
           immune system.
          Length = 262

 Score = 29.9 bits (67), Expect = 0.86
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%)

Query: 65  LVRPDNCPDRLFNLMRRCWQFKPQARPTFMEILADL 100
           LV P  C   L +LM  C  + P  RP F  I+ D+
Sbjct: 228 LVTPS-C-KELADLMTHCMNYDPNQRPFFRAIMRDI 261


>gnl|CDD|225802 COG3263, COG3263, NhaP-type Na+/H+ and K+/H+ antiporters with a
           unique C-terminal domain [Inorganic ion transport and
           metabolism].
          Length = 574

 Score = 29.7 bits (67), Expect = 1.1
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 8   LGLLRYVLGKILCIATGASMVATGASMVGKHWLLGL---LRYVLGKILQSTGASMV 60
           L   R   G  L +AT   ++ +G + V   +LL L      ++G I+ ST A+ V
Sbjct: 81  LSSFRVAAGPALSLATLGVLITSGLTGVAAAYLLNLDWLEGLLIGAIVGSTDAAAV 136


>gnl|CDD|227054 COG4710, COG4710, Predicted DNA-binding protein with an HTH domain
           [General function prediction only].
          Length = 80

 Score = 27.2 bits (60), Expect = 1.7
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 121 ENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSDSNEE 163
           + +L   +K   RT +  + E I     E++EDF L+ ++ E 
Sbjct: 17  KERLDNLSKNTGRTKAYYVREAIE-AYIEEMEDFYLAVNALER 58


>gnl|CDD|183159 PRK11482, PRK11482, putative DNA-binding transcriptional regulator;
           Provisional.
          Length = 317

 Score = 28.9 bits (65), Expect = 1.9
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 10/33 (30%)

Query: 55  TGASMVGG----GILVRPDNCPDRLFNLMRRCW 83
           T A+++      GI+      P R +NL  RCW
Sbjct: 249 TIAALIASSDMLGIM------PSRFYNLFSRCW 275


>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine
           Kinase,  Extracellular signal-Regulated Kinase 5.
           Serine/Threonine Kinases (STKs), Extracellular
           signal-Regulated Kinase 5 (ERK5) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ERK5 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. MAPKs are
           important mediators of cellular responses to
           extracellular signals. ERK5, also called Big MAPK1
           (BMK1) or MAPK7, has a unique C-terminal extension,
           making it approximately twice as big as other MAPKs.
           This extension contains transcriptional activation
           capability which is inhibited by the N-terminal half.
           ERK5 is activated in response to growth factors and
           stress by a cascade that leads to its phosphorylation by
           the MAP2K MEK5, which in turn is regulated by the MAP3Ks
           MEKK2 and MEKK3. Activated ERK5 phosphorylates its
           targets including myocyte enhancer factor 2 (MEF2),
           Sap1a, c-Myc, and RSK. It plays a role in EGF-induced
           cell proliferation during the G1/S phase transition.
           Studies on knockout mice revealed that ERK5 is essential
           for cardiovascular development and plays an important
           role in angiogenesis. It is also critical for neural
           differentiation and survival. The ERK5 pathway has been
           implicated in the pathogenesis of many diseases
           including cancer, cardiac hypertrophy, and
           atherosclerosis.
          Length = 334

 Score = 28.4 bits (64), Expect = 2.3
 Identities = 27/121 (22%), Positives = 41/121 (33%), Gaps = 37/121 (30%)

Query: 20  CIATGASMVATGASMVGKHWL--LGLLRYVLG----KILQSTGASMVGGGILVRPDNCPD 73
           CI   A M+       GK+++  L L+  VLG    ++L   G+  V   I     N P 
Sbjct: 200 CIF--AEMLGRRQLFPGKNYVHQLKLILSVLGSPSEEVLNRIGSDRVRKYI----QNLPR 253

Query: 74  R---------------LFNLMRRCWQFKPQARPTFMEIL----------ADLERDIAASF 108
           +                 +L+ +  QF P+ R T  + L           D E      F
Sbjct: 254 KQPVPWSKIFPKASPEALDLLSQMLQFDPEERITVEQALQHPFLAQYHDPDDEPTCPPPF 313

Query: 109 R 109
            
Sbjct: 314 D 314


>gnl|CDD|224460 COG1543, COG1543, Uncharacterized conserved protein [Function
           unknown].
          Length = 504

 Score = 28.5 bits (64), Expect = 2.4
 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 12/73 (16%)

Query: 91  PTFMEILADLERDIAASFRQVSYYHSAACAENKLRLAAKAETRTSSTTLDEQIP--LRSA 148
           P  ME+LAD    +   + +          E K+ L+ K E R +  +L E     +   
Sbjct: 62  PVLMEMLAD--PYLQDRYLRY--------LEWKIELSEKEEKRYADQSLRELAEFYIPEF 111

Query: 149 EDIEDFSLSSDSN 161
            +   +    D N
Sbjct: 112 LNARGYWEQYDGN 124


>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ
           cell-Associated Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Male germ
           cell-Associated Kinase (MAK)-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of human MAK and
           MAK-related kinase (MRK), Saccharomyces cerevisiae
           Ime2p, Schizosaccharomyces pombe Mei4-dependent protein
           3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5,
           Arabidopsis thaliana MHK, and similar proteins. These
           proteins play important roles during meiosis. MAK is
           highly expressed in testicular cells specifically in the
           meiotic phase, but is not essential for spermatogenesis
           and fertility. It functions as a coactivator of the
           androgen receptor in prostate cells. MRK, also called
           Intestinal Cell Kinase (ICK), is expressed ubiquitously,
           with highest expression in the ovary and uterus. A
           missense mutation in MRK causes
           endocrine-cerebro-osteodysplasia (ECO), suggesting that
           this protein plays an important role in the development
           of many organs. MAK and MRK may be involved in
           regulating cell cycle and cell fate. Ime2p is a
           meiosis-specific kinase that is important during meiotic
           initiation and during the later stages of meiosis. Mde3
           functions downstream of the transcription factor Mei-4
           which is essential for meiotic prophase I.
          Length = 283

 Score = 28.3 bits (64), Expect = 2.4
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 70  NCPDRLFNLMRRCWQFKPQARPTFMEIL 97
           N      +L++   ++ P+ RPT  + L
Sbjct: 251 NASPEAIDLIKDMLRWDPKKRPTASQAL 278


>gnl|CDD|240364 PTZ00332, PTZ00332, paraflagellar rod protein; Provisional.
          Length = 589

 Score = 28.4 bits (63), Expect = 3.3
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 21/93 (22%)

Query: 78  LMRRCWQ-------FKPQARPTFMEILA------DLERDIAASFRQVSYYHSAACAENKL 124
           LMR C         ++P+ +P FM+I+A      DL+++   + R VS+       +N +
Sbjct: 81  LMRVCGLEMSQRELYRPEDKPQFMDIIALKKVLQDLKQNRNKT-RVVSF---TQMIDNAI 136

Query: 125 RLAAKAETRTSSTTLD----EQIPLRSAEDIED 153
               K E     + LD     Q+P  + ++IED
Sbjct: 137 AKMEKVEEELRRSQLDATQLAQVPTATLKNIED 169


>gnl|CDD|236564 PRK09556, uhpT, sugar phosphate antiporter; Reviewed.
          Length = 467

 Score = 27.7 bits (62), Expect = 4.6
 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 2/42 (4%)

Query: 19  LCIATGASMVATGASMVGKHWLLGLL--RYVLGKILQSTGAS 58
           L I +   M+  GAS+      LGL+   + L    QSTG  
Sbjct: 100 LLILSAICMLGFGASLGSGSVSLGLMIALWALSGFFQSTGGP 141


>gnl|CDD|132286 TIGR03242, arg_catab_astE, succinylglutamate desuccinylase.
           Members of this protein family are succinylglutamate
           desuccinylase, the fifth and final enzyme of the
           arginine succinyltransferase (AST) pathway for arginine
           catabolism. This model excludes the related protein
           aspartoacylase [Energy metabolism, Amino acids and
           amines].
          Length = 319

 Score = 27.7 bits (62), Expect = 4.8
 Identities = 10/39 (25%), Positives = 16/39 (41%)

Query: 121 ENKLRLAAKAETRTSSTTLDEQIPLRSAEDIEDFSLSSD 159
           +N L   A   +   +   DE IP R  + +  F + S 
Sbjct: 218 QNDLSQFAAITSALRALISDEAIPARRTDPLRLFRVVSS 256


>gnl|CDD|223148 COG0070, GltB, Glutamate synthase domain 3 [Amino acid transport
           and metabolism].
          Length = 301

 Score = 26.9 bits (60), Expect = 7.3
 Identities = 10/24 (41%), Positives = 13/24 (54%)

Query: 47  VLGKILQSTGASMVGGGILVRPDN 70
           VLG   ++ GA M GG   VR + 
Sbjct: 192 VLGDTGRNFGAGMSGGVAYVRGEV 215


>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the
           Protein Tyrosine Kinases, Janus kinases 2 and 3.
           Protein Tyrosine Kinase (PTK) family; Janus kinase 2
           (Jak2) and Jak3; pseudokinase domain (repeat 1). The
           PTKc (catalytic domain) family to which this subfamily
           belongs, is part of a larger superfamily that includes
           the catalytic domains of other kinases such as protein
           serine/threonine kinases, RIO kinases, and
           phosphoinositide 3-kinase (PI3K). PTKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           tyrosine (tyr) residues in protein substrates. Jak2 and
           Jak3 are members of the Janus kinase (Jak) subfamily of
           proteins, which are cytoplasmic (or nonreceptor) tyr
           kinases containing an N-terminal FERM domain, followed
           by a Src homology 2 (SH2) domain, a pseudokinase domain,
           and a C-terminal tyr kinase domain. The pseudokinase
           domain shows similarity to tyr kinases but lacks crucial
           residues for catalytic activity and ATP binding. It
           modulates the kinase activity of the C-terminal
           catalytic domain. Jaks are crucial for cytokine receptor
           signaling. They are activated by autophosphorylation
           upon cytokine-induced receptor aggregation, and
           subsequently trigger downstream signaling events such as
           the phosphorylation of signal transducers and activators
           of transcription (STATs). Jak2 is widely expressed in
           many tissues while Jak3 is expressed only in
           hematopoietic cells. Jak2 is essential for the signaling
           of hormone-like cytokines such as growth hormone,
           erythropoietin, thrombopoietin, and prolactin, as well
           as some IFNs and cytokines that signal through the IL-3
           and gp130 receptors. Jak3 binds the shared receptor
           subunit common gamma chain and thus, is essential in the
           signaling of cytokines that use it such as IL-2, IL-4,
           IL-7, IL-9, IL-15, and IL-21. Disruption of Jak2 in mice
           results in an embryonic lethal phenotype with multiple
           defects including erythropoietic and cardiac
           abnormalities. It is the only Jak gene that results in a
           lethal phenotype when disrupted in mice. A mutation in
           the pseudokinase domain of Jak2, V617F, is present in
           many myeloproliferative diseases, including almost all
           patients with polycythemia vera, and 50% of patients
           with essential thrombocytosis and myelofibrosis. Jak3 is
           important in lymphoid development and myeloid cell
           differentiation. Inactivating mutations in Jak3 have
           been reported in humans with severe combined
           immunodeficiency (SCID).
          Length = 258

 Score = 26.7 bits (59), Expect = 8.4
 Identities = 11/26 (42%), Positives = 17/26 (65%)

Query: 75  LFNLMRRCWQFKPQARPTFMEILADL 100
           L NL+ +C  ++P  RP+F  I+ DL
Sbjct: 232 LANLINQCMDYEPDFRPSFRAIIRDL 257


>gnl|CDD|201826 pfam01493, GXGXG, GXGXG motif.  This domain is found in glutamate
           synthase, tungsten formylmethanofuran dehydrogenase
           subunit c (FwdC) and molybdenum formylmethanofuran
           dehydrogenase subunit c (FmdC). A repeated G-XX-G-XXX-G
           motif is seen in the alignment.
          Length = 198

 Score = 26.4 bits (59), Expect = 9.1
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 47  VLGKILQSTGASMVGGGILVR 67
           VLG   ++ GA M GG I V 
Sbjct: 145 VLGDAGRNVGAGMTGGTIYVL 165


>gnl|CDD|238281 cd00504, GXGXG, GXGXG domain. This domain of unknown function is
           found at the C-terminus of the large subunit (gltB) of
           glutamate synthase (GltS),  in subunit C of tungsten
           formylmethanofuran dehydrogenase (FwdC) and in subunit C
           of molybdenum formylmethanofuran dehydrogenase (FmdC).
           It is also found in a primarily archeal group of
           proteins predicted to encode part of the large subunit
           of GltS. It is characterized by a repeated GXXGXXXG
           motif. GltS is a complex iron-sulfur flavoprotein that
           catalyzes the synthesis of L-glutamate from L-glutamine
           and 2-oxoglutarate. It requires the transfer of ammonia
           and electrons among three distinct active centers that
           carry out L-Gln hydrolysis, conversion of 2-oxoglutarate
           into L-Glu, and electron uptake from a donor. These
           catalytic sites occur in other domains within the
           protein or or encoded by separate genes, and are not
           present in the domain in this CD. FwdC and FmdC are
           reversible ion pumps that catalyze the formylation and
           deformylation of methanofuran in hyperthermophiles and
           bacteria.  They require the presence of either tungstun
           (FwdC) or molybdenum (FmdC). The specific function of
           this domain also remains unidentified in the
           formylmethanofuran dehydrogenases.
          Length = 149

 Score = 26.0 bits (58), Expect = 9.3
 Identities = 11/21 (52%), Positives = 13/21 (61%)

Query: 47  VLGKILQSTGASMVGGGILVR 67
           VLG   ++ GA M GG I VR
Sbjct: 128 VLGDAGRNFGAGMSGGVIYVR 148


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 26.5 bits (59), Expect = 10.0
 Identities = 8/23 (34%), Positives = 13/23 (56%)

Query: 77  NLMRRCWQFKPQARPTFMEILAD 99
           + + RC +  P+ RPT  E+L  
Sbjct: 239 DFLDRCLESDPKKRPTASELLQH 261


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0774    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 10,373,948
Number of extensions: 969311
Number of successful extensions: 1000
Number of sequences better than 10.0: 1
Number of HSP's gapped: 999
Number of HSP's successfully gapped: 125
Length of query: 205
Length of database: 10,937,602
Length adjustment: 92
Effective length of query: 113
Effective length of database: 6,857,034
Effective search space: 774844842
Effective search space used: 774844842
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (25.6 bits)