Query         psy7033
Match_columns 107
No_of_seqs    101 out of 198
Neff          6.1 
Searched_HMMs 46136
Date          Sat Aug 17 01:03:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7033.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7033hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3609|consensus               99.9 7.5E-29 1.6E-33  211.6   2.9   83   22-107   269-353 (822)
  2 TIGR00870 trp transient-recept  99.4 5.6E-14 1.2E-18  119.4  -0.7   83   25-107   272-356 (743)
  3 KOG3614|consensus               99.2 7.3E-12 1.6E-16  112.0   1.9   71   11-86    640-715 (1381)
  4 PF13373 DUF2407_C:  DUF2407 C-  59.0      40 0.00086   23.9   5.7   28   63-90     88-115 (140)
  5 KOG4349|consensus               50.6      23  0.0005   25.1   3.3   37   63-101    50-86  (143)
  6 PF11588 DUF3243:  Protein of u  42.1      12 0.00026   24.4   0.7   38    1-54     26-63  (81)
  7 TIGR02972 TMAO_torE trimethyla  31.2 1.2E+02  0.0025   17.9   3.7   17   69-85     13-29  (47)
  8 PF06796 NapE:  Periplasmic nit  29.8 1.3E+02  0.0027   18.3   3.8   15   70-84     22-36  (56)
  9 PF11970 Git3_C:  G protein-cou  29.0      82  0.0018   19.9   3.0   20   69-88      9-28  (76)
 10 PF08352 oligo_HPY:  Oligopepti  27.2      30 0.00066   20.3   0.8   12   39-50     14-25  (64)
 11 TIGR02973 nitrate_rd_NapE peri  26.3   1E+02  0.0023   17.6   2.8   16   69-84      8-23  (42)
 12 COG0163 UbiX 3-polyprenyl-4-hy  25.6      36 0.00079   25.6   1.0   21    2-22     90-110 (191)
 13 COG4459 NapE Periplasmic nitra  25.5 1.5E+02  0.0032   18.3   3.6   28   55-84     12-39  (62)
 14 PF04342 DUF486:  Protein of un  25.1 1.8E+02  0.0038   20.0   4.2   45   44-94     11-56  (108)
 15 cd01053 AOX Alternative oxidas  23.9 1.2E+02  0.0027   22.2   3.5   32   59-90     63-94  (168)
 16 TIGR02113 coaC_strep phosphopa  23.6      60  0.0013   23.5   1.9   52    2-53     86-141 (177)
 17 PF01786 AOX:  Alternative oxid  22.2 1.1E+02  0.0025   23.0   3.2   31   60-90    104-134 (207)

No 1  
>KOG3609|consensus
Probab=99.95  E-value=7.5e-29  Score=211.59  Aligned_cols=83  Identities=41%  Similarity=0.680  Sum_probs=80.5

Q ss_pred             cCCCCcccccccccc--ceeehhHHHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhccc
Q psy7033          22 CQSHKYQPLPTNFFQ--FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKP   99 (107)
Q Consensus        22 ~~~~~~L~lAi~~~q--FVAHp~~Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s~~g~~~r~P   99 (107)
                      ..+++|||+||+|+|  |||||||||+|+++||+   |||+++...|++.+..++++||+++++|+++|+|+.|+++|+|
T Consensus       269 ~~sl~RLklAIkyeqK~FVahpNcQq~L~siWy~---g~R~~~~~~K~~~~~~~~~~~P~~~l~yllap~S~~G~~~r~P  345 (822)
T KOG3609|consen  269 RISLPRLKLAIKYEQKEFVAHPNCQQLLKSVWYS---GWRRKGIKPKFDAWRFLRLCFPMPSLVYLLAPMSRKGTTMRKP  345 (822)
T ss_pred             ccccHHHHHHHHHhhhheecCccHHHHHHHHHhh---hhhhcchHHHHHHHHHHHHHhHHHHHHHHhCCCCcccchhhch
Confidence            367899999999999  99999999999999999   8999999999999999999999999999999999999999999


Q ss_pred             eeeccccC
Q psy7033         100 FVKFVVHA  107 (107)
Q Consensus       100 fvKF~~h~  107 (107)
                      |+||++|+
T Consensus       346 fmKFi~H~  353 (822)
T KOG3609|consen  346 FMKFIAHI  353 (822)
T ss_pred             HHHHHHHH
Confidence            99999995


No 2  
>TIGR00870 trp transient-receptor-potential calcium channel protein. after chronic exposure to capsaicin. (McCleskey and Gold, 1999).
Probab=99.37  E-value=5.6e-14  Score=119.39  Aligned_cols=83  Identities=37%  Similarity=0.572  Sum_probs=77.5

Q ss_pred             CCcccccccccc--ceeehhHHHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhccceee
Q psy7033          25 HKYQPLPTNFFQ--FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFVK  102 (107)
Q Consensus        25 ~~~L~lAi~~~q--FVAHp~~Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s~~g~~~r~PfvK  102 (107)
                      +.++.++++++|  ||+||+||+.++..||++.++|++++..++++......+.+|..+.+|.++|.+++|++.++||+|
T Consensus       272 l~~lLL~~~~~~kk~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~p~~~~~~~~~P~~~l~~~kw~pf~k  351 (743)
T TIGR00870       272 LFRLKLAIKYKQKKFVAWPNGQQLLSLYWLEELDGWRRKQSVLELIVVFVIGLKFPELSDMYLIAPLSRLGQFKWKPFIK  351 (743)
T ss_pred             HHHHHHHHHHhcceeeccCcchHhHhhhccccCCcccccccHHHHHHHHHHhhcChHHHHHHHHhhhHHHHHHHHHHHHH
Confidence            346778999999  999999999999999999999999988999999988888999999999999999999999999999


Q ss_pred             ccccC
Q psy7033         103 FVVHA  107 (107)
Q Consensus       103 F~~h~  107 (107)
                      |+.|+
T Consensus       352 f~~~~  356 (743)
T TIGR00870       352 FIFHS  356 (743)
T ss_pred             HHHHH
Confidence            99873


No 3  
>KOG3614|consensus
Probab=99.18  E-value=7.3e-12  Score=112.01  Aligned_cols=71  Identities=23%  Similarity=0.258  Sum_probs=59.3

Q ss_pred             hcchhhhhhhhcCCC---Ccccccccccc--ceeehhHHHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHH
Q psy7033          11 TGIGDKLITHRCQSH---KYQPLPTNFFQ--FVAHSNIQQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYM   85 (107)
Q Consensus        11 ~~~g~~ll~~~~~~~---~~L~lAi~~~q--FVAHp~~Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~   85 (107)
                      ...+.+|+++++..|   +||++|++++.  |+|||.||.+|+++|||++..  +++.++|++.+++   ++|++.+.-+
T Consensus       640 e~~A~~LLt~el~~W~~~tCL~LAv~a~~r~FiAH~c~Q~lLt~~W~G~L~~--r~~~~~kvila~i---cpP~Il~l~~  714 (1381)
T KOG3614|consen  640 EARALQLLTYELENWGNSTCLQLAVEANAREFIAHPCCQMLLTDKWYGNLQA--RNNPIWKVILALI---CPPLILTLLV  714 (1381)
T ss_pred             HHHHHHHHHhHHhhcccccHHHHHHhcCCCceeccHhHHHHHHHHHhccccc--cCCCcHHHHHHHH---hhHHHHHhhc
Confidence            345678889999987   89999999998  999999999999999999853  7778899888765   8888777643


Q ss_pred             H
Q psy7033          86 I   86 (107)
Q Consensus        86 i   86 (107)
                      =
T Consensus       715 k  715 (1381)
T KOG3614|consen  715 K  715 (1381)
T ss_pred             c
Confidence            3


No 4  
>PF13373 DUF2407_C:  DUF2407 C-terminal domain
Probab=59.00  E-value=40  Score=23.86  Aligned_cols=28  Identities=18%  Similarity=0.212  Sum_probs=23.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcCC
Q psy7033          63 LLEKLLDLSKIILIFPYYCLLYMISGMS   90 (107)
Q Consensus        63 ~~~k~l~~~~~~~~~Pll~l~y~i~P~s   90 (107)
                      ....++.-+.+++++|++++++++...+
T Consensus        88 ~~~dlL~G~liGff~g~~~~~~L~~~~~  115 (140)
T PF13373_consen   88 HNDDLLWGLLIGFFFGLFSLFWLLREDG  115 (140)
T ss_pred             hHHHHHHHHHHHHHHHHHhHHHHhhccc
Confidence            4567888999999999999998877654


No 5  
>KOG4349|consensus
Probab=50.64  E-value=23  Score=25.12  Aligned_cols=37  Identities=22%  Similarity=0.160  Sum_probs=23.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhcccee
Q psy7033          63 LLEKLLDLSKIILIFPYYCLLYMISGMSDTGKIIRKPFV  101 (107)
Q Consensus        63 ~~~k~l~~~~~~~~~Pll~l~y~i~P~s~~g~~~r~Pfv  101 (107)
                      ..|-++..+++.+.--++  .++-..|.|.|+|+..|+.
T Consensus        50 FLWal~Ss~fih~~A~il--alFTLRkHkygrF~si~il   86 (143)
T KOG4349|consen   50 FLWALLSSMFIHLGATIL--ALFTLRKHKYGRFISIPIL   86 (143)
T ss_pred             HHHHHHHHHHHHhhHHHH--HHHHhhcCccceeeehHHH
Confidence            355555555544433333  3455678899999998875


No 6  
>PF11588 DUF3243:  Protein of unknown function (DUF3243);  InterPro: IPR021637 This family of proteins with unknown function includes uncharacterised proteins ymfJ and yflH. The family appears to be restricted to Firmicutes.; PDB: 3D0W_B.
Probab=42.06  E-value=12  Score=24.38  Aligned_cols=38  Identities=32%  Similarity=0.368  Sum_probs=20.1

Q ss_pred             CchhhhhHhhhcchhhhhhhhcCCCCccccccccccceeehhHHHHHHHHHhcC
Q psy7033           1 MSESGLAQVATGIGDKLITHRCQSHKYQPLPTNFFQFVAHSNIQQLLAAMWYDG   54 (107)
Q Consensus         1 ~~~~~~~~~~~~~g~~ll~~~~~~~~~L~lAi~~~qFVAHp~~Q~~L~~~Wy~~   54 (107)
                      |||..++..|.-+|+-|-.+..|.         ++       -|.+|.++|--+
T Consensus        26 ms~e~i~~~A~~iGdyLA~~vdP~---------N~-------EerlLkELW~va   63 (81)
T PF11588_consen   26 MSEETIANLAYQIGDYLAKNVDPK---------NP-------EERLLKELWDVA   63 (81)
T ss_dssp             HHTT----HHHHHHHHHHT--------------SH-------HHHHHHHHHHC-
T ss_pred             CCHHHHHHHHHHHHHHHHhcCCCC---------CH-------HHHHHHHHHHhC
Confidence            567778888899999887776665         22       267777777643


No 7  
>TIGR02972 TMAO_torE trimethylamine N-oxide reductase system, TorE protein. Members of this small, apparent transmembrane protein are designated TorE and occur in operons for the trimethylamine N-oxide (TMAO) reductase system. Members are closely related to the NapE protein of the related periplasmic nitrate reductase system. It may be that TorE is an integral membrane subunit of a complex with the reductase TorA.
Probab=31.17  E-value=1.2e+02  Score=17.85  Aligned_cols=17  Identities=18%  Similarity=0.227  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy7033          69 DLSKIILIFPYYCLLYM   85 (107)
Q Consensus        69 ~~~~~~~~~Pll~l~y~   85 (107)
                      +.+..++++|++++..+
T Consensus        13 flfl~v~l~PiLsV~~V   29 (47)
T TIGR02972        13 LGFIIVVLFPILSVAGI   29 (47)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            34456789999998743


No 8  
>PF06796 NapE:  Periplasmic nitrate reductase protein NapE;  InterPro: IPR010649 This family consists of several bacterial periplasmic nitrate reductase NapE proteins. Seven genes, napKEFDABC, encoding the periplasmic nitrate reductase system were cloned from the denitrifying phototrophic bacterium Rhodobacter sphaeroides. NapE is thought to be a transmembrane protein [].
Probab=29.83  E-value=1.3e+02  Score=18.30  Aligned_cols=15  Identities=20%  Similarity=0.580  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHH
Q psy7033          70 LSKIILIFPYYCLLY   84 (107)
Q Consensus        70 ~~~~~~~~Pll~l~y   84 (107)
                      .+..++++|++++..
T Consensus        22 lfl~~~l~PiL~v~~   36 (56)
T PF06796_consen   22 LFLAVVLFPILAVAF   36 (56)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            445678999999874


No 9  
>PF11970 Git3_C:  G protein-coupled glucose receptor regulating Gpa2 C-term;  InterPro: IPR022596 This entry contains a functionally uncharacterised region belonging to the Git3 G-protein coupled receptor. Git3 is one of six proteins required for glucose-triggered adenylate cyclase activation, and is a G protein-coupled receptor responsible for the activation of adenylate cyclase through Gpa2 - heterotrimeric G protein alpha subunit, part of the glucose-detection pathway. Git3 contains seven predicted transmembrane domains, a third cytoplasmic loop and a cytoplasmic tail []. This family is the conserved C-terminal domain of the member proteins. 
Probab=28.95  E-value=82  Score=19.91  Aligned_cols=20  Identities=10%  Similarity=0.310  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHhc
Q psy7033          69 DLSKIILIFPYYCLLYMISG   88 (107)
Q Consensus        69 ~~~~~~~~~Pll~l~y~i~P   88 (107)
                      ..+...+.+|+..++-++.|
T Consensus         9 r~lr~mfiYP~~Yi~lwlfP   28 (76)
T PF11970_consen    9 RQLRSMFIYPLVYIVLWLFP   28 (76)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34455569999999999988


No 10 
>PF08352 oligo_HPY:  Oligopeptide/dipeptide transporter, C-terminal region;  InterPro: IPR013563 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry features a region found towards the C terminus of oligopeptide ABC transporter ATP binding proteins, immediately following the ATP-binding domain (IPR003439 from INTERPRO). All characterised members appear able to be involved in the transport of oligopeptides or dipeptides. Some are important for sporulation or antibiotic resistance. Some dipeptide transporters also act on the haem precursor delta-aminolevulinic acid. ; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0015833 peptide transport
Probab=27.23  E-value=30  Score=20.30  Aligned_cols=12  Identities=42%  Similarity=0.542  Sum_probs=10.6

Q ss_pred             eehhHHHHHHHH
Q psy7033          39 AHSNIQQLLAAM   50 (107)
Q Consensus        39 AHp~~Q~~L~~~   50 (107)
                      .||+.|.+|+++
T Consensus        14 ~HPYT~~Ll~a~   25 (64)
T PF08352_consen   14 RHPYTRALLAAV   25 (64)
T ss_pred             cCHHHHHHHHcC
Confidence            599999999985


No 11 
>TIGR02973 nitrate_rd_NapE periplasmic nitrate reductase, NapE protein. NapE, homologous to TorE (TIGR02972), is a membrane protein of unknown function that is part of the periplasmic nitrate reductase system; it may be part of the enzyme complex. The periplasmic nitrate reductase allows for nitrate respiration in anaerobic conditions.
Probab=26.26  E-value=1e+02  Score=17.61  Aligned_cols=16  Identities=19%  Similarity=0.245  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q psy7033          69 DLSKIILIFPYYCLLY   84 (107)
Q Consensus        69 ~~~~~~~~~Pll~l~y   84 (107)
                      +.+..++++|++++..
T Consensus         8 flfl~~~l~PiLsV~~   23 (42)
T TIGR02973         8 FLFLAAVIWPVLSVIT   23 (42)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3445677999999874


No 12 
>COG0163 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism]
Probab=25.61  E-value=36  Score=25.56  Aligned_cols=21  Identities=43%  Similarity=0.559  Sum_probs=17.4

Q ss_pred             chhhhhHhhhcchhhhhhhhc
Q psy7033           2 SESGLAQVATGIGDKLITHRC   22 (107)
Q Consensus         2 ~~~~~~~~~~~~g~~ll~~~~   22 (107)
                      |-..||+.|+|++|+|+++..
T Consensus        90 SmkTla~IA~G~~dnLi~RAA  110 (191)
T COG0163          90 SMKTLAAIAHGFADNLITRAA  110 (191)
T ss_pred             cHHHHHHHHhcccccHHHHHH
Confidence            446799999999999998743


No 13 
>COG4459 NapE Periplasmic nitrate reductase system, NapE component [Energy production and conversion]
Probab=25.51  E-value=1.5e+02  Score=18.26  Aligned_cols=28  Identities=11%  Similarity=0.066  Sum_probs=15.5

Q ss_pred             CCCCcccchHHHHHHHHHHHHHHHHHHHHH
Q psy7033          55 LPGFRRKPLLEKLLDLSKIILIFPYYCLLY   84 (107)
Q Consensus        55 l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y   84 (107)
                      .+.-++++ -|+. +.+..+-+||++++.+
T Consensus        12 v~~~~~r~-e~it-Fl~la~~l~PilsV~~   39 (62)
T COG4459          12 VKPSEKRS-EWIT-FLFLAFGLFPILSVAF   39 (62)
T ss_pred             CCcchhhh-HHHH-HHHHHHHHHHHHHHHH
Confidence            33444444 2222 3334456899999875


No 14 
>PF04342 DUF486:  Protein of unknown function, DUF486;  InterPro: IPR007437 This family contains several proteins of uncharacterised function.
Probab=25.12  E-value=1.8e+02  Score=19.99  Aligned_cols=45  Identities=18%  Similarity=0.246  Sum_probs=24.6

Q ss_pred             HHHHHHHHhcCCCCCcccchHHHHHHHHHHHHHHHHHHHHHHHh-cCCcccc
Q psy7033          44 QQLLAAMWYDGLPGFRRKPLLEKLLDLSKIILIFPYYCLLYMIS-GMSDTGK   94 (107)
Q Consensus        44 Q~~L~~~Wy~~l~~~~~~~~~~k~l~~~~~~~~~Pll~l~y~i~-P~s~~g~   94 (107)
                      --.++--|||.+....+++ ++..++.     -+=+-..-|.+. |..|+|.
T Consensus        11 N~FMTfAWYGHLK~~~~~p-l~~ail~-----SWgIAffEY~l~VPANRiG~   56 (108)
T PF04342_consen   11 NIFMTFAWYGHLKFKSSKP-LWIAILI-----SWGIAFFEYCLQVPANRIGY   56 (108)
T ss_pred             HHHHHHHHHHHhhccccCc-HHHHHHH-----HHHHHHHHHHHhCcchhhhc
Confidence            3467778999987544444 3333222     222222345554 7778774


No 15 
>cd01053 AOX Alternative oxidase, ferritin-like diiron-binding domain. Alternative oxidase (AOX) is a mitochondrial ubiquinol oxidase found in plants and some fungi and protists. AOX is a member of the ferritin-like diiron-carboxylate superfamily. The plant mitochondrial protein alternative oxidase catalyses dioxygen dependent ubiquinol oxidation to yield ubiquinone and water. AOX is a cyanide-resistant, salicylhydroxamic acid-sensitive oxidase that transfers electrons from ubiquinol to oxygen, bypassing the cytochrome chain. AOX has been proposed to contain a hydroxo-bridged diiron center within a four-helix bundle and a proximal redox-active tyrosine residue. AOX is proposed to be peripherally associated with the matrix side of the inner mitochondrial membrane. Fungal and protozoan AOXs generally exist as monomers. In plants, AOX is dimeric. Pyruvate is an allosteric activator of plant AOX involved in the reversible inactivation of the enzyme though the formation of an intermolecular 
Probab=23.91  E-value=1.2e+02  Score=22.23  Aligned_cols=32  Identities=19%  Similarity=0.191  Sum_probs=26.5

Q ss_pred             cccchHHHHHHHHHHHHHHHHHHHHHHHhcCC
Q psy7033          59 RRKPLLEKLLDLSKIILIFPYYCLLYMISGMS   90 (107)
Q Consensus        59 ~~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s   90 (107)
                      +..+.+.+.+.....++.+=++++.|++.|+.
T Consensus        63 ~~p~~~~r~~v~~~q~vfy~~~~~~YlisPr~   94 (168)
T cd01053          63 GGPGWWFRRFVAQHQAVFYNAYFLLYLISPRL   94 (168)
T ss_pred             cCCcHHHHHHHHHHHHHHHHHHHHHHHhhHHH
Confidence            34557788888888888999999999999975


No 16 
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal. In most bacteria, a single bifunctional protein catalyses phosphopantothenoylcysteine decarboxylase and phosphopantothenate--cysteine ligase activities, sequential steps in coenzyme A biosynthesis (see TIGR00521). These activities reside in separate proteins encoded by tandem genes in some bacterial lineages. This model describes proteins from the genera Streptococcus and Enterococcus homologous to the N-terminal region of TIGR00521, corresponding to phosphopantothenoylcysteine decarboxylase activity.
Probab=23.64  E-value=60  Score=23.52  Aligned_cols=52  Identities=13%  Similarity=0.142  Sum_probs=31.7

Q ss_pred             chhhhhHhhhcchhhhhhhhcCCCC---cccccccccc-ceeehhHHHHHHHHHhc
Q psy7033           2 SESGLAQVATGIGDKLITHRCQSHK---YQPLPTNFFQ-FVAHSNIQQLLAAMWYD   53 (107)
Q Consensus         2 ~~~~~~~~~~~~g~~ll~~~~~~~~---~L~lAi~~~q-FVAHp~~Q~~L~~~Wy~   53 (107)
                      |-..++..|+|++|++++.....+.   .+-.|-.-+. =-.||-.|+-+..+--.
T Consensus        86 SanTlakiA~GiaDnLlt~~a~a~~~~~pv~i~PaMn~~M~~~p~~~~nl~~L~~~  141 (177)
T TIGR02113        86 SANTIAHLAHGFADNIVTSVALALPPETPKLIAPAMNTKMYQNPITQRNIKILKKI  141 (177)
T ss_pred             CHHHHHHHHcCcCCcHHHHHHHHcCCCCCEEEEeCCCHHHhCCHHHHHHHHHHHHC
Confidence            3456889999999999987555431   1111111111 23488888888887543


No 17 
>PF01786 AOX:  Alternative oxidase;  InterPro: IPR002680 The alternative oxidase is used as a second terminal oxidase in the mitochondria, electrons are transferred directly from reduced ubiquinol to oxygen forming water []. This is not coupled to ATP synthesis and is not inhibited by cyanide, this pathway is a single step process []. In Oryza sativa (Rice) the transcript levels of the alternative oxidase are increased by low temperature []. It has been predicted to contain a coupled diiron centre on the basis of a conserved sequence motif consisting of the proposed iron ligands, four Glu and two His residues []. The EPR study of Arabidopsis thaliana (Mouse-ear cress) alternative oxidase AOX1a shows that the enzyme contains a hydroxo-bridged mixed-valent Fe(II)/Fe(III) binuclear iron centre []. A catalytic cycle has been proposed that involves diiron centre and at least one transient protein-derived radical, most probably an invariant Tyr residue [].; GO: 0007585 respiratory gaseous exchange, 0055114 oxidation-reduction process, 0005740 mitochondrial envelope
Probab=22.15  E-value=1.1e+02  Score=23.00  Aligned_cols=31  Identities=19%  Similarity=0.452  Sum_probs=26.4

Q ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHhcCC
Q psy7033          60 RKPLLEKLLDLSKIILIFPYYCLLYMISGMS   90 (107)
Q Consensus        60 ~~~~~~k~l~~~~~~~~~Pll~l~y~i~P~s   90 (107)
                      ..+++-+.+.....++.+-++++.|++.|+.
T Consensus       104 ~p~~~~R~lv~~~q~vf~~~~~~~Yl~sPr~  134 (207)
T PF01786_consen  104 KPSWFDRFLVLHAQGVFYNIFFLLYLVSPRT  134 (207)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHHHcCHHH
Confidence            4456778888888999999999999999976


Done!