Query         psy7060
Match_columns 160
No_of_seqs    117 out of 303
Neff          2.9 
Searched_HMMs 46136
Date          Fri Aug 16 17:06:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7060.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7060hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1486|consensus              100.0 5.7E-52 1.2E-56  360.5  12.6  124    1-160   146-269 (364)
  2 COG1163 DRG Predicted GTPase [ 100.0 4.9E-41 1.1E-45  295.4  13.6  124    1-160   147-270 (365)
  3 KOG1487|consensus              100.0 2.1E-37 4.6E-42  269.8   6.4  120    1-160   143-262 (358)
  4 cd01896 DRG The developmentall 100.0 5.6E-35 1.2E-39  235.0  14.6  124    1-160    84-207 (233)
  5 cd01899 Ygr210 Ygr210 subfamil  98.9 1.5E-10 3.2E-15   99.3  -0.5  118    7-160   127-249 (318)
  6 PRK09602 translation-associate  98.7 5.4E-09 1.2E-13   92.1   2.0  116    7-160   130-251 (396)
  7 KOG1486|consensus               94.9  0.0069 1.5E-07   54.4  -0.1   19   54-72    199-217 (364)
  8 COG2262 HflX GTPases [General   94.6   0.033 7.1E-07   51.2   3.3   31  130-160   305-337 (411)
  9 TIGR03156 GTP_HflX GTP-binding  90.9    0.38 8.3E-06   42.0   4.6   81   78-160   239-333 (351)
 10 cd01858 NGP_1 NGP-1.  Autoanti  90.2    0.35 7.5E-06   36.1   3.3   19  130-148    40-58  (157)
 11 cd01857 HSR1_MMR1 HSR1/MMR1.    90.2     0.4 8.7E-06   35.4   3.5   32  118-149    31-62  (141)
 12 cd04178 Nucleostemin_like Nucl  89.5    0.43 9.4E-06   37.6   3.4   21  130-150    31-51  (172)
 13 COG1160 Predicted GTPases [Gen  88.7       1 2.3E-05   41.9   5.8   48  111-160    94-146 (444)
 14 smart00174 RHO Rho (Ras homolo  88.3     1.7 3.8E-05   31.6   5.7   21  123-143    96-116 (174)
 15 TIGR02528 EutP ethanolamine ut  87.0     1.7 3.7E-05   30.8   4.9   21  131-151    90-114 (142)
 16 cd01849 YlqF_related_GTPase Yl  86.6    0.62 1.3E-05   34.8   2.6   19  130-148    30-48  (155)
 17 cd01881 Obg_like The Obg-like   86.2    0.77 1.7E-05   33.1   2.8   22  128-149   119-140 (176)
 18 cd01878 HflX HflX subfamily.    86.0       2 4.3E-05   32.8   5.2   19  130-148   154-172 (204)
 19 PTZ00258 GTP-binding protein;   85.4     2.3 4.9E-05   38.6   6.0   53   91-150   186-245 (390)
 20 cd01868 Rab11_like Rab11-like.  83.1       2 4.2E-05   31.1   3.8   23  130-152   109-136 (165)
 21 cd01863 Rab18 Rab18 subfamily.  83.0      11 0.00024   27.0   7.6   28  127-154   104-135 (161)
 22 cd01856 YlqF YlqF.  Proteins o  83.0     1.2 2.7E-05   33.8   2.8   18  130-147    47-64  (171)
 23 cd04164 trmE TrmE (MnmE, ThdF,  83.0    0.69 1.5E-05   32.4   1.3   20  128-147   106-125 (157)
 24 cd01896 DRG The developmentall  82.6     1.4   3E-05   35.9   3.1   34   56-100   139-172 (233)
 25 cd04141 Rit_Rin_Ric Rit/Rin/Ri  82.0     1.4   3E-05   33.3   2.8   26  128-153   106-136 (172)
 26 cd01894 EngA1 EngA1 subfamily.  82.0     1.8   4E-05   30.3   3.2   18  130-147   106-123 (157)
 27 cd04107 Rab32_Rab38 Rab38/Rab3  81.8      10 0.00022   29.2   7.5   28  128-155   109-141 (201)
 28 cd04157 Arl6 Arl6 subfamily.    81.2     8.7 0.00019   27.3   6.5   15  129-143   104-118 (162)
 29 cd04171 SelB SelB subfamily.    80.8      16 0.00035   25.8   7.7   15  130-144   105-119 (164)
 30 cd01862 Rab7 Rab7 subfamily.    80.7     1.9 4.2E-05   31.0   3.0   26  129-154   109-139 (172)
 31 smart00173 RAS Ras subfamily o  80.7     8.7 0.00019   27.6   6.4   25  129-153   105-134 (164)
 32 cd01864 Rab19 Rab19 subfamily.  80.3      14 0.00031   26.8   7.5   26  128-153   107-137 (165)
 33 cd04163 Era Era subfamily.  Er  80.0     3.9 8.4E-05   28.4   4.2   19  130-148   112-131 (168)
 34 PRK10463 hydrogenase nickel in  79.5       2 4.4E-05   37.6   3.3   67   76-143   156-244 (290)
 35 cd04112 Rab26 Rab26 subfamily.  79.5      14  0.0003   28.2   7.5   26  128-153   105-135 (191)
 36 PF00009 GTP_EFTU:  Elongation   79.5      11 0.00023   28.8   6.9   51   90-142    80-135 (188)
 37 cd04139 RalA_RalB RalA/RalB su  79.3       2 4.4E-05   30.4   2.7   14  130-143   106-119 (164)
 38 cd01893 Miro1 Miro1 subfamily.  78.8      11 0.00023   27.7   6.5   46   98-144    65-118 (166)
 39 cd01892 Miro2 Miro2 subfamily.  78.8     6.5 0.00014   29.5   5.4   15  129-143   108-122 (169)
 40 cd01861 Rab6 Rab6 subfamily.    78.6       4 8.7E-05   29.2   4.1   26  129-154   105-135 (161)
 41 cd01859 MJ1464 MJ1464.  This f  78.4     1.7 3.7E-05   32.0   2.2   20  130-149    42-61  (156)
 42 cd04127 Rab27A Rab27a subfamil  78.3      17 0.00037   26.7   7.4   24  130-153   121-149 (180)
 43 cd01898 Obg Obg subfamily.  Th  77.9     2.3 4.9E-05   30.7   2.6   19  128-146   113-131 (170)
 44 cd04151 Arl1 Arl1 subfamily.    77.6     3.5 7.6E-05   29.9   3.6   15  129-143   100-114 (158)
 45 COG1163 DRG Predicted GTPase [  77.4     8.1 0.00018   35.6   6.6   23   56-78    202-224 (365)
 46 cd00879 Sar1 Sar1 subfamily.    77.1      25 0.00054   26.2   8.2   25  129-153   120-147 (190)
 47 PRK00089 era GTPase Era; Revie  76.9      10 0.00022   31.1   6.5   18  130-147   114-132 (292)
 48 cd01866 Rab2 Rab2 subfamily.    76.6       4 8.7E-05   30.1   3.7   25  128-152   108-137 (168)
 49 cd04106 Rab23_lke Rab23-like s  76.6     3.3 7.1E-05   29.7   3.1   24  129-152   106-134 (162)
 50 PRK12289 GTPase RsgA; Reviewed  76.5     3.4 7.4E-05   36.6   3.8   20  130-149   121-140 (352)
 51 cd01888 eIF2_gamma eIF2-gamma   76.4      15 0.00032   28.7   7.1   56   90-146    93-154 (203)
 52 cd01867 Rab8_Rab10_Rab13_like   76.3       3 6.4E-05   30.6   2.9   25  128-152   107-136 (167)
 53 cd04116 Rab9 Rab9 subfamily.    76.1     3.4 7.4E-05   30.1   3.2   27  128-154   113-143 (170)
 54 cd04175 Rap1 Rap1 subgroup.  T  76.0     2.5 5.5E-05   30.6   2.5   23  130-152   107-134 (164)
 55 cd00881 GTP_translation_factor  76.0       2 4.3E-05   31.2   1.9   16  130-145   115-130 (189)
 56 cd00880 Era_like Era (E. coli   75.8     2.8   6E-05   28.4   2.5   23  127-149   102-124 (163)
 57 TIGR00231 small_GTP small GTP-  75.8     4.2   9E-05   27.5   3.4   15  129-143   108-122 (161)
 58 cd01876 YihA_EngB The YihA (En  75.5     4.7  0.0001   28.1   3.6   27  119-147   102-128 (170)
 59 PRK04213 GTP-binding protein;   75.4     2.7 5.9E-05   31.9   2.6   16  129-144   130-145 (201)
 60 cd04110 Rab35 Rab35 subfamily.  75.3     4.6  0.0001   31.2   3.9   30  123-152   104-138 (199)
 61 TIGR00436 era GTP-binding prot  75.3     3.6 7.8E-05   33.8   3.5   17  130-146   108-124 (270)
 62 cd04160 Arfrp1 Arfrp1 subfamil  75.1      12 0.00025   27.0   5.7   17  128-144   106-122 (167)
 63 cd04155 Arl3 Arl3 subfamily.    74.9      14  0.0003   26.9   6.1   17  128-144   114-130 (173)
 64 cd04158 ARD1 ARD1 subfamily.    74.8      21 0.00046   26.4   7.2   24  130-153   101-127 (169)
 65 cd04136 Rap_like Rap-like subf  74.6     3.5 7.6E-05   29.4   2.9   23  130-152   107-134 (163)
 66 cd04101 RabL4 RabL4 (Rab-like4  74.5     2.1 4.6E-05   30.8   1.7   17  128-144   106-122 (164)
 67 cd04146 RERG_RasL11_like RERG/  74.3       4 8.6E-05   29.7   3.1   23  129-151   106-133 (165)
 68 PLN00223 ADP-ribosylation fact  73.8      15 0.00032   28.2   6.3   26  129-154   118-146 (181)
 69 TIGR02729 Obg_CgtA Obg family   73.7       3 6.6E-05   36.2   2.8   21  130-150   274-294 (329)
 70 cd04144 Ras2 Ras2 subfamily.    73.7     5.5 0.00012   30.3   3.9   22  130-151   107-133 (190)
 71 cd04138 H_N_K_Ras_like H-Ras/N  73.6     4.2 9.2E-05   28.6   3.0   24  128-151   105-132 (162)
 72 TIGR03597 GTPase_YqeH ribosome  73.2     4.6  0.0001   35.3   3.8   51   89-143    48-104 (360)
 73 cd04130 Wrch_1 Wrch-1 subfamil  72.8     5.2 0.00011   29.6   3.5   24  120-143    95-118 (173)
 74 cd01897 NOG NOG1 is a nucleola  72.2     3.3 7.1E-05   29.9   2.3   19  130-148   114-132 (168)
 75 cd04125 RabA_like RabA-like su  72.1     6.9 0.00015   29.5   4.1   24  129-152   105-133 (188)
 76 cd04132 Rho4_like Rho4-like su  71.7     5.9 0.00013   29.5   3.6   25  129-153   105-138 (187)
 77 PRK12288 GTPase RsgA; Reviewed  71.7     5.4 0.00012   35.2   3.9   16  130-145   151-166 (347)
 78 cd01890 LepA LepA subfamily.    71.3     5.9 0.00013   29.0   3.5   14  130-143   120-133 (179)
 79 TIGR03596 GTPase_YlqF ribosome  71.2     3.8 8.2E-05   34.1   2.7   20  130-149    49-68  (276)
 80 cd01889 SelB_euk SelB subfamil  71.2      21 0.00046   27.2   6.6   17  129-145   120-136 (192)
 81 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  71.0     5.3 0.00011   31.1   3.3   14  128-141   108-121 (182)
 82 cd04114 Rab30 Rab30 subfamily.  70.9     3.1 6.8E-05   30.1   1.9   14  130-143   113-126 (169)
 83 cd04165 GTPBP1_like GTPBP1-lik  70.4     6.3 0.00014   32.2   3.8   56   91-148    95-157 (224)
 84 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  70.4      24 0.00052   29.2   7.2   20  123-142   111-130 (232)
 85 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  70.4      16 0.00035   26.4   5.6   25  129-153   107-136 (166)
 86 cd01895 EngA2 EngA2 subfamily.  70.4     4.2 9.2E-05   28.7   2.4   15  130-144   114-128 (174)
 87 cd04122 Rab14 Rab14 subfamily.  70.3      39 0.00085   24.6   8.0   25  129-153   107-136 (166)
 88 cd04159 Arl10_like Arl10-like   70.3     3.2 6.9E-05   28.7   1.8   17  129-145   101-117 (159)
 89 cd04124 RabL2 RabL2 subfamily.  70.1     3.9 8.5E-05   30.0   2.3   23  120-142    95-117 (161)
 90 cd01855 YqeH YqeH.  YqeH is an  69.9     6.7 0.00015   30.0   3.6   52   92-144    22-76  (190)
 91 cd04137 RheB Rheb (Ras Homolog  69.9     4.9 0.00011   29.7   2.8   25  128-152   105-134 (180)
 92 cd04167 Snu114p Snu114p subfam  69.5      14  0.0003   29.0   5.4   13  130-142   124-136 (213)
 93 smart00178 SAR Sar1p-like memb  69.0      47   0.001   25.3   8.1   25  129-153   118-145 (184)
 94 TIGR00157 ribosome small subun  68.9     6.2 0.00013   32.6   3.5   18  129-146    67-84  (245)
 95 cd04115 Rab33B_Rab33A Rab33B/R  68.8     8.9 0.00019   28.3   4.0   27  128-154   108-139 (170)
 96 cd04131 Rnd Rnd subfamily.  Th  68.6     6.4 0.00014   30.3   3.3   13  129-141   105-117 (178)
 97 TIGR00412 redox_disulf_2 small  68.6     6.7 0.00015   26.6   3.1   49   81-135     7-55  (76)
 98 PRK00454 engB GTP-binding prot  68.5     5.6 0.00012   29.7   2.9   22  127-148   133-154 (196)
 99 cd04154 Arl2 Arl2 subfamily.    68.1       6 0.00013   29.3   2.9   23  129-151   115-140 (173)
100 cd01860 Rab5_related Rab5-rela  68.0     9.4  0.0002   27.3   3.9   25  128-152   105-134 (163)
101 cd04161 Arl2l1_Arl13_like Arl2  67.9      25 0.00055   26.1   6.3   16  128-143    99-114 (167)
102 cd04152 Arl4_Arl7 Arl4/Arl7 su  67.4      44 0.00095   25.3   7.6   24  128-151   108-134 (183)
103 cd03418 GRX_GRXb_1_3_like Glut  67.4      13 0.00029   24.0   4.2   62   82-151     8-72  (75)
104 PRK12299 obgE GTPase CgtA; Rev  67.3      12 0.00027   32.6   5.2   17  130-146   272-288 (335)
105 cd04145 M_R_Ras_like M-Ras/R-R  66.9     2.7 5.9E-05   30.0   0.9   23  129-151   107-134 (164)
106 COG1084 Predicted GTPase [Gene  66.9      44 0.00094   30.7   8.6   67   84-151   228-302 (346)
107 TIGR03598 GTPase_YsxC ribosome  66.8       6 0.00013   29.8   2.8   17  129-145   129-145 (179)
108 cd04104 p47_IIGP_like p47 (47-  66.7      12 0.00025   29.2   4.4   48   94-143    69-121 (197)
109 cd00878 Arf_Arl Arf (ADP-ribos  66.6     6.4 0.00014   28.2   2.8   26  128-153    99-127 (158)
110 smart00053 DYNc Dynamin, GTPas  66.2      15 0.00033   31.0   5.3   54   91-144   148-207 (240)
111 cd04109 Rab28 Rab28 subfamily.  66.1      10 0.00023   29.6   4.1   25  129-153   109-138 (215)
112 cd04140 ARHI_like ARHI subfami  66.1     7.1 0.00015   28.6   3.0   15  129-143   108-122 (165)
113 TIGR00750 lao LAO/AO transport  65.9     5.6 0.00012   33.6   2.7   30  116-146   160-189 (300)
114 PRK11058 GTPase HflX; Provisio  65.9      24 0.00053   31.9   6.9   15  129-143   309-323 (426)
115 TIGR02194 GlrX_NrdH Glutaredox  65.8      17 0.00038   23.9   4.6   63   81-150     6-71  (72)
116 cd04134 Rho3 Rho3 subfamily.    65.5      10 0.00022   29.0   3.8   24  121-144    96-119 (189)
117 cd01850 CDC_Septin CDC/Septin.  65.1      14 0.00031   31.1   5.0   28  120-150   137-164 (276)
118 PRK09563 rbgA GTPase YlqF; Rev  64.9      25 0.00055   29.5   6.4   27  118-148    44-70  (287)
119 cd04142 RRP22 RRP22 subfamily.  64.8     9.5 0.00021   30.0   3.7   53  100-152    77-144 (198)
120 cd01865 Rab3 Rab3 subfamily.    64.7      52  0.0011   24.0   7.4   23  129-151   106-133 (165)
121 cd00882 Ras_like_GTPase Ras-li  64.5       8 0.00017   25.5   2.7   23  124-146    97-119 (157)
122 PLN03108 Rab family protein; P  64.4      58  0.0013   25.5   8.0   26  128-153   110-140 (210)
123 cd01871 Rac1_like Rac1-like su  64.3      11 0.00023   28.6   3.8   14  129-142   105-118 (174)
124 cd00154 Rab Rab family.  Rab G  64.1     7.6 0.00016   26.7   2.7   24  130-153   106-134 (159)
125 cd01879 FeoB Ferrous iron tran  63.8     3.4 7.4E-05   29.2   0.9   15  130-144   102-116 (158)
126 PRK12298 obgE GTPase CgtA; Rev  63.7     7.5 0.00016   34.7   3.2   18  130-147   276-293 (390)
127 cd04119 RJL RJL (RabJ-Like) su  63.6     7.1 0.00015   27.7   2.5   23  130-152   111-138 (168)
128 smart00175 RAB Rab subfamily o  63.6     8.6 0.00019   27.3   2.9   24  129-152   105-133 (164)
129 cd01854 YjeQ_engC YjeQ/EngC.    63.5     7.6 0.00016   32.8   3.0   16  130-145   110-125 (287)
130 cd04162 Arl9_Arfrp2_like Arl9/  63.3     7.7 0.00017   28.9   2.8   16  128-143    98-113 (164)
131 PRK00093 GTP-binding protein D  63.3     6.7 0.00015   34.0   2.8   19  129-147   284-302 (435)
132 PRK13796 GTPase YqeH; Provisio  63.3      20 0.00044   31.4   5.8   52   89-143    54-110 (365)
133 TIGR03594 GTPase_EngA ribosome  62.7       7 0.00015   33.7   2.8   16  130-145   284-300 (429)
134 PTZ00133 ADP-ribosylation fact  62.6      36 0.00077   26.0   6.4   14  129-142   118-131 (182)
135 PRK10597 DNA damage-inducible   62.5      22 0.00049   26.2   5.0   50    9-64     16-69  (81)
136 cd04149 Arf6 Arf6 subfamily.    62.3      55  0.0012   24.5   7.3   22  129-150   110-134 (168)
137 cd01875 RhoG RhoG subfamily.    62.0      14 0.00031   28.3   4.1   14  129-142   107-120 (191)
138 cd00157 Rho Rho (Ras homology)  61.9     5.5 0.00012   28.6   1.7   22  123-144    98-119 (171)
139 cd04148 RGK RGK subfamily.  Th  61.9     4.4 9.6E-05   32.3   1.3   16  128-143   105-120 (221)
140 KOG4252|consensus               61.7     5.3 0.00012   34.7   1.8   94   60-155    35-155 (246)
141 cd04153 Arl5_Arl8 Arl5/Arl8 su  61.5     5.9 0.00013   29.6   1.9   14  129-142   116-129 (174)
142 cd04156 ARLTS1 ARLTS1 subfamil  61.5      56  0.0012   23.3   7.8   22  129-150   101-125 (160)
143 PLN03118 Rab family protein; P  60.9      69  0.0015   24.8   7.8   25  128-152   119-148 (211)
144 cd00876 Ras Ras family.  The R  60.5      15 0.00033   25.7   3.8   25  128-152   103-132 (160)
145 cd04121 Rab40 Rab40 subfamily.  60.4      13 0.00028   29.3   3.7   26  128-153   109-139 (189)
146 PF13192 Thioredoxin_3:  Thiore  60.3      18 0.00039   24.4   3.9   51   80-136     6-56  (76)
147 PRK12297 obgE GTPase CgtA; Rev  60.1      12 0.00027   34.1   4.0   23  129-151   274-297 (424)
148 PF06207 DUF1002:  Protein of u  60.0      23 0.00051   30.1   5.4   53   30-116    53-106 (225)
149 COG2229 Predicted GTPase [Gene  59.9      24 0.00052   29.8   5.4   51  103-155    92-150 (187)
150 cd04120 Rab12 Rab12 subfamily.  59.3      13 0.00028   29.7   3.5   25  128-152   104-133 (202)
151 PRK05291 trmE tRNA modificatio  59.3     5.8 0.00013   35.7   1.7   18  130-147   322-339 (449)
152 PRK15494 era GTPase Era; Provi  59.1      35 0.00076   29.5   6.4   14  130-143   161-174 (339)
153 cd01887 IF2_eIF5B IF2/eIF5B (i  59.1     5.8 0.00013   28.4   1.4   14  130-143   103-116 (168)
154 cd04135 Tc10 TC10 subfamily.    58.9      15 0.00032   26.7   3.6   16  127-142   102-117 (174)
155 cd01886 EF-G Elongation factor  58.8     8.4 0.00018   32.4   2.5   49   93-143    77-130 (270)
156 PRK00098 GTPase RsgA; Reviewed  58.5      12 0.00025   31.8   3.3   14  129-142   111-124 (298)
157 PRK13675 GTP cyclohydrolase; P  57.7      14  0.0003   32.7   3.8   26  101-126   191-224 (308)
158 cd04143 Rhes_like Rhes_like su  57.4      42 0.00091   27.7   6.4   25  128-152   112-141 (247)
159 TIGR02200 GlrX_actino Glutared  57.3      24 0.00052   22.4   4.0   53   81-137     7-59  (77)
160 COG3052 CitD Citrate lyase, ga  57.2      14  0.0003   28.6   3.2   61   29-121    16-76  (98)
161 smart00177 ARF ARF-like small   56.6      73  0.0016   23.9   7.1   21  130-150   115-138 (175)
162 cd04113 Rab4 Rab4 subfamily.    56.6      12 0.00025   27.0   2.6   22  130-151   106-132 (161)
163 PF06857 ACP:  Malonate decarbo  56.2      33 0.00072   25.3   5.0   30   90-119    44-73  (87)
164 KOG1752|consensus               56.2      24 0.00052   26.6   4.3   64   82-150    22-87  (104)
165 cd04133 Rop_like Rop subfamily  56.1      10 0.00023   29.4   2.5   25  130-154   106-145 (176)
166 cd04168 TetM_like Tet(M)-like   55.9      13 0.00029   30.4   3.2   24  118-143   107-130 (237)
167 cd01883 EF1_alpha Eukaryotic e  55.5      11 0.00024   29.9   2.6   13  130-142   138-150 (219)
168 PRK13768 GTPase; Provisional    55.3     7.8 0.00017   32.1   1.7   23  128-150   161-183 (253)
169 cd04123 Rab21 Rab21 subfamily.  55.0      14  0.0003   26.0   2.7   23  130-152   106-133 (162)
170 cd01873 RhoBTB RhoBTB subfamil  54.9      17 0.00036   28.7   3.5   14  129-142   120-133 (195)
171 cd04150 Arf1_5_like Arf1-Arf5-  54.6      57  0.0012   24.0   6.1   13  130-142   102-114 (159)
172 PLN03110 Rab GTPase; Provision  54.5      47   0.001   26.2   6.0   24  130-153   118-146 (216)
173 cd04129 Rho2 Rho2 subfamily.    54.3      19 0.00041   27.3   3.6   14  129-142   105-118 (187)
174 TIGR02183 GRXA Glutaredoxin, G  53.6      45 0.00099   23.0   5.2   68   82-154     8-81  (86)
175 PF01189 Nol1_Nop2_Fmu:  NOL1/N  53.6     7.6 0.00016   33.0   1.5   45    9-65    193-238 (283)
176 PRK01889 GTPase RsgA; Reviewed  53.6      20 0.00043   31.4   4.1   26  117-144   132-157 (356)
177 PF08477 Miro:  Miro-like prote  52.8      13 0.00027   25.6   2.2   13  128-140   107-119 (119)
178 KOG1489|consensus               52.3      13 0.00029   34.2   2.9   36  125-160   308-348 (366)
179 cd01885 EF2 EF2 (for archaea a  51.7      14 0.00031   30.3   2.7   13  130-142   126-138 (222)
180 PRK12296 obgE GTPase CgtA; Rev  51.2      12 0.00025   35.2   2.4   19  128-146   283-301 (500)
181 TIGR00483 EF-1_alpha translati  51.1      64  0.0014   28.5   6.8   14  130-143   142-155 (426)
182 TIGR02189 GlrX-like_plant Glut  51.0      47   0.001   23.9   5.0   64   82-150    16-81  (99)
183 cd04108 Rab36_Rab34 Rab34/Rab3  50.5      63  0.0014   24.2   5.9   14  130-143   107-120 (170)
184 PRK09518 bifunctional cytidyla  50.3      20 0.00044   34.2   3.8   18  129-146   561-578 (712)
185 cd04105 SR_beta Signal recogni  50.3      44 0.00095   26.4   5.2   15  129-143   109-123 (203)
186 PRK00093 GTP-binding protein D  50.2      18 0.00039   31.4   3.3   40  119-160   101-143 (435)
187 cd01884 EF_Tu EF-Tu subfamily.  50.0      15 0.00032   29.3   2.5   52   91-144    76-133 (195)
188 COG0536 Obg Predicted GTPase [  49.9      15 0.00032   34.0   2.8   21  130-150   276-297 (369)
189 cd04117 Rab15 Rab15 subfamily.  49.6      19 0.00041   26.5   2.9   24  129-152   105-133 (161)
190 cd04176 Rap2 Rap2 subgroup.  T  49.5      10 0.00022   27.3   1.4   14  129-142   106-119 (163)
191 PRK03003 GTP-binding protein D  49.2      15 0.00031   33.1   2.6   16  129-144   322-337 (472)
192 PF00025 Arf:  ADP-ribosylation  49.0      27 0.00059   26.6   3.8   33  118-150   103-139 (175)
193 TIGR01393 lepA GTP-binding pro  48.7      72  0.0016   30.2   7.2   14  130-143   123-136 (595)
194 TIGR02181 GRX_bact Glutaredoxi  48.4      44 0.00095   22.0   4.3   64   81-151     6-70  (79)
195 cd01615 CIDE_N CIDE_N domain,   47.8      16 0.00034   26.9   2.1   59   64-129     4-67  (78)
196 PTZ00327 eukaryotic translatio  47.8      17 0.00036   33.5   2.8   56   91-147   128-189 (460)
197 cd04166 CysN_ATPS CysN_ATPS su  47.7      20 0.00044   28.1   2.9   13  131-143   132-144 (208)
198 cd04126 Rab20 Rab20 subfamily.  47.2      32 0.00068   28.1   4.1   15  129-143   100-114 (220)
199 TIGR00475 selB selenocysteine-  46.6      71  0.0015   30.1   6.7   18  130-147   103-121 (581)
200 cd02966 TlpA_like_family TlpA-  46.6      61  0.0013   20.9   4.6   43   90-138    64-106 (116)
201 cd01874 Cdc42 Cdc42 subfamily.  46.4      21 0.00046   27.0   2.8   15  129-143   105-119 (175)
202 cd04147 Ras_dva Ras-dva subfam  46.3      13 0.00029   28.5   1.6   15  129-143   104-118 (198)
203 PF06858 NOG1:  Nucleolar GTP-b  46.2      12 0.00026   26.2   1.3   12  129-140    47-58  (58)
204 cd01891 TypA_BipA TypA (tyrosi  46.0      13 0.00029   28.3   1.6   14  129-142   117-130 (194)
205 TIGR03680 eif2g_arch translati  45.2      89  0.0019   27.7   6.8   55   91-146    91-151 (406)
206 COG0523 Putative GTPases (G3E   45.1      19 0.00041   31.8   2.6   18  133-150   149-166 (323)
207 cd04177 RSR1 RSR1 subgroup.  R  44.9      26 0.00057   25.6   3.0   14  129-142   106-119 (168)
208 PRK03003 GTP-binding protein D  44.4      23 0.00049   31.9   3.0   24  118-143   137-160 (472)
209 PF02421 FeoB_N:  Ferrous iron   43.8      31 0.00067   27.4   3.4   52   90-142    66-118 (156)
210 PTZ00369 Ras-like protein; Pro  43.5      24 0.00052   26.8   2.7   14  129-142   110-123 (189)
211 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  43.2 1.4E+02  0.0029   24.5   7.2   14  129-142   105-118 (222)
212 PF05193 Peptidase_M16_C:  Pept  43.1      61  0.0013   22.8   4.5   37   89-125     2-39  (184)
213 CHL00071 tufA elongation facto  43.0      23 0.00049   31.4   2.8   54   91-146    86-145 (409)
214 PRK12739 elongation factor G;   42.9      22 0.00047   33.8   2.8   25  118-144   116-140 (691)
215 TIGR00485 EF-Tu translation el  42.8      34 0.00074   30.0   3.8   19  127-145   125-144 (394)
216 TIGR00073 hypB hydrogenase acc  42.6      19 0.00042   28.3   2.1   14  130-143   149-162 (207)
217 PRK13674 putative GTP cyclohyd  42.5      21 0.00047   31.0   2.5   42   77-126   147-196 (271)
218 cd01870 RhoA_like RhoA-like su  42.4      26 0.00056   25.5   2.6   15  129-143   105-119 (175)
219 PHA01631 hypothetical protein   42.3      22 0.00048   29.9   2.5   49   91-139    57-107 (176)
220 cd00877 Ran Ran (Ras-related n  42.2      22 0.00047   26.4   2.2   14  129-142   104-117 (166)
221 PRK09866 hypothetical protein;  42.2      39 0.00085   33.8   4.5   13  131-143   291-303 (741)
222 cd04118 Rab24 Rab24 subfamily.  41.5      29 0.00063   26.0   2.8   14  130-143   106-119 (193)
223 PLN03126 Elongation factor Tu;  41.3      23 0.00051   32.6   2.7   54   91-146   155-214 (478)
224 cd06535 CIDE_N_CAD CIDE_N doma  40.9      23  0.0005   26.1   2.1   57   65-129     5-66  (77)
225 PF14297 DUF4373:  Domain of un  40.5      23  0.0005   24.9   2.0   20   88-107    57-76  (87)
226 COG0012 Predicted GTPase, prob  40.4      22 0.00047   32.7   2.3   47  114-160   190-245 (372)
227 PRK09518 bifunctional cytidyla  39.5 1.1E+02  0.0024   29.3   6.9   52   91-144   342-398 (712)
228 cd04111 Rab39 Rab39 subfamily.  39.0      31 0.00067   27.2   2.7   24  130-153   110-138 (211)
229 KOG2484|consensus               38.8      35 0.00077   32.2   3.5   58   90-150   129-198 (435)
230 PF00071 Ras:  Ras family;  Int  38.6      44 0.00096   23.9   3.3   53  101-153    69-133 (162)
231 cd02997 PDI_a_PDIR PDIa family  38.6      43 0.00092   22.3   3.0   59   81-139    26-85  (104)
232 COG1161 Predicted GTPases [Gen  38.4      23  0.0005   30.7   2.1   55   91-149    21-81  (322)
233 TIGR00294 conserved hypothetic  38.4      33 0.00072   29.8   3.1   26  101-126   189-222 (308)
234 PRK12736 elongation factor Tu;  38.4   1E+02  0.0022   27.1   6.1   53   91-145    86-144 (394)
235 cd02995 PDI_a_PDI_a'_C PDIa fa  38.4      62  0.0013   21.5   3.8   59   80-140    26-84  (104)
236 smart00266 CAD Domains present  38.4      26 0.00057   25.5   2.1   58   65-129     3-65  (74)
237 TIGR01608 citD citrate lyase a  38.3      61  0.0013   24.7   4.1   30   91-120    46-75  (92)
238 PRK13580 serine hydroxymethylt  38.1      44 0.00096   31.5   4.0   37   12-48    384-421 (493)
239 COG0486 ThdF Predicted GTPase   37.9      32  0.0007   32.5   3.1   48  103-150   294-345 (454)
240 cd04103 Centaurin_gamma Centau  37.7      23 0.00049   26.6   1.7   23  130-152   100-129 (158)
241 PRK15467 ethanolamine utilizat  37.6      45 0.00098   25.1   3.3   15  129-143    91-105 (158)
242 PF03029 ATP_bind_1:  Conserved  37.5      20 0.00043   29.8   1.5   18  126-143   153-170 (238)
243 PRK15367 type III secretion sy  37.3 3.5E+02  0.0076   25.3  10.6  120   10-151   140-274 (395)
244 TIGR02475 CobW cobalamin biosy  37.3      30 0.00065   30.3   2.6   19  132-150   176-194 (341)
245 PRK10076 pyruvate formate lyas  37.3      37 0.00081   28.0   3.1  100   38-152    38-152 (213)
246 KOG1487|consensus               37.3      21 0.00045   32.8   1.7   71   56-126   194-279 (358)
247 PTZ00099 rab6; Provisional      36.7      72  0.0016   24.7   4.4   23  129-151    85-112 (176)
248 KOG0395|consensus               36.7      33 0.00072   27.7   2.6   23  129-151   108-135 (196)
249 PLN03127 Elongation factor Tu;  36.6      51  0.0011   30.1   4.0   26  118-145   167-193 (447)
250 PRK05433 GTP-binding protein L  36.5      69  0.0015   30.4   5.0   14  130-143   127-140 (600)
251 smart00176 RAN Ran (Ras-relate  36.2 1.2E+02  0.0026   24.2   5.7   15  128-142    98-112 (200)
252 TIGR01295 PedC_BrcD bacterioci  35.9 1.8E+02  0.0039   21.6   6.6   72   80-151    31-120 (122)
253 TIGR00550 nadA quinolinate syn  35.5      61  0.0013   28.6   4.3   52   61-117    63-118 (310)
254 cd05025 S-100A1 S-100A1: S-100  35.4      42  0.0009   23.3   2.7   31   89-124    49-79  (92)
255 TIGR03594 GTPase_EngA ribosome  34.9      22 0.00047   30.7   1.4   24  119-144    99-122 (429)
256 KOG2485|consensus               34.8      88  0.0019   28.7   5.2   55   91-148    34-92  (335)
257 COG2151 PaaD Predicted metal-s  34.8      42 0.00091   25.9   2.8   39   81-119    59-100 (111)
258 PLN03071 GTP-binding nuclear p  34.7      28 0.00061   27.7   1.9   15  128-142   116-130 (219)
259 TIGR00450 mnmE_trmE_thdF tRNA   34.5      30 0.00066   31.4   2.3   16  129-144   310-325 (442)
260 PF10662 PduV-EutP:  Ethanolami  33.6      35 0.00076   27.1   2.3   44  107-150    66-111 (143)
261 TIGR00484 EF-G translation elo  33.3      43 0.00093   31.8   3.1   24  118-143   118-141 (689)
262 PRK10512 selenocysteinyl-tRNA-  33.2 1.5E+02  0.0032   28.4   6.7   54   91-146    62-121 (614)
263 PF12307 DUF3631:  Protein of u  33.0      65  0.0014   26.9   3.8   36   89-124   143-182 (184)
264 cd04169 RF3 RF3 subfamily.  Pe  32.7      35 0.00075   28.7   2.2   14  130-143   124-137 (267)
265 cd02973 TRX_GRX_like Thioredox  32.6      46   0.001   21.1   2.3   53   81-138     8-61  (67)
266 PLN00043 elongation factor 1-a  32.5      48   0.001   30.1   3.2   52   90-142    95-158 (447)
267 cd02976 NrdH NrdH-redoxin (Nrd  32.4      72  0.0016   19.5   3.2   51   81-137     7-58  (73)
268 cd04170 EF-G_bact Elongation f  32.3      30 0.00065   28.2   1.7   25  118-144   107-131 (268)
269 PF07927 YcfA:  YcfA-like prote  32.2 1.3E+02  0.0029   18.9   5.4   51   13-63      3-54  (56)
270 PRK12735 elongation factor Tu;  32.1      39 0.00084   29.8   2.5   25  118-144   118-143 (396)
271 PRK04000 translation initiatio  32.1      35 0.00075   30.4   2.2   16  131-146   141-156 (411)
272 cd06538 CIDE_N_FSP27 CIDE_N do  32.0      34 0.00074   25.3   1.8   58   65-129     5-66  (79)
273 COG5324 Uncharacterized conser  32.0      34 0.00073   33.9   2.2   74   58-133   502-576 (758)
274 PTZ00062 glutaredoxin; Provisi  31.7 1.1E+02  0.0024   25.4   5.0   66   80-151   124-189 (204)
275 PF06183 DinI:  DinI-like famil  31.0      80  0.0017   22.1   3.5   49   10-64      5-55  (65)
276 PLN00023 GTP-binding protein;   30.9      53  0.0012   29.7   3.2   15  129-143   151-165 (334)
277 PRK11933 yebU rRNA (cytosine-C  30.0      29 0.00063   32.2   1.4   32   71-102   230-262 (470)
278 COG1100 GTPase SAR1 and relate  29.9      95  0.0021   23.6   4.0   55   90-144    63-126 (219)
279 cd03029 GRX_hybridPRX5 Glutare  29.9 1.5E+02  0.0032   19.2   4.5   52   81-138     8-59  (72)
280 PRK11200 grxA glutaredoxin 1;   29.7      62  0.0013   21.9   2.7   65   82-151     9-79  (85)
281 PF13590 DUF4136:  Domain of un  29.7      77  0.0017   23.0   3.4   25   11-35     41-65  (151)
282 PF00462 Glutaredoxin:  Glutare  29.6 1.1E+02  0.0023   19.3   3.7   49   82-136     7-56  (60)
283 TIGR00446 nop2p NOL1/NOP2/sun   29.2      33 0.00071   28.5   1.5   32   72-103   188-220 (264)
284 PRK10824 glutaredoxin-4; Provi  29.1 1.4E+02  0.0031   22.7   4.9   50   82-138    28-79  (115)
285 PRK09435 membrane ATPase/prote  29.0      37  0.0008   30.1   1.9   31  114-145   180-210 (332)
286 cd04128 Spg1 Spg1p.  Spg1p (se  28.7      78  0.0017   24.3   3.4   12  130-142   106-117 (182)
287 PF02492 cobW:  CobW/HypB/UreG,  28.5      25 0.00054   27.2   0.7   19  132-150   144-163 (178)
288 cd01853 Toc34_like Toc34-like   28.5 1.1E+02  0.0023   25.7   4.4   23  123-145   143-165 (249)
289 KOG1490|consensus               28.5      24 0.00052   34.5   0.7   62   84-148   228-300 (620)
290 PRK00007 elongation factor G;   28.2      58  0.0013   31.1   3.1   24  118-143   118-141 (693)
291 PF04320 DUF469:  Protein with   28.2 1.8E+02  0.0039   22.3   5.2   38  113-150    33-78  (101)
292 COG5309 Exo-beta-1,3-glucanase  28.1      35 0.00075   30.9   1.5   53   75-127    98-162 (305)
293 PF05511 ATP-synt_F6:  Mitochon  28.1      36 0.00078   26.2   1.4   48   59-106    39-86  (99)
294 cd04102 RabL3 RabL3 (Rab-like3  27.9      36 0.00078   27.4   1.5   15  130-144   130-144 (202)
295 KOG1122|consensus               27.8      68  0.0015   30.6   3.4   45   10-65    345-390 (460)
296 CHL00053 rps7 ribosomal protei  27.8 2.1E+02  0.0045   22.7   5.8   93   12-130    60-152 (155)
297 COG0144 Sun tRNA and rRNA cyto  27.8 1.1E+02  0.0024   27.0   4.6   40   10-65    267-307 (355)
298 PRK05124 cysN sulfate adenylyl  27.5      49  0.0011   30.2   2.5   14  130-143   161-174 (474)
299 COG0218 Predicted GTPase [Gene  27.5      50  0.0011   28.0   2.3   53   93-147    92-153 (200)
300 cd03028 GRX_PICOT_like Glutare  27.4 1.4E+02   0.003   20.7   4.2   63   83-151    22-84  (90)
301 KOG1532|consensus               27.4      47   0.001   30.7   2.3   18  129-146   181-198 (366)
302 PF08765 Mor:  Mor transcriptio  26.8      28 0.00061   25.6   0.6   41   91-131    11-52  (108)
303 cd03027 GRX_DEP Glutaredoxin (  26.4 1.7E+02  0.0037   19.0   4.3   62   82-150     9-71  (73)
304 COG3797 Uncharacterized protei  26.0      77  0.0017   26.8   3.1   88   58-151    24-120 (178)
305 COG2239 MgtE Mg/Co/Ni transpor  26.0      81  0.0018   29.4   3.6   40   86-125   210-254 (451)
306 PRK09554 feoB ferrous iron tra  25.9 1.1E+02  0.0024   30.1   4.7   14  129-142   112-125 (772)
307 TIGR00101 ureG urease accessor  25.8      68  0.0015   25.7   2.7   12  132-143   140-151 (199)
308 COG0780 Enzyme related to GTP   25.6      39 0.00084   27.4   1.3   42   80-124    49-107 (149)
309 TIGR02190 GlrX-dom Glutaredoxi  25.5 1.8E+02   0.004   19.4   4.5   50   82-137    16-65  (79)
310 PF00578 AhpC-TSA:  AhpC/TSA fa  25.5      59  0.0013   22.4   2.0   42   83-124    37-78  (124)
311 PRK00049 elongation factor Tu;  25.4      63  0.0014   28.5   2.7   25  118-144   118-143 (396)
312 COG1281 Disulfide bond chapero  25.3 1.3E+02  0.0028   26.8   4.6   35   90-124   211-248 (286)
313 PF06784 UPF0240:  Uncharacteri  25.0      77  0.0017   26.0   2.9   20   89-108   148-167 (179)
314 PRK14862 rimO ribosomal protei  25.0      88  0.0019   28.2   3.5   69   42-112    10-81  (440)
315 PF01189 Nol1_Nop2_Fmu:  NOL1/N  24.8      26 0.00056   29.8   0.2   29   74-102   210-239 (283)
316 PF00571 CBS:  CBS domain CBS d  24.6 1.5E+02  0.0033   17.8   3.6   34   90-123    17-55  (57)
317 PRK13808 adenylate kinase; Pro  24.5 1.5E+02  0.0033   26.6   4.9   24    1-24     82-106 (333)
318 PRK13253 citrate lyase subunit  24.0 2.3E+02   0.005   21.2   5.1   29   91-119    46-74  (92)
319 KOG2198|consensus               23.9      55  0.0012   30.3   2.1   31   71-101   284-315 (375)
320 cd00304 RT_like RT_like: Rever  23.8 1.2E+02  0.0025   20.3   3.2   24   10-33     62-85  (98)
321 PF00919 UPF0004:  Uncharacteri  23.8 1.3E+02  0.0028   22.1   3.6   66   47-112     8-76  (98)
322 TIGR00550 nadA quinolinate syn  23.8 1.1E+02  0.0025   26.9   3.9   35   81-117   172-207 (310)
323 PF10678 DUF2492:  Protein of u  23.6   2E+02  0.0043   21.2   4.5   39   91-132    23-65  (78)
324 TIGR01394 TypA_BipA GTP-bindin  23.6      51  0.0011   31.3   1.9   14  130-143   117-130 (594)
325 cd01882 BMS1 Bms1.  Bms1 is an  23.5 1.1E+02  0.0025   24.6   3.6   24  118-143   123-147 (225)
326 PHA02992 hypothetical protein;  23.4 1.8E+02  0.0038   29.4   5.5   63   54-128   153-215 (728)
327 PF10281 Ish1:  Putative stress  23.2 1.1E+02  0.0024   18.7   2.8   34   89-126     4-37  (38)
328 smart00115 CASc Caspase, inter  23.1 1.2E+02  0.0026   25.0   3.7   33   89-124    30-62  (241)
329 PRK13505 formate--tetrahydrofo  22.8      67  0.0015   31.1   2.5   35  114-150   359-393 (557)
330 PLN00116 translation elongatio  22.6      67  0.0015   31.6   2.5   49   92-142   110-163 (843)
331 PRK05506 bifunctional sulfate   22.5      69  0.0015   30.0   2.5   14  130-143   158-171 (632)
332 cd06536 CIDE_N_ICAD CIDE_N dom  22.4      79  0.0017   23.4   2.3   58   65-129     5-69  (80)
333 PF02017 CIDE-N:  CIDE-N domain  22.2      26 0.00057   25.6  -0.3   58   65-129     5-67  (78)
334 PF13529 Peptidase_C39_2:  Pept  22.0 2.6E+02  0.0057   19.1   4.8   44   88-137    64-107 (144)
335 cd03063 TRX_Fd_FDH_beta TRX-li  21.9 2.3E+02   0.005   20.9   4.7   61    9-103    18-79  (92)
336 TIGR00487 IF-2 translation ini  21.6      83  0.0018   29.9   2.8   21  128-148   186-208 (587)
337 TIGR00411 redox_disulf_1 small  21.6 1.6E+02  0.0035   18.8   3.4   53   80-138     7-61  (82)
338 PF13419 HAD_2:  Haloacid dehal  21.4   3E+02  0.0064   19.2   5.4   67   54-125   103-169 (176)
339 cd02947 TRX_family TRX family;  21.4 2.1E+02  0.0046   17.6   4.2   54   81-139    19-73  (93)
340 TIGR00503 prfC peptide chain r  20.9      56  0.0012   30.5   1.5   23  118-142   123-145 (527)
341 COG1159 Era GTPase [General fu  20.9 6.3E+02   0.014   22.8  10.5  106    7-146    15-131 (298)
342 COG1258 Predicted pseudouridyl  20.7 1.2E+02  0.0025   28.6   3.5   41   85-125   262-305 (398)
343 PF11263 Attachment_P66:  Borre  20.6      88  0.0019   27.4   2.5   48   66-113    71-122 (233)
344 COG0050 TufB GTPases - transla  20.4      77  0.0017   29.6   2.3   80   67-149    50-148 (394)
345 cd02961 PDI_a_family Protein D  20.4 2.4E+02  0.0052   17.8   4.2   58   80-139    23-81  (101)
346 COG4009 Uncharacterized protei  20.3      66  0.0014   24.5   1.5   19   11-29     62-80  (88)
347 COG1162 Predicted GTPases [Gen  20.2      76  0.0017   28.4   2.1   37  112-148    92-129 (301)
348 PRK00741 prfC peptide chain re  20.1      64  0.0014   30.1   1.7   15  129-143   131-145 (526)
349 cd01659 TRX_superfamily Thiore  20.0 1.7E+02  0.0036   15.8   4.6   56   81-138     6-62  (69)

No 1  
>KOG1486|consensus
Probab=100.00  E-value=5.7e-52  Score=360.49  Aligned_cols=124  Identities=73%  Similarity=1.165  Sum_probs=118.0

Q ss_pred             CCCCCCchHHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccc
Q psy7060           1 MLDATKQDVQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAF   80 (160)
Q Consensus         1 vLDa~k~~~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~   80 (160)
                      ||||+|.+.||.+||+|||++||||||+||||+|++|+.|||.|+.|||+                              
T Consensus       146 vLDatk~e~qr~~le~ELe~vGiRLNk~~Pniy~k~kk~gGi~f~~T~~l------------------------------  195 (364)
T KOG1486|consen  146 VLDATKSEDQREILEKELEAVGIRLNKRKPNIYFKKKKTGGISFNTTVPL------------------------------  195 (364)
T ss_pred             EecCCcchhHHHHHHHHHHHhceeccCCCCCeEEEeeccCCeEEeeeecc------------------------------
Confidence            79999999999999999999999999999999999998888877665555                              


Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHhcCCCceeeC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIARQPNSVVVR  160 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~~~p~~v~is  160 (160)
                            |++||++++.||||||||||+|+||||||.|||||+|.|||+|+||+|||||||++|+||+||+||+||||+||
T Consensus       196 ------T~~~ek~i~~ILheykI~Naevl~ReD~t~DdfIDvi~gnr~Y~~ClYvYnKID~vs~eevdrlAr~PnsvViS  269 (364)
T KOG1486|consen  196 ------THCDEKLIYTILHEYKIHNAEVLFREDCTVDDFIDVIEGNRVYIKCLYVYNKIDQVSIEEVDRLARQPNSVVIS  269 (364)
T ss_pred             ------ccccHHHHHHHHHHHeeccceEEEecCCChHHHHHHHhccceEEEEEEEeeccceecHHHHHHHhcCCCcEEEE
Confidence                  55999999999999999999999999999999999999999999999999999999999999999999999997


No 2  
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=100.00  E-value=4.9e-41  Score=295.45  Aligned_cols=124  Identities=50%  Similarity=0.849  Sum_probs=120.2

Q ss_pred             CCCCCCchHHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccc
Q psy7060           1 MLDATKQDVQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAF   80 (160)
Q Consensus         1 vLDa~k~~~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~   80 (160)
                      |||++++..|++.|++|||++|||||+.||+|+|++++.|||++++++++++                            
T Consensus       147 Vld~~~~~~~~~~i~~ELe~~GIrlnk~~p~V~I~kk~~gGI~i~~t~~l~~----------------------------  198 (365)
T COG1163         147 VLDVFEDPHHRDIIERELEDVGIRLNKRPPDVTIKKKESGGIRINGTGPLTH----------------------------  198 (365)
T ss_pred             EEecCCChhHHHHHHHHHHhcCeEecCCCCceEEEEeccCCEEEeccccccc----------------------------
Confidence            5899999878999999999999999999999999999999999998888776                            


Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHhcCCCceeeC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIARQPNSVVVR  160 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~~~p~~v~is  160 (160)
                              +|+++|++||+|||||||+|+||||||+|||||++++||+|+|||||+||+|+++.|+++.+++.|++++||
T Consensus       199 --------~d~~~ir~iL~Ey~I~nA~V~Ir~dvTlDd~id~l~~nrvY~p~l~v~NKiD~~~~e~~~~l~~~~~~v~is  270 (365)
T COG1163         199 --------LDEDTVRAILREYRIHNADVLIREDVTLDDLIDALEGNRVYKPALYVVNKIDLPGLEELERLARKPNSVPIS  270 (365)
T ss_pred             --------CCHHHHHHHHHHhCcccceEEEecCCcHHHHHHHHhhcceeeeeEEEEecccccCHHHHHHHHhccceEEEe
Confidence                    999999999999999999999999999999999999999999999999999999999999999999999997


No 3  
>KOG1487|consensus
Probab=100.00  E-value=2.1e-37  Score=269.79  Aligned_cols=120  Identities=48%  Similarity=0.783  Sum_probs=117.1

Q ss_pred             CCCCCCchHHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccc
Q psy7060           1 MLDATKQDVQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAF   80 (160)
Q Consensus         1 vLDa~k~~~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~   80 (160)
                      |||+.|+..|+.++|+|||.+||||||+||||.+++|+.|||++++    ++                            
T Consensus       143 vld~~kp~~hk~~ie~eleg~girlnk~pp~i~~kkKdkgGInlt~----~~----------------------------  190 (358)
T KOG1487|consen  143 VLDVLKPLSHKKIIEKELEGFGIRLNKQPPNIGTKKKDKGGINLTG----TH----------------------------  190 (358)
T ss_pred             EeeccCcccHHHHHHHhhhcceeeccCCCCCccccccccCceeeec----ch----------------------------
Confidence            6899999999999999999999999999999999999999999988    55                            


Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHhcCCCceeeC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIARQPNSVVVR  160 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~~~p~~v~is  160 (160)
                              ++-++++++|.|||+|||++.+|.|+|+|||||++++||+|+||||++||||++|+||+|-+.+.||+|+||
T Consensus       191 --------LdlD~~rsil~eyR~hsAdi~Lr~DaT~DdLIdvVegnr~yVp~iyvLNkIdsISiEELdii~~iphavpIS  262 (358)
T KOG1487|consen  191 --------LDLDLQRSILSEYRIHSADIALRFDATADDLIDVVEGNRIYVPCIYVLNKIDSISIEELDIIYTIPHAVPIS  262 (358)
T ss_pred             --------hhHHHHHHHHHHhhhcchheeeecCcchhhhhhhhccCceeeeeeeeecccceeeeeccceeeeccceeecc
Confidence                    889999999999999999999999999999999999999999999999999999999999999999999997


No 4  
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=100.00  E-value=5.6e-35  Score=234.98  Aligned_cols=124  Identities=64%  Similarity=1.003  Sum_probs=118.6

Q ss_pred             CCCCCCchHHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccc
Q psy7060           1 MLDATKQDVQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAF   80 (160)
Q Consensus         1 vLDa~k~~~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~   80 (160)
                      |+|++.+..|+..++++|+++||++|+++|.|.|+++..|||+|++++++++                            
T Consensus        84 V~D~t~~~~~~~~~~~~l~~~gi~l~~~~~~v~~~~~~~ggi~~~~~~~~~~----------------------------  135 (233)
T cd01896          84 VLDATKPEGHREILERELEGVGIRLNKRPPNITIKKKKKGGINITSTVPLTK----------------------------  135 (233)
T ss_pred             EecCCcchhHHHHHHHHHHHcCceecCCCCeEEEEEEecCCEEEeccCCCCC----------------------------
Confidence            5788888779999999999999999999999999999999999999888877                            


Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHhcCCCceeeC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIARQPNSVVVR  160 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~~~p~~v~is  160 (160)
                              +|+++|++||+|||||||+|.++|++|+|||||+|+|||+|+||++|+||+|+.+.++++.+++.|+.+++|
T Consensus       136 --------~~~~~v~~~l~~~~i~~~~v~~~~~~~~~~~~~~~~~~~~y~p~iiV~NK~Dl~~~~~~~~~~~~~~~~~~S  207 (233)
T cd01896         136 --------LDEKTIKAILREYKIHNADVLIREDITVDDLIDVIEGNRVYIPCLYVYNKIDLISIEELDLLARQPNSVVIS  207 (233)
T ss_pred             --------CCHHHHHHHHHHhCeeeEEEEEccCCCHHHHHHHHhCCceEeeEEEEEECccCCCHHHHHHHhcCCCEEEEc
Confidence                    999999999999999999999999999999999999999999999999999999999999999999888876


No 5  
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=98.92  E-value=1.5e-10  Score=99.35  Aligned_cols=118  Identities=19%  Similarity=0.050  Sum_probs=85.0

Q ss_pred             chHHHHHHHHHHHhc-CceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCC
Q psy7060           7 QDVQRGLLEKELESV-GIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCP   85 (160)
Q Consensus         7 ~~~q~~~le~ELe~~-GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~   85 (160)
                      +..|...++.||+.. ...++++.+.+. ++..+||..++.+....                                ..
T Consensus       127 p~~d~~~i~~El~~~d~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~--------------------------------~~  173 (318)
T cd01899         127 PLEDIEFLENEIDMWIYGILEKNWEKIV-RKADAEKTDIVEALSEQ--------------------------------LS  173 (318)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHhcCCccHHHHHHHH--------------------------------Hh
Confidence            355889999999986 777788877777 44455555544322110                                01


Q ss_pred             CcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHH-H-hc--CCCceeeC
Q psy7060          86 LTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDR-I-AR--QPNSVVVR  160 (160)
Q Consensus        86 ~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~-i-~~--~p~~v~is  160 (160)
                      +-+++++.|+.+| ++++++|.+.++++.++++|.+++..  .++|+|||+||+|+.+.++... + ..  .+..+++|
T Consensus       174 ~~~~~~~~v~~~L-~~~~~~~~~~~~~~~~~~~~~~~~ll--t~KPvI~VlNK~Dl~~~~~~~~~l~~~~~~~~iI~iS  249 (318)
T cd01899         174 GFGVNEKDVIEAL-EELELPEDLSKWTDEDLLRLARALRK--RSKPMVIAANKADIPDAENNISKLRLKYPDEIVVPTS  249 (318)
T ss_pred             hccccHHHHHHHH-HhCCCCCcccCCCHHHHHHHHHHHHh--cCCcEEEEEEHHHccChHHHHHHHHhhCCCCeEEEEe
Confidence            1248899999999 55999999999999999999999985  4589999999999876655332 2 22  33456665


No 6  
>PRK09602 translation-associated GTPase; Reviewed
Probab=98.70  E-value=5.4e-09  Score=92.14  Aligned_cols=116  Identities=22%  Similarity=0.236  Sum_probs=78.6

Q ss_pred             chHHHHHHHHHHHhc--CceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccC
Q psy7060           7 QDVQRGLLEKELESV--GIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTC   84 (160)
Q Consensus         7 ~~~q~~~le~ELe~~--GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~   84 (160)
                      +..|...++.||+..  ++ ++|+.+.+ .++.++|+..+..          .++..|.-                    
T Consensus       130 p~~d~~~i~~EL~~~d~~~-~~k~~~~~-~~~~~~~~~~~~~----------~~~~~l~~--------------------  177 (396)
T PRK09602        130 PVEDIKFLEEELDMWIYGI-LEKNWEKF-SRKAQAEKFDIEE----------ALAEQLSG--------------------  177 (396)
T ss_pred             HHHHHHHHHHHHHHHhHHH-HHHHHHHH-HHHHhcCCcchHH----------HHHHHHhh--------------------
Confidence            356899999999985  88 77777777 4444455522111          11111111                    


Q ss_pred             CCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcce-eceEEEEecCCCCC-HHHHHHHhcC--CCceeeC
Q psy7060          85 PLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVY-LPCIYAYNKIDQIS-IEEVDRIARQ--PNSVVVR  160 (160)
Q Consensus        85 ~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY-~P~iyv~NKiD~is-~eevd~i~~~--p~~v~is  160 (160)
                        -+++++.|+.+|++|++. |.+...   +.+|+.++...++.+ +|+|||+||+|..+ .+.++.+.++  +..++||
T Consensus       178 --~~~~e~~v~~~L~~~g~~-~~~~~~---~~~~~~~I~~~~l~t~KPvI~VlNK~D~~~~~~~l~~i~~~~~~~vvpIS  251 (396)
T PRK09602        178 --LGINEEHVKEALRELGLP-EDPSKW---TDEDLLELARELRKISKPMVIAANKADLPPAEENIERLKEEKYYIVVPTS  251 (396)
T ss_pred             --hccCHHHHHHHHHHcCCc-CcccCC---CHHHHHHHHHhhhhcCCCEEEEEEchhcccchHHHHHHHhcCCCcEEEEc
Confidence              137899999999999998 665554   457777777777665 99999999999874 4446666555  4567776


No 7  
>KOG1486|consensus
Probab=94.92  E-value=0.0069  Score=54.40  Aligned_cols=19  Identities=68%  Similarity=0.945  Sum_probs=17.5

Q ss_pred             hHHHHHHHHHHhhhhhhHH
Q psy7060          54 NEKLVQLILHEYKIFNAEQ   72 (160)
Q Consensus        54 ~~~~v~~~l~~yki~n~~~   72 (160)
                      |+++++.|||+||||||+-
T Consensus       199 ~ek~i~~ILheykI~Naev  217 (364)
T KOG1486|consen  199 DEKLIYTILHEYKIHNAEV  217 (364)
T ss_pred             cHHHHHHHHHHHeeccceE
Confidence            5899999999999999984


No 8  
>COG2262 HflX GTPases [General function prediction only]
Probab=94.55  E-value=0.033  Score=51.24  Aligned_cols=31  Identities=39%  Similarity=0.651  Sum_probs=24.2

Q ss_pred             eceEEEEecCCCCCHHH-HHHHhcC-CCceeeC
Q psy7060         130 LPCIYAYNKIDQISIEE-VDRIARQ-PNSVVVR  160 (160)
Q Consensus       130 ~P~iyv~NKiD~is~ee-vd~i~~~-p~~v~is  160 (160)
                      +|.|+|+||||+++.++ +..+.+. |+.|+||
T Consensus       305 ~p~i~v~NKiD~~~~~~~~~~~~~~~~~~v~iS  337 (411)
T COG2262         305 IPIILVLNKIDLLEDEEILAELERGSPNPVFIS  337 (411)
T ss_pred             CCEEEEEecccccCchhhhhhhhhcCCCeEEEE
Confidence            89999999999997765 5555444 5678887


No 9  
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=90.88  E-value=0.38  Score=42.03  Aligned_cols=81  Identities=22%  Similarity=0.447  Sum_probs=43.0

Q ss_pred             ccccccCCC-cccCHHH---HHHHHHHcCccceEEEee-cCCC----hhHH---HHHHhcCcc-eeceEEEEecCCCCCH
Q psy7060          78 IAFNSTCPL-TQVNEKL---VQLILHEYKIFNAEVLFR-EDCN----ADEL---IDVINANRV-YLPCIYAYNKIDQISI  144 (160)
Q Consensus        78 ~~~~~~~~~-~~~~e~~---V~~IL~EYkI~NA~V~ir-ed~t----~Ddl---iDvi~~nrv-Y~P~iyv~NKiD~is~  144 (160)
                      +.|--|+-+ ..++.+.   .+..+.+  +.+|++.+- =|++    .+++   .+.+..-.. =+|+|+|+||+|+.+.
T Consensus       239 i~l~DT~G~~~~l~~~lie~f~~tle~--~~~ADlil~VvD~s~~~~~~~~~~~~~~L~~l~~~~~piIlV~NK~Dl~~~  316 (351)
T TIGR03156       239 VLLTDTVGFIRDLPHELVAAFRATLEE--VREADLLLHVVDASDPDREEQIEAVEKVLEELGAEDIPQLLVYNKIDLLDE  316 (351)
T ss_pred             EEEEecCcccccCCHHHHHHHHHHHHH--HHhCCEEEEEEECCCCchHHHHHHHHHHHHHhccCCCCEEEEEEeecCCCh
Confidence            344556555 3334444   4444554  456655432 2332    2222   233332111 2699999999999877


Q ss_pred             HHHHHHhc-CCCceeeC
Q psy7060         145 EEVDRIAR-QPNSVVVR  160 (160)
Q Consensus       145 eevd~i~~-~p~~v~is  160 (160)
                      +++..+.. .|..+++|
T Consensus       317 ~~v~~~~~~~~~~i~iS  333 (351)
T TIGR03156       317 PRIERLEEGYPEAVFVS  333 (351)
T ss_pred             HhHHHHHhCCCCEEEEE
Confidence            77665532 24566665


No 10 
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=90.23  E-value=0.35  Score=36.11  Aligned_cols=19  Identities=21%  Similarity=0.176  Sum_probs=16.2

Q ss_pred             eceEEEEecCCCCCHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd  148 (160)
                      +|.|.|+||+|+.+.+++.
T Consensus        40 ~p~ilVlNKiDl~~~~~~~   58 (157)
T cd01858          40 KHLIFVLNKCDLVPTWVTA   58 (157)
T ss_pred             CCEEEEEEchhcCCHHHHH
Confidence            7999999999999876554


No 11 
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=90.15  E-value=0.4  Score=35.38  Aligned_cols=32  Identities=19%  Similarity=0.135  Sum_probs=21.6

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCCHHHHHH
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is~eevd~  149 (160)
                      ++...+.....-+|+|+|+||+|+.+.+++..
T Consensus        31 ~l~~~l~~~~~~k~~iivlNK~DL~~~~~~~~   62 (141)
T cd01857          31 DLERYVKEVDPRKKNILLLNKADLLTEEQRKA   62 (141)
T ss_pred             HHHHHHHhccCCCcEEEEEechhcCCHHHHHH
Confidence            44454443223479999999999987766544


No 12 
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=89.46  E-value=0.43  Score=37.57  Aligned_cols=21  Identities=29%  Similarity=0.414  Sum_probs=17.6

Q ss_pred             eceEEEEecCCCCCHHHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd~i  150 (160)
                      .|+|+|+||+|+.+.+++...
T Consensus        31 kp~IlVlNK~DL~~~~~l~~~   51 (172)
T cd04178          31 KKLVLVLNKIDLVPKENVEKW   51 (172)
T ss_pred             CCEEEEEehhhcCCHHHHHHH
Confidence            699999999999987766543


No 13 
>COG1160 Predicted GTPases [General function prediction only]
Probab=88.68  E-value=1  Score=41.93  Aligned_cols=48  Identities=25%  Similarity=0.389  Sum_probs=29.1

Q ss_pred             ecCCChhH--HHHHHhcCcceeceEEEEecCCCCCHHHHHH-HhcC--CCceeeC
Q psy7060         111 REDCNADE--LIDVINANRVYLPCIYAYNKIDQISIEEVDR-IARQ--PNSVVVR  160 (160)
Q Consensus       111 red~t~Dd--liDvi~~nrvY~P~iyv~NKiD~is~eevd~-i~~~--p~~v~is  160 (160)
                      ++-+|.+|  +.+.+.  +.-+|+|.|+||+|-...|+... ..++  ...++||
T Consensus        94 ~~Git~~D~~ia~~Lr--~~~kpviLvvNK~D~~~~e~~~~efyslG~g~~~~IS  146 (444)
T COG1160          94 REGITPADEEIAKILR--RSKKPVILVVNKIDNLKAEELAYEFYSLGFGEPVPIS  146 (444)
T ss_pred             CCCCCHHHHHHHHHHH--hcCCCEEEEEEcccCchhhhhHHHHHhcCCCCceEee
Confidence            55556544  334443  44489999999999885554332 3443  3556665


No 14 
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=88.29  E-value=1.7  Score=31.64  Aligned_cols=21  Identities=19%  Similarity=0.118  Sum_probs=15.6

Q ss_pred             HhcCcceeceEEEEecCCCCC
Q psy7060         123 INANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       123 i~~nrvY~P~iyv~NKiD~is  143 (160)
                      +....--+|+|+|.||+|+.+
T Consensus        96 i~~~~~~~piilv~nK~Dl~~  116 (174)
T smart00174       96 VKHFCPNTPIILVGTKLDLRE  116 (174)
T ss_pred             HHhhCCCCCEEEEecChhhhh
Confidence            433344689999999999853


No 15 
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=86.98  E-value=1.7  Score=30.83  Aligned_cols=21  Identities=33%  Similarity=0.415  Sum_probs=15.4

Q ss_pred             ceEEEEecCCCCC----HHHHHHHh
Q psy7060         131 PCIYAYNKIDQIS----IEEVDRIA  151 (160)
Q Consensus       131 P~iyv~NKiD~is----~eevd~i~  151 (160)
                      |+|+|.||+|+..    .+++.+++
T Consensus        90 p~ilv~NK~Dl~~~~~~~~~~~~~~  114 (142)
T TIGR02528        90 PVIGLVTKIDLAEADVDIERAKELL  114 (142)
T ss_pred             CeEEEEEeeccCCcccCHHHHHHHH
Confidence            9999999999864    24445544


No 16 
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=86.62  E-value=0.62  Score=34.79  Aligned_cols=19  Identities=26%  Similarity=0.244  Sum_probs=16.3

Q ss_pred             eceEEEEecCCCCCHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd  148 (160)
                      +|.|+|+||+|+.+.+++.
T Consensus        30 ~p~IiVlNK~Dl~~~~~~~   48 (155)
T cd01849          30 KKLILVLNKADLVPKEVLR   48 (155)
T ss_pred             CCEEEEEechhcCCHHHHH
Confidence            6999999999998876554


No 17 
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=86.17  E-value=0.77  Score=33.11  Aligned_cols=22  Identities=41%  Similarity=0.566  Sum_probs=17.9

Q ss_pred             ceeceEEEEecCCCCCHHHHHH
Q psy7060         128 VYLPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~eevd~  149 (160)
                      ..+|.++|.||+|+.+.+++..
T Consensus       119 ~~~p~ivv~NK~Dl~~~~~~~~  140 (176)
T cd01881         119 TAKPVIYVLNKIDLDDAEELEE  140 (176)
T ss_pred             hhCCeEEEEEchhcCchhHHHH
Confidence            4789999999999987655544


No 18 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=86.05  E-value=2  Score=32.79  Aligned_cols=19  Identities=42%  Similarity=0.683  Sum_probs=15.9

Q ss_pred             eceEEEEecCCCCCHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd  148 (160)
                      +|+++|.||+|+...++..
T Consensus       154 ~~viiV~NK~Dl~~~~~~~  172 (204)
T cd01878         154 IPMILVLNKIDLLDDEELE  172 (204)
T ss_pred             CCEEEEEEccccCChHHHH
Confidence            6999999999998765544


No 19 
>PTZ00258 GTP-binding protein; Provisional
Probab=85.41  E-value=2.3  Score=38.56  Aligned_cols=53  Identities=26%  Similarity=0.104  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcC---cceeceEEEEecC--CC--CCHHHHHHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFREDCNADELIDVINAN---RVYLPCIYAYNKI--DQ--ISIEEVDRI  150 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~n---rvY~P~iyv~NKi--D~--is~eevd~i  150 (160)
                      .+.|+..|.+++..++     .+.+.+|  ..+..+   ..++|.|||.||.  |+  .+.+.++.+
T Consensus       186 l~~v~~~L~~~~~~~~-----~~~~~~e--~~~l~~l~llt~KP~iyv~N~~E~D~~~~~~~~~~~l  245 (390)
T PTZ00258        186 LKKVLEWLEEGKPVRD-----GDWTDKE--IEILNEYQLLTAKPMIYLVNMSEKDFIRQKNKWLAKI  245 (390)
T ss_pred             HHHHHHHHHcCCcccc-----CCCCHHH--HHHHHHhchhhcCCEEEEEECchhhhcccchHHHHHH
Confidence            3678999999888765     2445554  333333   6799999999999  86  244444444


No 20 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=83.15  E-value=2  Score=31.11  Aligned_cols=23  Identities=26%  Similarity=0.213  Sum_probs=17.6

Q ss_pred             eceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      +|+++|.||+|+..     .++...+++
T Consensus       109 ~pi~vv~nK~Dl~~~~~~~~~~~~~~~~  136 (165)
T cd01868         109 IVIMLVGNKSDLRHLRAVPTEEAKAFAE  136 (165)
T ss_pred             CeEEEEEECccccccccCCHHHHHHHHH
Confidence            79999999999863     356666655


No 21 
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=83.04  E-value=11  Score=27.00  Aligned_cols=28  Identities=29%  Similarity=0.202  Sum_probs=20.9

Q ss_pred             cceeceEEEEecCCCC----CHHHHHHHhcCC
Q psy7060         127 RVYLPCIYAYNKIDQI----SIEEVDRIARQP  154 (160)
Q Consensus       127 rvY~P~iyv~NKiD~i----s~eevd~i~~~p  154 (160)
                      ....|.++|.||+|+.    +.++..++++..
T Consensus       104 ~~~~~~~iv~nK~D~~~~~~~~~~~~~~~~~~  135 (161)
T cd01863         104 NNDIVKMLVGNKIDKENREVTREEGLKFARKH  135 (161)
T ss_pred             CCCCcEEEEEECCcccccccCHHHHHHHHHHc
Confidence            4568999999999997    556776665543


No 22 
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=83.02  E-value=1.2  Score=33.80  Aligned_cols=18  Identities=28%  Similarity=0.289  Sum_probs=15.1

Q ss_pred             eceEEEEecCCCCCHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eev  147 (160)
                      .|.|+|+||+|+.+.+++
T Consensus        47 k~~ilVlNK~Dl~~~~~~   64 (171)
T cd01856          47 KPRIIVLNKADLADPKKT   64 (171)
T ss_pred             CCEEEEEehhhcCChHHH
Confidence            599999999999866554


No 23 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=82.98  E-value=0.69  Score=32.37  Aligned_cols=20  Identities=30%  Similarity=0.302  Sum_probs=16.2

Q ss_pred             ceeceEEEEecCCCCCHHHH
Q psy7060         128 VYLPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~eev  147 (160)
                      .-.|.+++.||+|+.+.++.
T Consensus       106 ~~~~vi~v~nK~D~~~~~~~  125 (157)
T cd04164         106 ADKPIIVVLNKSDLLPDSEL  125 (157)
T ss_pred             cCCCEEEEEEchhcCCcccc
Confidence            34799999999999876554


No 24 
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=82.63  E-value=1.4  Score=35.92  Aligned_cols=34  Identities=26%  Similarity=0.334  Sum_probs=25.7

Q ss_pred             HHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHH
Q psy7060          56 KLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHE  100 (160)
Q Consensus        56 ~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~E  100 (160)
                      ++|+.+|++|+||||+=+-.|.           ++.+++...+..
T Consensus       139 ~~v~~~l~~~~i~~~~v~~~~~-----------~~~~~~~~~~~~  172 (233)
T cd01896         139 KTIKAILREYKIHNADVLIRED-----------ITVDDLIDVIEG  172 (233)
T ss_pred             HHHHHHHHHhCeeeEEEEEccC-----------CCHHHHHHHHhC
Confidence            6899999999999998876666           445555555543


No 25 
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=82.01  E-value=1.4  Score=33.27  Aligned_cols=26  Identities=31%  Similarity=0.390  Sum_probs=19.3

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      .-+|+++|.||+|+.     +.++...+++.
T Consensus       106 ~~~piilvgNK~Dl~~~~~v~~~~~~~~a~~  136 (172)
T cd04141         106 EDIPLVLVGNKVDLESQRQVTTEEGRNLARE  136 (172)
T ss_pred             CCCCEEEEEEChhhhhcCccCHHHHHHHHHH
Confidence            458999999999974     45666666543


No 26 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=81.98  E-value=1.8  Score=30.33  Aligned_cols=18  Identities=39%  Similarity=0.553  Sum_probs=15.3

Q ss_pred             eceEEEEecCCCCCHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eev  147 (160)
                      .|+++|.||+|+...++.
T Consensus       106 ~piiiv~nK~D~~~~~~~  123 (157)
T cd01894         106 KPVILVVNKVDNIKEEDE  123 (157)
T ss_pred             CCEEEEEECcccCChHHH
Confidence            799999999999876554


No 27 
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=81.80  E-value=10  Score=29.16  Aligned_cols=28  Identities=25%  Similarity=0.450  Sum_probs=21.9

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcCCC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQPN  155 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~p~  155 (160)
                      ..+|.|+|.||+|+.     +.+++..+++..+
T Consensus       109 ~~~piilv~NK~Dl~~~~~~~~~~~~~~~~~~~  141 (201)
T cd04107         109 EPIPCLLLANKCDLKKRLAKDGEQMDQFCKENG  141 (201)
T ss_pred             CCCcEEEEEECCCcccccccCHHHHHHHHHHcC
Confidence            467999999999985     6678888766543


No 28 
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=81.19  E-value=8.7  Score=27.34  Aligned_cols=15  Identities=27%  Similarity=0.454  Sum_probs=13.3

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|+++|.||+|+.+
T Consensus       104 ~~p~iiv~NK~Dl~~  118 (162)
T cd04157         104 RVPILFFANKMDLPD  118 (162)
T ss_pred             CCCEEEEEeCccccC
Confidence            489999999999874


No 29 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=80.76  E-value=16  Score=25.82  Aligned_cols=15  Identities=13%  Similarity=0.085  Sum_probs=13.0

Q ss_pred             eceEEEEecCCCCCH
Q psy7060         130 LPCIYAYNKIDQISI  144 (160)
Q Consensus       130 ~P~iyv~NKiD~is~  144 (160)
                      .|.|++.||+|+.+.
T Consensus       105 ~~~ilv~NK~Dl~~~  119 (164)
T cd04171         105 KRGLVVLTKADLVDE  119 (164)
T ss_pred             CcEEEEEECccccCH
Confidence            399999999999864


No 30 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=80.69  E-value=1.9  Score=31.04  Aligned_cols=26  Identities=23%  Similarity=0.279  Sum_probs=20.0

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHhcCC
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIARQP  154 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~~~p  154 (160)
                      -+|.++|.||+|+.     +.++++++.+..
T Consensus       109 ~~p~ilv~nK~Dl~~~~~~~~~~~~~~~~~~  139 (172)
T cd01862         109 NFPFVVLGNKIDLEEKRQVSTKKAQQWCQSN  139 (172)
T ss_pred             CceEEEEEECcccccccccCHHHHHHHHHHc
Confidence            57999999999997     457777665443


No 31 
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=80.67  E-value=8.7  Score=27.58  Aligned_cols=25  Identities=40%  Similarity=0.401  Sum_probs=18.1

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      ..|.++|.||+|+..     .++...+++.
T Consensus       105 ~~pii~v~nK~Dl~~~~~~~~~~~~~~~~~  134 (164)
T smart00173      105 DVPIVLVGNKCDLESERVVSTEEGKELARQ  134 (164)
T ss_pred             CCCEEEEEECccccccceEcHHHHHHHHHH
Confidence            579999999999853     3555555543


No 32 
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=80.26  E-value=14  Score=26.81  Aligned_cols=26  Identities=23%  Similarity=0.164  Sum_probs=18.8

Q ss_pred             ceeceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      .-+|.|+|.||+|+..     .++...+++.
T Consensus       107 ~~~p~ivv~nK~Dl~~~~~~~~~~~~~~~~~  137 (165)
T cd01864         107 SNVVLLLIGNKCDLEEQREVLFEEACTLAEK  137 (165)
T ss_pred             CCCcEEEEEECcccccccccCHHHHHHHHHH
Confidence            4579999999999863     3555566554


No 33 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=79.99  E-value=3.9  Score=28.36  Aligned_cols=19  Identities=37%  Similarity=0.529  Sum_probs=14.7

Q ss_pred             eceEEEEecCCCC-CHHHHH
Q psy7060         130 LPCIYAYNKIDQI-SIEEVD  148 (160)
Q Consensus       130 ~P~iyv~NKiD~i-s~eevd  148 (160)
                      .|.++++||+|+. +.+++.
T Consensus       112 ~~~iiv~nK~Dl~~~~~~~~  131 (168)
T cd04163         112 TPVILVLNKIDLVKDKEDLL  131 (168)
T ss_pred             CCEEEEEEchhccccHHHHH
Confidence            5999999999998 444443


No 34 
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=79.53  E-value=2  Score=37.57  Aligned_cols=67  Identities=16%  Similarity=0.274  Sum_probs=49.5

Q ss_pred             cCccccccCCCcccCHHHHHHHHHHcCccceEEEeecCCCh--h-------H-----HHHHHhcCc---ce-----eceE
Q psy7060          76 GGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNA--D-------E-----LIDVINANR---VY-----LPCI  133 (160)
Q Consensus        76 ~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~--D-------d-----liDvi~~nr---vY-----~P~i  133 (160)
                      -++.+|+.| .-+++..++...|.++.-...+++|-|.+..  .       +     ++++.+|..   .|     .+.+
T Consensus       156 pvvqi~tG~-~Chl~a~mv~~Al~~L~~~~~d~liIEnvGnLvcPa~fdlge~~~v~vlsV~eg~dkplKyp~~f~~ADI  234 (290)
T PRK10463        156 PAIQVNTGK-GCHLDAQMIADAAPRLPLDDNGILFIENVGNLVCPASFDLGEKHKVAVLSVTEGEDKPLKYPHMFAAASL  234 (290)
T ss_pred             cEEEecCCC-CCcCcHHHHHHHHHHHhhcCCcEEEEECCCCccCCCccchhhceeEEEEECccccccchhccchhhcCcE
Confidence            466677765 4578888999999999888888888887541  2       2     455666632   44     7789


Q ss_pred             EEEecCCCCC
Q psy7060         134 YAYNKIDQIS  143 (160)
Q Consensus       134 yv~NKiD~is  143 (160)
                      +++||+|+.+
T Consensus       235 VVLNKiDLl~  244 (290)
T PRK10463        235 MLLNKVDLLP  244 (290)
T ss_pred             EEEEhHHcCc
Confidence            9999999986


No 35 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=79.51  E-value=14  Score=28.15  Aligned_cols=26  Identities=23%  Similarity=0.224  Sum_probs=19.6

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      .-+|.++|.||+|+.     +.++...+++.
T Consensus       105 ~~~piiiv~NK~Dl~~~~~~~~~~~~~l~~~  135 (191)
T cd04112         105 EDVVIMLLGNKADMSGERVVKREDGERLAKE  135 (191)
T ss_pred             CCCcEEEEEEcccchhccccCHHHHHHHHHH
Confidence            367999999999985     44667777543


No 36 
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=79.49  E-value=11  Score=28.85  Aligned_cols=51  Identities=18%  Similarity=0.401  Sum_probs=32.4

Q ss_pred             CHHHHHHHHHHcCccceEEEeec---CCChh--HHHHHHhcCcceeceEEEEecCCCC
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFRE---DCNAD--ELIDVINANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ire---d~t~D--dliDvi~~nrvY~P~iyv~NKiD~i  142 (160)
                      ..+.++....--+.-++-+++-.   ..+..  +.+..+  ...=+|.|+|+||+|+.
T Consensus        80 ~~~f~~~~~~~~~~~D~ailvVda~~g~~~~~~~~l~~~--~~~~~p~ivvlNK~D~~  135 (188)
T PF00009_consen   80 HEDFIKEMIRGLRQADIAILVVDANDGIQPQTEEHLKIL--RELGIPIIVVLNKMDLI  135 (188)
T ss_dssp             SHHHHHHHHHHHTTSSEEEEEEETTTBSTHHHHHHHHHH--HHTT-SEEEEEETCTSS
T ss_pred             ccceeecccceecccccceeeeecccccccccccccccc--cccccceEEeeeeccch
Confidence            46777888877777776555543   23322  233333  44446899999999998


No 37 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=79.30  E-value=2  Score=30.43  Aligned_cols=14  Identities=29%  Similarity=0.325  Sum_probs=12.9

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.++|+||+|+..
T Consensus       106 ~piiiv~NK~D~~~  119 (164)
T cd04139         106 VPLLLVGNKCDLED  119 (164)
T ss_pred             CCEEEEEEcccccc
Confidence            89999999999975


No 38 
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=78.83  E-value=11  Score=27.74  Aligned_cols=46  Identities=22%  Similarity=0.185  Sum_probs=26.6

Q ss_pred             HHHcCccceEEEeecCCC----hhHH----HHHHhcCcceeceEEEEecCCCCCH
Q psy7060          98 LHEYKIFNAEVLFREDCN----ADEL----IDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus        98 L~EYkI~NA~V~ired~t----~Ddl----iDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      ...|+--++-+++- |++    .+++    ++.+...+--+|.++|.||+|+.+.
T Consensus        65 ~~~~~~ad~~ilv~-d~~~~~s~~~~~~~~~~~i~~~~~~~pviiv~nK~Dl~~~  118 (166)
T cd01893          65 AAEIRKANVICLVY-SVDRPSTLERIRTKWLPLIRRLGVKVPIILVGNKSDLRDG  118 (166)
T ss_pred             hhhcccCCEEEEEE-ECCCHHHHHHHHHHHHHHHHHhCCCCCEEEEEEchhcccc
Confidence            34455555555554 333    3332    2334333335799999999999753


No 39 
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=78.79  E-value=6.5  Score=29.47  Aligned_cols=15  Identities=27%  Similarity=0.592  Sum_probs=12.9

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      =+|+++|.||+|+..
T Consensus       108 ~~p~iiv~NK~Dl~~  122 (169)
T cd01892         108 EIPCLFVAAKADLDE  122 (169)
T ss_pred             CCeEEEEEEcccccc
Confidence            379999999999863


No 40 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=78.56  E-value=4  Score=29.15  Aligned_cols=26  Identities=27%  Similarity=0.201  Sum_probs=19.7

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHhcCC
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIARQP  154 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~~~p  154 (160)
                      ..|.++|.||+|+.     +.++...+++..
T Consensus       105 ~~~iilv~nK~D~~~~~~~~~~~~~~~~~~~  135 (161)
T cd01861         105 DVIIVLVGNKTDLSDKRQVSTEEGEKKAKEL  135 (161)
T ss_pred             CCEEEEEEEChhccccCccCHHHHHHHHHHh
Confidence            68999999999993     556677765443


No 41 
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=78.42  E-value=1.7  Score=32.04  Aligned_cols=20  Identities=20%  Similarity=0.295  Sum_probs=15.8

Q ss_pred             eceEEEEecCCCCCHHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd~  149 (160)
                      +|.|+|+||+|+.+.++...
T Consensus        42 ~p~iiv~NK~Dl~~~~~~~~   61 (156)
T cd01859          42 KKLLIVLNKADLVPKEVLEK   61 (156)
T ss_pred             CcEEEEEEhHHhCCHHHHHH
Confidence            69999999999986654443


No 42 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=78.25  E-value=17  Score=26.66  Aligned_cols=24  Identities=25%  Similarity=0.187  Sum_probs=17.9

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      .|.++|.||+|+.     +.++...+++.
T Consensus       121 ~piiiv~nK~Dl~~~~~v~~~~~~~~~~~  149 (180)
T cd04127         121 PDIVLCGNKADLEDQRQVSEEQAKALADK  149 (180)
T ss_pred             CcEEEEEeCccchhcCccCHHHHHHHHHH
Confidence            5899999999985     44666666543


No 43 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=77.89  E-value=2.3  Score=30.71  Aligned_cols=19  Identities=42%  Similarity=0.480  Sum_probs=15.4

Q ss_pred             ceeceEEEEecCCCCCHHH
Q psy7060         128 VYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~ee  146 (160)
                      ...|.++|.||+|+.+.++
T Consensus       113 ~~~p~ivv~NK~Dl~~~~~  131 (170)
T cd01898         113 LEKPRIVVLNKIDLLDEEE  131 (170)
T ss_pred             cccccEEEEEchhcCCchh
Confidence            4689999999999976544


No 44 
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=77.59  E-value=3.5  Score=29.89  Aligned_cols=15  Identities=20%  Similarity=-0.102  Sum_probs=13.0

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|++++.||+|+..
T Consensus       100 ~~piiiv~nK~Dl~~  114 (158)
T cd04151         100 GAVLLVFANKQDMPG  114 (158)
T ss_pred             CCcEEEEEeCCCCCC
Confidence            379999999999863


No 45 
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=77.41  E-value=8.1  Score=35.58  Aligned_cols=23  Identities=35%  Similarity=0.501  Sum_probs=19.6

Q ss_pred             HHHHHHHHHhhhhhhHHhhhcCc
Q psy7060          56 KLVQLILHEYKIFNAEQKKAGGI   78 (160)
Q Consensus        56 ~~v~~~l~~yki~n~~~~~~~~~   78 (160)
                      ++|+.+|.+|+||||+-.-.|-+
T Consensus       202 ~~ir~iL~Ey~I~nA~V~Ir~dv  224 (365)
T COG1163         202 DTVRAILREYRIHNADVLIREDV  224 (365)
T ss_pred             HHHHHHHHHhCcccceEEEecCC
Confidence            47999999999999997777653


No 46 
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=77.12  E-value=25  Score=26.19  Aligned_cols=25  Identities=32%  Similarity=0.278  Sum_probs=19.4

Q ss_pred             eeceEEEEecCCCC---CHHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQI---SIEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~i---s~eevd~i~~~  153 (160)
                      -.|.+++.||.|+.   +.+++....+.
T Consensus       120 ~~pvivv~NK~Dl~~~~~~~~~~~~~~~  147 (190)
T cd00879         120 NVPFLILGNKIDLPGAVSEEELRQALGL  147 (190)
T ss_pred             CCCEEEEEeCCCCCCCcCHHHHHHHhCc
Confidence            48999999999986   66777666543


No 47 
>PRK00089 era GTPase Era; Reviewed
Probab=76.89  E-value=10  Score=31.06  Aligned_cols=18  Identities=44%  Similarity=0.648  Sum_probs=14.6

Q ss_pred             eceEEEEecCCCC-CHHHH
Q psy7060         130 LPCIYAYNKIDQI-SIEEV  147 (160)
Q Consensus       130 ~P~iyv~NKiD~i-s~eev  147 (160)
                      .|+++|+||+|+. +.+++
T Consensus       114 ~pvilVlNKiDl~~~~~~l  132 (292)
T PRK00089        114 TPVILVLNKIDLVKDKEEL  132 (292)
T ss_pred             CCEEEEEECCcCCCCHHHH
Confidence            6999999999998 54433


No 48 
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=76.64  E-value=4  Score=30.08  Aligned_cols=25  Identities=28%  Similarity=0.228  Sum_probs=19.0

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      -.+|.++|.||+|+.     +.++.+.+++
T Consensus       108 ~~~pvivv~nK~Dl~~~~~~~~~~~~~~~~  137 (168)
T cd01866         108 SNMTIMLIGNKCDLESRREVSYEEGEAFAK  137 (168)
T ss_pred             CCCcEEEEEECcccccccCCCHHHHHHHHH
Confidence            468999999999986     4466666644


No 49 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=76.59  E-value=3.3  Score=29.65  Aligned_cols=24  Identities=29%  Similarity=0.512  Sum_probs=17.8

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      -+|.++|.||+|+.+     .++...+++
T Consensus       106 ~~p~iiv~nK~Dl~~~~~v~~~~~~~~~~  134 (162)
T cd04106         106 DIPMVLVQTKIDLLDQAVITNEEAEALAK  134 (162)
T ss_pred             CCCEEEEEEChhcccccCCCHHHHHHHHH
Confidence            479999999999864     455555654


No 50 
>PRK12289 GTPase RsgA; Reviewed
Probab=76.48  E-value=3.4  Score=36.61  Aligned_cols=20  Identities=30%  Similarity=0.375  Sum_probs=16.6

Q ss_pred             eceEEEEecCCCCCHHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd~  149 (160)
                      +|.++|+||+|+++.++...
T Consensus       121 ip~ILVlNK~DLv~~~~~~~  140 (352)
T PRK12289        121 LEIVLCLNKADLVSPTEQQQ  140 (352)
T ss_pred             CCEEEEEEchhcCChHHHHH
Confidence            79999999999998765443


No 51 
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=76.45  E-value=15  Score=28.74  Aligned_cols=56  Identities=20%  Similarity=0.267  Sum_probs=30.5

Q ss_pred             CHHHHHHHHHHcCccce-EEEeecC---C--ChhHHHHHHhcCcceeceEEEEecCCCCCHHH
Q psy7060          90 NEKLVQLILHEYKIFNA-EVLFRED---C--NADELIDVINANRVYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA-~V~ired---~--t~DdliDvi~~nrvY~P~iyv~NKiD~is~ee  146 (160)
                      .++.+...+....--.+ -+.+...   .  ...+.+..+..... .|.|+|+||+|+.+.++
T Consensus        93 ~~~~~~~~~~~~~~~D~~llVvd~~~~~~~~~t~~~l~~~~~~~~-~~iiivvNK~Dl~~~~~  154 (203)
T cd01888          93 HEILMATMLSGAAVMDGALLLIAANEPCPQPQTSEHLAALEIMGL-KHIIIVQNKIDLVKEEQ  154 (203)
T ss_pred             hHHHHHHHHHhhhcCCEEEEEEECCCCCCCcchHHHHHHHHHcCC-CcEEEEEEchhccCHHH
Confidence            46667776666643333 3333322   1  12344444432222 47899999999987543


No 52 
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=76.30  E-value=3  Score=30.63  Aligned_cols=25  Identities=28%  Similarity=0.147  Sum_probs=18.0

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      ...|+++|.||+|+.     +.++...+++
T Consensus       107 ~~~p~iiv~nK~Dl~~~~~~~~~~~~~~~~  136 (167)
T cd01867         107 EDVERMLVGNKCDMEEKRVVSKEEGEALAD  136 (167)
T ss_pred             CCCcEEEEEECcccccccCCCHHHHHHHHH
Confidence            357999999999986     3355555543


No 53 
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=76.11  E-value=3.4  Score=30.11  Aligned_cols=27  Identities=30%  Similarity=0.244  Sum_probs=20.4

Q ss_pred             ceeceEEEEecCCCC----CHHHHHHHhcCC
Q psy7060         128 VYLPCIYAYNKIDQI----SIEEVDRIARQP  154 (160)
Q Consensus       128 vY~P~iyv~NKiD~i----s~eevd~i~~~p  154 (160)
                      .-+|.++|.||+|+.    +.+++.++++..
T Consensus       113 ~~~piilv~nK~Dl~~~~~~~~~~~~~~~~~  143 (170)
T cd04116         113 ESFPFVVLGNKNDIPERQVSTEEAQAWCREN  143 (170)
T ss_pred             CCCcEEEEEECccccccccCHHHHHHHHHHC
Confidence            357999999999984    457777776543


No 54 
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=76.02  E-value=2.5  Score=30.61  Aligned_cols=23  Identities=35%  Similarity=0.382  Sum_probs=17.2

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      +|.|+|.||+|+.     +.++.+.+++
T Consensus       107 ~piilv~nK~Dl~~~~~~~~~~~~~~~~  134 (164)
T cd04175         107 VPMILVGNKCDLEDERVVGKEQGQNLAR  134 (164)
T ss_pred             CCEEEEEECCcchhccEEcHHHHHHHHH
Confidence            6999999999985     3455556654


No 55 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=75.97  E-value=2  Score=31.25  Aligned_cols=16  Identities=56%  Similarity=0.764  Sum_probs=14.0

Q ss_pred             eceEEEEecCCCCCHH
Q psy7060         130 LPCIYAYNKIDQISIE  145 (160)
Q Consensus       130 ~P~iyv~NKiD~is~e  145 (160)
                      +|.++++||+|+...+
T Consensus       115 ~~i~iv~nK~D~~~~~  130 (189)
T cd00881         115 LPIIVAINKIDRVGEE  130 (189)
T ss_pred             CCeEEEEECCCCcchh
Confidence            7999999999998743


No 56 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=75.81  E-value=2.8  Score=28.37  Aligned_cols=23  Identities=30%  Similarity=0.375  Sum_probs=17.8

Q ss_pred             cceeceEEEEecCCCCCHHHHHH
Q psy7060         127 RVYLPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       127 rvY~P~iyv~NKiD~is~eevd~  149 (160)
                      ..-+|.++|.||+|+.+.++...
T Consensus       102 ~~~~~~ivv~nK~D~~~~~~~~~  124 (163)
T cd00880         102 ERGKPVLLVLNKIDLLPEEEEEE  124 (163)
T ss_pred             hcCCeEEEEEEccccCChhhHHH
Confidence            44579999999999997655543


No 57 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=75.81  E-value=4.2  Score=27.54  Aligned_cols=15  Identities=40%  Similarity=0.428  Sum_probs=13.5

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -.|.+++.||+|+.+
T Consensus       108 ~~p~ivv~nK~D~~~  122 (161)
T TIGR00231       108 NVPIILVGNKIDLRD  122 (161)
T ss_pred             CCcEEEEEEcccCCc
Confidence            569999999999986


No 58 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=75.45  E-value=4.7  Score=28.12  Aligned_cols=27  Identities=19%  Similarity=0.425  Sum_probs=19.4

Q ss_pred             HHHHHhcCcceeceEEEEecCCCCCHHHH
Q psy7060         119 LIDVINANRVYLPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       119 liDvi~~nrvY~P~iyv~NKiD~is~eev  147 (160)
                      ++..+...+  .|.+.+.||+|+.+.++.
T Consensus       102 ~~~~l~~~~--~~vi~v~nK~D~~~~~~~  128 (170)
T cd01876         102 MLDWLEELG--IPFLVVLTKADKLKKSEL  128 (170)
T ss_pred             HHHHHHHcC--CCEEEEEEchhcCChHHH
Confidence            455555443  699999999999876544


No 59 
>PRK04213 GTP-binding protein; Provisional
Probab=75.43  E-value=2.7  Score=31.89  Aligned_cols=16  Identities=44%  Similarity=0.511  Sum_probs=13.6

Q ss_pred             eeceEEEEecCCCCCH
Q psy7060         129 YLPCIYAYNKIDQISI  144 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~  144 (160)
                      =+|.++|.||+|+...
T Consensus       130 ~~p~iiv~NK~Dl~~~  145 (201)
T PRK04213        130 GIPPIVAVNKMDKIKN  145 (201)
T ss_pred             CCCeEEEEECccccCc
Confidence            3799999999999753


No 60 
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=75.31  E-value=4.6  Score=31.16  Aligned_cols=30  Identities=23%  Similarity=0.127  Sum_probs=20.7

Q ss_pred             HhcCcceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         123 INANRVYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       123 i~~nrvY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      +..+.-..|.++|.||+|+.     +.++..++++
T Consensus       104 i~~~~~~~piivVgNK~Dl~~~~~~~~~~~~~~~~  138 (199)
T cd04110         104 IEQNCDDVCKVLVGNKNDDPERKVVETEDAYKFAG  138 (199)
T ss_pred             HHHhCCCCCEEEEEECcccccccccCHHHHHHHHH
Confidence            33444568999999999985     3455665654


No 61 
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=75.27  E-value=3.6  Score=33.79  Aligned_cols=17  Identities=24%  Similarity=0.382  Sum_probs=14.4

Q ss_pred             eceEEEEecCCCCCHHH
Q psy7060         130 LPCIYAYNKIDQISIEE  146 (160)
Q Consensus       130 ~P~iyv~NKiD~is~ee  146 (160)
                      .|+++|.||+|+...++
T Consensus       108 ~p~ilV~NK~Dl~~~~~  124 (270)
T TIGR00436       108 RPVVLTRNKLDNKFKDK  124 (270)
T ss_pred             CCEEEEEECeeCCCHHH
Confidence            69999999999986544


No 62 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=75.07  E-value=12  Score=27.00  Aligned_cols=17  Identities=24%  Similarity=0.120  Sum_probs=14.1

Q ss_pred             ceeceEEEEecCCCCCH
Q psy7060         128 VYLPCIYAYNKIDQISI  144 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~  144 (160)
                      ..+|++++.||+|+...
T Consensus       106 ~~~p~ilv~NK~D~~~~  122 (167)
T cd04160         106 EGVPLLILANKQDLPDA  122 (167)
T ss_pred             cCCCEEEEEEccccccC
Confidence            35899999999998643


No 63 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=74.94  E-value=14  Score=26.88  Aligned_cols=17  Identities=24%  Similarity=0.214  Sum_probs=14.3

Q ss_pred             ceeceEEEEecCCCCCH
Q psy7060         128 VYLPCIYAYNKIDQISI  144 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~  144 (160)
                      ..+|.+++.||+|+...
T Consensus       114 ~~~p~ivv~nK~D~~~~  130 (173)
T cd04155         114 AGVPVLVFANKQDLATA  130 (173)
T ss_pred             cCCCEEEEEECCCCccC
Confidence            35899999999999764


No 64 
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=74.76  E-value=21  Score=26.44  Aligned_cols=24  Identities=25%  Similarity=0.202  Sum_probs=18.6

Q ss_pred             eceEEEEecCCCC---CHHHHHHHhcC
Q psy7060         130 LPCIYAYNKIDQI---SIEEVDRIARQ  153 (160)
Q Consensus       130 ~P~iyv~NKiD~i---s~eevd~i~~~  153 (160)
                      .|.++|.||.|+.   +.+++..+++.
T Consensus       101 ~piilv~NK~Dl~~~~~~~~~~~~~~~  127 (169)
T cd04158         101 ALLLIFANKQDVAGALSVEEMTELLSL  127 (169)
T ss_pred             CCEEEEEeCcCcccCCCHHHHHHHhCC
Confidence            6999999999985   55777666543


No 65 
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=74.62  E-value=3.5  Score=29.40  Aligned_cols=23  Identities=35%  Similarity=0.381  Sum_probs=16.5

Q ss_pred             eceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      +|.|+|.||+|+..     .++...+++
T Consensus       107 ~piilv~nK~Dl~~~~~~~~~~~~~~~~  134 (163)
T cd04136         107 VPMVLVGNKCDLEDERVVSREEGQALAR  134 (163)
T ss_pred             CCEEEEEECccccccceecHHHHHHHHH
Confidence            69999999999853     344455543


No 66 
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=74.49  E-value=2.1  Score=30.81  Aligned_cols=17  Identities=24%  Similarity=0.274  Sum_probs=14.1

Q ss_pred             ceeceEEEEecCCCCCH
Q psy7060         128 VYLPCIYAYNKIDQISI  144 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~  144 (160)
                      ...|.++|.||+|+.+.
T Consensus       106 ~~~p~ilv~nK~Dl~~~  122 (164)
T cd04101         106 KHMPGVLVGNKMDLADK  122 (164)
T ss_pred             CCCCEEEEEECcccccc
Confidence            45899999999998643


No 67 
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=74.30  E-value=4  Score=29.70  Aligned_cols=23  Identities=39%  Similarity=0.523  Sum_probs=17.2

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~  151 (160)
                      -+|+|+|.||+|+.     +.++..+++
T Consensus       106 ~~piilv~nK~Dl~~~~~v~~~~~~~~~  133 (165)
T cd04146         106 EIPVILVGNKADLLHYRQVSTEEGEKLA  133 (165)
T ss_pred             CCCEEEEEECCchHHhCccCHHHHHHHH
Confidence            58999999999985     345555554


No 68 
>PLN00223 ADP-ribosylation factor; Provisional
Probab=73.77  E-value=15  Score=28.18  Aligned_cols=26  Identities=15%  Similarity=-0.061  Sum_probs=17.9

Q ss_pred             eeceEEEEecCCCCC---HHHHHHHhcCC
Q psy7060         129 YLPCIYAYNKIDQIS---IEEVDRIARQP  154 (160)
Q Consensus       129 Y~P~iyv~NKiD~is---~eevd~i~~~p  154 (160)
                      -+|.+++.||+|+..   .+++.+....+
T Consensus       118 ~~piilv~NK~Dl~~~~~~~~~~~~l~l~  146 (181)
T PLN00223        118 DAVLLVFANKQDLPNAMNAAEITDKLGLH  146 (181)
T ss_pred             CCCEEEEEECCCCCCCCCHHHHHHHhCcc
Confidence            479999999999864   35555444433


No 69 
>TIGR02729 Obg_CgtA Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.
Probab=73.74  E-value=3  Score=36.18  Aligned_cols=21  Identities=38%  Similarity=0.523  Sum_probs=16.5

Q ss_pred             eceEEEEecCCCCCHHHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd~i  150 (160)
                      +|+|+|.||+|+.+.++++.+
T Consensus       274 kp~IIV~NK~DL~~~~~~~~~  294 (329)
T TIGR02729       274 KPRIVVLNKIDLLDEEELAEL  294 (329)
T ss_pred             CCEEEEEeCccCCChHHHHHH
Confidence            799999999999876554433


No 70 
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=73.70  E-value=5.5  Score=30.30  Aligned_cols=22  Identities=36%  Similarity=0.474  Sum_probs=15.9

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHh
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIA  151 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~  151 (160)
                      .|.|+|.||+|+.     +.++...++
T Consensus       107 ~piilvgNK~Dl~~~~~v~~~~~~~~~  133 (190)
T cd04144         107 VPIMIVGNKCDKVYEREVSTEEGAALA  133 (190)
T ss_pred             CCEEEEEEChhccccCccCHHHHHHHH
Confidence            6999999999984     444444444


No 71 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=73.58  E-value=4.2  Score=28.64  Aligned_cols=24  Identities=21%  Similarity=0.198  Sum_probs=17.3

Q ss_pred             ceeceEEEEecCCCCC----HHHHHHHh
Q psy7060         128 VYLPCIYAYNKIDQIS----IEEVDRIA  151 (160)
Q Consensus       128 vY~P~iyv~NKiD~is----~eevd~i~  151 (160)
                      --+|+++|.||+|+.+    .++..+++
T Consensus       105 ~~~piivv~nK~Dl~~~~~~~~~~~~~~  132 (162)
T cd04138         105 DDVPMVLVGNKCDLAARTVSSRQGQDLA  132 (162)
T ss_pred             CCCCEEEEEECcccccceecHHHHHHHH
Confidence            3579999999999864    34555553


No 72 
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=73.22  E-value=4.6  Score=35.27  Aligned_cols=51  Identities=24%  Similarity=0.230  Sum_probs=34.2

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecCCC------hhHHHHHHhcCcceeceEEEEecCCCCC
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFREDCN------ADELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired~t------~DdliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      ++.+..+.++++|.-..+.|++-=|++      ..++.+.+.    -.|.++|.||+|+.+
T Consensus        48 ~~~e~f~~~l~~~~~~~~~Il~VvD~~d~~~s~~~~l~~~~~----~~piilV~NK~DLl~  104 (360)
T TIGR03597        48 LNDDDFLNLLNSLGDSNALIVYVVDIFDFEGSLIPELKRFVG----GNPVLLVGNKIDLLP  104 (360)
T ss_pred             CCHHHHHHHHhhcccCCcEEEEEEECcCCCCCccHHHHHHhC----CCCEEEEEEchhhCC
Confidence            667889999999966655555444442      223444432    259999999999974


No 73 
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=72.84  E-value=5.2  Score=29.59  Aligned_cols=24  Identities=21%  Similarity=0.164  Sum_probs=16.2

Q ss_pred             HHHHhcCcceeceEEEEecCCCCC
Q psy7060         120 IDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       120 iDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      ++.+.....-.|+++|.||+|+.+
T Consensus        95 ~~~~~~~~~~~piilv~nK~Dl~~  118 (173)
T cd04130          95 IPEIRKHNPKAPIILVGTQADLRT  118 (173)
T ss_pred             HHHHHhhCCCCCEEEEeeChhhcc
Confidence            334433223479999999999863


No 74 
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=72.23  E-value=3.3  Score=29.92  Aligned_cols=19  Identities=37%  Similarity=0.641  Sum_probs=15.7

Q ss_pred             eceEEEEecCCCCCHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd  148 (160)
                      +|.|+|.||+|+.+.+++.
T Consensus       114 ~pvilv~NK~Dl~~~~~~~  132 (168)
T cd01897         114 KPVIVVLNKIDLLTFEDLS  132 (168)
T ss_pred             CCeEEEEEccccCchhhHH
Confidence            6999999999998665544


No 75 
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=72.13  E-value=6.9  Score=29.46  Aligned_cols=24  Identities=13%  Similarity=0.075  Sum_probs=17.3

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      ..|++++.||+|+.     +.++...+++
T Consensus       105 ~~~~ivv~nK~Dl~~~~~v~~~~~~~~~~  133 (188)
T cd04125         105 NVIKVIVANKSDLVNNKVVDSNIAKSFCD  133 (188)
T ss_pred             CCeEEEEEECCCCcccccCCHHHHHHHHH
Confidence            47999999999987     3345555543


No 76 
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=71.73  E-value=5.9  Score=29.48  Aligned_cols=25  Identities=16%  Similarity=0.157  Sum_probs=18.1

Q ss_pred             eeceEEEEecCCCCC---------HHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQIS---------IEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~is---------~eevd~i~~~  153 (160)
                      -+|.|+|.||.|+..         .++...+++.
T Consensus       105 ~~piilv~nK~Dl~~~~~~~~~v~~~~~~~~~~~  138 (187)
T cd04132         105 GTPIMLVGLKTDLRKDKNLDRKVTPAQAESVAKK  138 (187)
T ss_pred             CCCEEEEEeChhhhhCccccCCcCHHHHHHHHHH
Confidence            479999999999864         4555555443


No 77 
>PRK12288 GTPase RsgA; Reviewed
Probab=71.67  E-value=5.4  Score=35.19  Aligned_cols=16  Identities=31%  Similarity=0.389  Sum_probs=14.2

Q ss_pred             eceEEEEecCCCCCHH
Q psy7060         130 LPCIYAYNKIDQISIE  145 (160)
Q Consensus       130 ~P~iyv~NKiD~is~e  145 (160)
                      +|+++|+||+|+.+.+
T Consensus       151 i~~VIVlNK~DL~~~~  166 (347)
T PRK12288        151 IEPLIVLNKIDLLDDE  166 (347)
T ss_pred             CCEEEEEECccCCCcH
Confidence            7999999999998754


No 78 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=71.31  E-value=5.9  Score=28.98  Aligned_cols=14  Identities=50%  Similarity=0.392  Sum_probs=12.2

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.+.|.||+|+..
T Consensus       120 ~~iiiv~NK~Dl~~  133 (179)
T cd01890         120 LEIIPVINKIDLPS  133 (179)
T ss_pred             CCEEEEEECCCCCc
Confidence            58999999999864


No 79 
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=71.21  E-value=3.8  Score=34.12  Aligned_cols=20  Identities=20%  Similarity=0.202  Sum_probs=15.8

Q ss_pred             eceEEEEecCCCCCHHHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eevd~  149 (160)
                      .|.|+|+||+|+.+.++...
T Consensus        49 kp~IiVlNK~DL~~~~~~~~   68 (276)
T TIGR03596        49 KPRLIVLNKADLADPAVTKQ   68 (276)
T ss_pred             CCEEEEEEccccCCHHHHHH
Confidence            59999999999986654443


No 80 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=71.16  E-value=21  Score=27.17  Aligned_cols=17  Identities=41%  Similarity=0.348  Sum_probs=14.1

Q ss_pred             eeceEEEEecCCCCCHH
Q psy7060         129 YLPCIYAYNKIDQISIE  145 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~e  145 (160)
                      -+|.+++.||+|+.+.+
T Consensus       120 ~~~~iiv~NK~Dl~~~~  136 (192)
T cd01889         120 CKKLIVVLNKIDLIPEE  136 (192)
T ss_pred             CCCEEEEEECcccCCHH
Confidence            46999999999998543


No 81 
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=70.99  E-value=5.3  Score=31.09  Aligned_cols=14  Identities=14%  Similarity=-0.102  Sum_probs=12.2

Q ss_pred             ceeceEEEEecCCC
Q psy7060         128 VYLPCIYAYNKIDQ  141 (160)
Q Consensus       128 vY~P~iyv~NKiD~  141 (160)
                      --.|.|+|.||+|+
T Consensus       108 ~~~piilVgNK~DL  121 (182)
T cd04172         108 PNTKMLLVGCKSDL  121 (182)
T ss_pred             CCCCEEEEeEChhh
Confidence            35799999999997


No 82 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=70.93  E-value=3.1  Score=30.06  Aligned_cols=14  Identities=36%  Similarity=0.294  Sum_probs=12.6

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|++++.||+|+.+
T Consensus       113 ~~~i~v~NK~D~~~  126 (169)
T cd04114         113 VITILVGNKIDLAE  126 (169)
T ss_pred             CeEEEEEECccccc
Confidence            79999999999863


No 83 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=70.45  E-value=6.3  Score=32.15  Aligned_cols=56  Identities=16%  Similarity=0.141  Sum_probs=31.6

Q ss_pred             HHHHHHHHHHc---CccceEEEeecC--CChh--HHHHHHhcCcceeceEEEEecCCCCCHHHHH
Q psy7060          91 EKLVQLILHEY---KIFNAEVLFRED--CNAD--ELIDVINANRVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus        91 e~~V~~IL~EY---kI~NA~V~ired--~t~D--dliDvi~~nrvY~P~iyv~NKiD~is~eevd  148 (160)
                      ++..+..++..   ...=|-+.+..+  .+-.  +++..+....  +|.++|+||+|+.+.++++
T Consensus        95 ~~~~~~~~~~~~~~~~D~~llVvda~~g~~~~d~~~l~~l~~~~--ip~ivvvNK~D~~~~~~~~  157 (224)
T cd04165          95 ERYLKTTLFGLTGYAPDYAMLVVAANAGIIGMTKEHLGLALALN--IPVFVVVTKIDLAPANILQ  157 (224)
T ss_pred             HHHHHHHHHhhcccCCCEEEEEEECCCCCcHHHHHHHHHHHHcC--CCEEEEEECccccCHHHHH
Confidence            44444444433   333444555432  3332  3455555444  6999999999998765544


No 84 
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=70.40  E-value=24  Score=29.20  Aligned_cols=20  Identities=15%  Similarity=-0.157  Sum_probs=14.4

Q ss_pred             HhcCcceeceEEEEecCCCC
Q psy7060         123 INANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus       123 i~~nrvY~P~iyv~NKiD~i  142 (160)
                      +....--.|.|+|.||+|+.
T Consensus       111 i~~~~~~~piilVgNK~DL~  130 (232)
T cd04174         111 IMDYCPSTRILLIGCKTDLR  130 (232)
T ss_pred             HHHhCCCCCEEEEEECcccc
Confidence            44333357999999999973


No 85 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=70.39  E-value=16  Score=26.43  Aligned_cols=25  Identities=20%  Similarity=0.186  Sum_probs=18.0

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      -+|.++|.||+|+..     .++...+++.
T Consensus       107 ~~~~iiv~nK~Dl~~~~~~~~~~~~~~~~~  136 (166)
T cd01869         107 NVNKLLVGNKCDLTDKRVVDYSEAQEFADE  136 (166)
T ss_pred             CCcEEEEEEChhcccccCCCHHHHHHHHHH
Confidence            369999999999853     3556666543


No 86 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=70.36  E-value=4.2  Score=28.67  Aligned_cols=15  Identities=20%  Similarity=0.171  Sum_probs=13.4

Q ss_pred             eceEEEEecCCCCCH
Q psy7060         130 LPCIYAYNKIDQISI  144 (160)
Q Consensus       130 ~P~iyv~NKiD~is~  144 (160)
                      .|.++++||+|+.+.
T Consensus       114 ~~~iiv~nK~Dl~~~  128 (174)
T cd01895         114 KALVIVVNKWDLVEK  128 (174)
T ss_pred             CCEEEEEeccccCCc
Confidence            699999999999865


No 87 
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=70.27  E-value=39  Score=24.58  Aligned_cols=25  Identities=24%  Similarity=0.163  Sum_probs=18.9

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      -.|+++|.||+|+.     +.++...+++.
T Consensus       107 ~~~iiiv~nK~Dl~~~~~~~~~~~~~~~~~  136 (166)
T cd04122         107 NTVIFLIGNKADLEAQRDVTYEEAKQFADE  136 (166)
T ss_pred             CCeEEEEEECcccccccCcCHHHHHHHHHH
Confidence            47999999999985     44666766654


No 88 
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=70.27  E-value=3.2  Score=28.73  Aligned_cols=17  Identities=24%  Similarity=0.059  Sum_probs=14.0

Q ss_pred             eeceEEEEecCCCCCHH
Q psy7060         129 YLPCIYAYNKIDQISIE  145 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~e  145 (160)
                      -+|.++|.||+|+.+.+
T Consensus       101 ~~p~iiv~nK~D~~~~~  117 (159)
T cd04159         101 GIPLLVLGNKNDLPGAL  117 (159)
T ss_pred             CCCEEEEEeCccccCCc
Confidence            46999999999987543


No 89 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=70.13  E-value=3.9  Score=30.02  Aligned_cols=23  Identities=35%  Similarity=0.508  Sum_probs=15.8

Q ss_pred             HHHHhcCcceeceEEEEecCCCC
Q psy7060         120 IDVINANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus       120 iDvi~~nrvY~P~iyv~NKiD~i  142 (160)
                      ++.+....--+|.|+|.||+|+.
T Consensus        95 ~~~i~~~~~~~p~ivv~nK~Dl~  117 (161)
T cd04124          95 YEELREYRPEIPCIVVANKIDLD  117 (161)
T ss_pred             HHHHHHhCCCCcEEEEEECccCc
Confidence            33443332347999999999985


No 90 
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=69.90  E-value=6.7  Score=30.02  Aligned_cols=52  Identities=21%  Similarity=0.142  Sum_probs=28.7

Q ss_pred             HHHHHHHHHcCccceE-EEeecCCCh--hHHHHHHhcCcceeceEEEEecCCCCCH
Q psy7060          92 KLVQLILHEYKIFNAE-VLFREDCNA--DELIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus        92 ~~V~~IL~EYkI~NA~-V~ired~t~--DdliDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      ..++..+.+| +.+|+ |++-=|++-  .+..+.+.....=+|.++|+||+|+.+.
T Consensus        22 ~~~~~~l~~~-~~~ad~il~VvD~~~~~~~~~~~l~~~~~~~~~ilV~NK~Dl~~~   76 (190)
T cd01855          22 DFILNLLSSI-SPKKALVVHVVDIFDFPGSLIPRLRLFGGNNPVILVGNKIDLLPK   76 (190)
T ss_pred             HHHHHHHHhc-ccCCcEEEEEEECccCCCccchhHHHhcCCCcEEEEEEchhcCCC
Confidence            3378888888 55553 333333331  0111222111223699999999999753


No 91 
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=69.86  E-value=4.9  Score=29.65  Aligned_cols=25  Identities=28%  Similarity=0.283  Sum_probs=17.8

Q ss_pred             ceeceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      ..+|.|+|.||+|+..     .++...+++
T Consensus       105 ~~~p~ilv~NK~Dl~~~~~~~~~~~~~~~~  134 (180)
T cd04137         105 ESVPIVLVGNKSDLHTQRQVSTEEGKELAE  134 (180)
T ss_pred             CCCCEEEEEEchhhhhcCccCHHHHHHHHH
Confidence            4579999999999863     344555544


No 92 
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=69.48  E-value=14  Score=28.95  Aligned_cols=13  Identities=46%  Similarity=0.846  Sum_probs=12.1

Q ss_pred             eceEEEEecCCCC
Q psy7060         130 LPCIYAYNKIDQI  142 (160)
Q Consensus       130 ~P~iyv~NKiD~i  142 (160)
                      +|.+.|.||+|..
T Consensus       124 ~p~iiviNK~D~~  136 (213)
T cd04167         124 LPIVLVINKIDRL  136 (213)
T ss_pred             CCEEEEEECcccC
Confidence            7999999999986


No 93 
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=68.99  E-value=47  Score=25.27  Aligned_cols=25  Identities=28%  Similarity=0.234  Sum_probs=19.0

Q ss_pred             eeceEEEEecCCCC---CHHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQI---SIEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~i---s~eevd~i~~~  153 (160)
                      -.|.+++.||+|+.   +.+++.....+
T Consensus       118 ~~piliv~NK~Dl~~~~~~~~i~~~l~l  145 (184)
T smart00178      118 TVPFLILGNKIDAPYAASEDELRYALGL  145 (184)
T ss_pred             CCCEEEEEeCccccCCCCHHHHHHHcCC
Confidence            47999999999985   66777655433


No 94 
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=68.94  E-value=6.2  Score=32.60  Aligned_cols=18  Identities=33%  Similarity=0.392  Sum_probs=14.4

Q ss_pred             eeceEEEEecCCCCCHHH
Q psy7060         129 YLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~ee  146 (160)
                      =+|.++|.||+|+.+..+
T Consensus        67 ~i~~vIV~NK~DL~~~~~   84 (245)
T TIGR00157        67 NIEPIIVLNKIDLLDDED   84 (245)
T ss_pred             CCCEEEEEECcccCCCHH
Confidence            379999999999975433


No 95 
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=68.76  E-value=8.9  Score=28.28  Aligned_cols=27  Identities=26%  Similarity=0.202  Sum_probs=19.4

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcCC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQP  154 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~p  154 (160)
                      ..+|+++|.||+|+.     +.++.+++++..
T Consensus       108 ~~~p~iiv~nK~Dl~~~~~~~~~~~~~~~~~~  139 (170)
T cd04115         108 NEVPRILVGNKCDLREQIQVPTDLAQRFADAH  139 (170)
T ss_pred             CCCCEEEEEECccchhhcCCCHHHHHHHHHHc
Confidence            468999999999974     445566665443


No 96 
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=68.63  E-value=6.4  Score=30.27  Aligned_cols=13  Identities=15%  Similarity=-0.010  Sum_probs=11.7

Q ss_pred             eeceEEEEecCCC
Q psy7060         129 YLPCIYAYNKIDQ  141 (160)
Q Consensus       129 Y~P~iyv~NKiD~  141 (160)
                      -.|.|+|.||.|+
T Consensus       105 ~~~iilVgnK~DL  117 (178)
T cd04131         105 NTKVLLVGCKTDL  117 (178)
T ss_pred             CCCEEEEEEChhh
Confidence            4799999999997


No 97 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=68.62  E-value=6.7  Score=26.62  Aligned_cols=49  Identities=24%  Similarity=0.272  Sum_probs=35.3

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEE
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYA  135 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv  135 (160)
                      .+.||.-+.-...++.++.||++. +++.--+  +.|+   +..-+-..+|++++
T Consensus         7 a~~C~~C~~~~~~~~~~~~e~~~~-~~~~~v~--~~~~---a~~~~v~~vPti~i   55 (76)
T TIGR00412         7 GTGCANCQMTEKNVKKAVEELGID-AEFEKVT--DMNE---ILEAGVTATPGVAV   55 (76)
T ss_pred             CCCCcCHHHHHHHHHHHHHHcCCC-eEEEEeC--CHHH---HHHcCCCcCCEEEE
Confidence            478999999999999999999854 3331111  2443   55568888999998


No 98 
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=68.48  E-value=5.6  Score=29.65  Aligned_cols=22  Identities=18%  Similarity=0.291  Sum_probs=17.4

Q ss_pred             cceeceEEEEecCCCCCHHHHH
Q psy7060         127 RVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       127 rvY~P~iyv~NKiD~is~eevd  148 (160)
                      ...+|++++.||+|+.+.++..
T Consensus       133 ~~~~~~iiv~nK~Dl~~~~~~~  154 (196)
T PRK00454        133 EYGIPVLIVLTKADKLKKGERK  154 (196)
T ss_pred             HcCCcEEEEEECcccCCHHHHH
Confidence            3468999999999999865544


No 99 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=68.08  E-value=6  Score=29.28  Aligned_cols=23  Identities=26%  Similarity=0.083  Sum_probs=17.1

Q ss_pred             eeceEEEEecCCCC---CHHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQI---SIEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~i---s~eevd~i~  151 (160)
                      =.|.++|.||+|+.   +.+++....
T Consensus       115 ~~p~iiv~nK~Dl~~~~~~~~~~~~~  140 (173)
T cd04154         115 GATLLILANKQDLPGALSEEEIREAL  140 (173)
T ss_pred             CCCEEEEEECcccccCCCHHHHHHHh
Confidence            47999999999986   345655554


No 100
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=68.00  E-value=9.4  Score=27.30  Aligned_cols=25  Identities=28%  Similarity=0.128  Sum_probs=18.2

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      .-.|.+++.||+|+.     +.+++.++++
T Consensus       105 ~~~~iivv~nK~D~~~~~~~~~~~~~~~~~  134 (163)
T cd01860         105 PNIIIALVGNKADLESKRQVSTEEAQEYAD  134 (163)
T ss_pred             CCCeEEEEEECccccccCcCCHHHHHHHHH
Confidence            447899999999987     3456666543


No 101
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=67.86  E-value=25  Score=26.12  Aligned_cols=16  Identities=25%  Similarity=0.164  Sum_probs=13.5

Q ss_pred             ceeceEEEEecCCCCC
Q psy7060         128 VYLPCIYAYNKIDQIS  143 (160)
Q Consensus       128 vY~P~iyv~NKiD~is  143 (160)
                      ...|.++|.||+|+..
T Consensus        99 ~~~piliv~NK~Dl~~  114 (167)
T cd04161          99 SGKPILVLANKQDKKN  114 (167)
T ss_pred             cCCcEEEEEeCCCCcC
Confidence            3579999999999863


No 102
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=67.43  E-value=44  Score=25.30  Aligned_cols=24  Identities=29%  Similarity=0.380  Sum_probs=17.8

Q ss_pred             ceeceEEEEecCCCC---CHHHHHHHh
Q psy7060         128 VYLPCIYAYNKIDQI---SIEEVDRIA  151 (160)
Q Consensus       128 vY~P~iyv~NKiD~i---s~eevd~i~  151 (160)
                      .-+|+++|.||+|+.   +.++++.+.
T Consensus       108 ~~~p~iiv~NK~D~~~~~~~~~~~~~~  134 (183)
T cd04152         108 QGVPVLVLANKQDLPNALSVSEVEKLL  134 (183)
T ss_pred             CCCcEEEEEECcCccccCCHHHHHHHh
Confidence            357999999999986   345566554


No 103
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known i
Probab=67.35  E-value=13  Score=23.96  Aligned_cols=62  Identities=15%  Similarity=0.221  Sum_probs=39.5

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHH---hcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVI---NANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi---~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      +.||.-    ..++.+|++++|.-.++-+..+   .+..+.+   .+.+...|+|++=.+. .-+-+++.++.
T Consensus         8 ~~Cp~C----~~ak~~L~~~~i~~~~i~i~~~---~~~~~~~~~~~~~~~~vP~v~i~g~~-igg~~~~~~~~   72 (75)
T cd03418           8 PNCPYC----VRAKALLDKKGVDYEEIDVDGD---PALREEMINRSGGRRTVPQIFIGDVH-IGGCDDLYALE   72 (75)
T ss_pred             CCChHH----HHHHHHHHHCCCcEEEEECCCC---HHHHHHHHHHhCCCCccCEEEECCEE-EeChHHHHHHH
Confidence            556653    4689999999998888877765   3333333   3445588999865542 22456665554


No 104
>PRK12299 obgE GTPase CgtA; Reviewed
Probab=67.29  E-value=12  Score=32.64  Aligned_cols=17  Identities=47%  Similarity=0.575  Sum_probs=14.2

Q ss_pred             eceEEEEecCCCCCHHH
Q psy7060         130 LPCIYAYNKIDQISIEE  146 (160)
Q Consensus       130 ~P~iyv~NKiD~is~ee  146 (160)
                      +|+|+|.||+|+.+.++
T Consensus       272 kp~IIV~NKiDL~~~~~  288 (335)
T PRK12299        272 KPRILVLNKIDLLDEEE  288 (335)
T ss_pred             CCeEEEEECcccCCchh
Confidence            69999999999985543


No 105
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=66.93  E-value=2.7  Score=30.01  Aligned_cols=23  Identities=35%  Similarity=0.299  Sum_probs=16.5

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~  151 (160)
                      =+|+++|.||+|+..     .++...++
T Consensus       107 ~~piiiv~NK~Dl~~~~~~~~~~~~~~~  134 (164)
T cd04145         107 EFPMILVGNKADLEHQRKVSREEGQELA  134 (164)
T ss_pred             CCCEEEEeeCccccccceecHHHHHHHH
Confidence            369999999999863     34554444


No 106
>COG1084 Predicted GTPase [General function prediction only]
Probab=66.91  E-value=44  Score=30.73  Aligned_cols=67  Identities=25%  Similarity=0.262  Sum_probs=50.0

Q ss_pred             CCCcccCHHHHHHHHHHcCccceEEEeec---C--CChhHHHH---HHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          84 CPLTQVNEKLVQLILHEYKIFNAEVLFRE---D--CNADELID---VINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        84 ~~~~~~~e~~V~~IL~EYkI~NA~V~ire---d--~t~DdliD---vi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      -|+...|+=+-|+|+.=--+-++.+.|-.   .  .++++=+.   -|.++-. .|.+.|+||+|....|+++++.
T Consensus       228 RPl~ErN~IE~qAi~AL~hl~~~IlF~~D~Se~cgy~lE~Q~~L~~eIk~~f~-~p~v~V~nK~D~~~~e~~~~~~  302 (346)
T COG1084         228 RPLEERNEIERQAILALRHLAGVILFLFDPSETCGYSLEEQISLLEEIKELFK-APIVVVINKIDIADEEKLEEIE  302 (346)
T ss_pred             CChHHhcHHHHHHHHHHHHhcCeEEEEEcCccccCCCHHHHHHHHHHHHHhcC-CCeEEEEecccccchhHHHHHH
Confidence            48888999999999987777777776643   2  34555444   4444444 7999999999999898888874


No 107
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=66.78  E-value=6  Score=29.82  Aligned_cols=17  Identities=18%  Similarity=0.368  Sum_probs=14.3

Q ss_pred             eeceEEEEecCCCCCHH
Q psy7060         129 YLPCIYAYNKIDQISIE  145 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~e  145 (160)
                      -+|.+++.||+|+.+.+
T Consensus       129 ~~pviiv~nK~D~~~~~  145 (179)
T TIGR03598       129 GIPVLIVLTKADKLKKS  145 (179)
T ss_pred             CCCEEEEEECcccCCHH
Confidence            36999999999998653


No 108
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=66.69  E-value=12  Score=29.23  Aligned_cols=48  Identities=15%  Similarity=0.144  Sum_probs=29.4

Q ss_pred             HHHHHHHcCccceEEEee---cCCChhH--HHHHHhcCcceeceEEEEecCCCCC
Q psy7060          94 VQLILHEYKIFNAEVLFR---EDCNADE--LIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus        94 V~~IL~EYkI~NA~V~ir---ed~t~Dd--liDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      .+..+++.++..+++.+-   ++.+..|  ++..+...  -.|+++|.||+|+..
T Consensus        69 ~~~~l~~~~~~~~d~~l~v~~~~~~~~d~~~~~~l~~~--~~~~ilV~nK~D~~~  121 (197)
T cd04104          69 PDDYLEEMKFSEYDFFIIISSTRFSSNDVKLAKAIQCM--GKKFYFVRTKVDRDL  121 (197)
T ss_pred             HHHHHHHhCccCcCEEEEEeCCCCCHHHHHHHHHHHHh--CCCEEEEEecccchh
Confidence            345566666666555443   3334333  44555443  369999999999974


No 109
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=66.60  E-value=6.4  Score=28.23  Aligned_cols=26  Identities=19%  Similarity=0.069  Sum_probs=18.7

Q ss_pred             ceeceEEEEecCCCCC---HHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQIS---IEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~is---~eevd~i~~~  153 (160)
                      --.|+++|.||+|+..   .+++....+.
T Consensus        99 ~~~piiiv~nK~D~~~~~~~~~~~~~~~~  127 (158)
T cd00878          99 KGVPLLIFANKQDLPGALSVSELIEKLGL  127 (158)
T ss_pred             CCCcEEEEeeccCCccccCHHHHHHhhCh
Confidence            3579999999999985   3455555443


No 110
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=66.20  E-value=15  Score=30.98  Aligned_cols=54  Identities=11%  Similarity=0.127  Sum_probs=31.7

Q ss_pred             HHHHHHHHHHcC-----ccceEEEeecCCChhHHHHHHh-cCcceeceEEEEecCCCCCH
Q psy7060          91 EKLVQLILHEYK-----IFNAEVLFREDCNADELIDVIN-ANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus        91 e~~V~~IL~EYk-----I~NA~V~ired~t~DdliDvi~-~nrvY~P~iyv~NKiD~is~  144 (160)
                      .+.|+....+|=     |.=+.|--+.|.+..|..+... -.+...|+|.|+||+|..+.
T Consensus       148 ~~~i~~lv~~yi~~~~~IIL~Vvda~~d~~~~d~l~ia~~ld~~~~rti~ViTK~D~~~~  207 (240)
T smart00053      148 EEQIKDMIKQFISKEECLILAVTPANVDLANSDALKLAKEVDPQGERTIGVITKLDLMDE  207 (240)
T ss_pred             HHHHHHHHHHHHhCccCeEEEEEECCCCCCchhHHHHHHHHHHcCCcEEEEEECCCCCCc
Confidence            356777777772     2223333344544444333332 24566899999999999854


No 111
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=66.13  E-value=10  Score=29.64  Aligned_cols=25  Identities=20%  Similarity=0.092  Sum_probs=17.5

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      -.|.++|.||+|+..     .++...+++.
T Consensus       109 ~~piilVgNK~DL~~~~~v~~~~~~~~~~~  138 (215)
T cd04109         109 QPLVVLVGNKTDLEHNRTVKDDKHARFAQA  138 (215)
T ss_pred             CceEEEEEECcccccccccCHHHHHHHHHH
Confidence            457899999999863     3556666543


No 112
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=66.06  E-value=7.1  Score=28.56  Aligned_cols=15  Identities=27%  Similarity=0.359  Sum_probs=13.0

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      =+|+++|.||+|+..
T Consensus       108 ~~piilv~nK~Dl~~  122 (165)
T cd04140         108 KIPIMLVGNKCDESH  122 (165)
T ss_pred             CCCEEEEEECccccc
Confidence            369999999999864


No 113
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=65.91  E-value=5.6  Score=33.60  Aligned_cols=30  Identities=23%  Similarity=0.294  Sum_probs=20.7

Q ss_pred             hhHHHHHHhcCcceeceEEEEecCCCCCHHH
Q psy7060         116 ADELIDVINANRVYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       116 ~DdliDvi~~nrvY~P~iyv~NKiD~is~ee  146 (160)
                      -||+.....+ -.=+|.++|+||+|+...++
T Consensus       160 ~~el~~~~~~-l~~~~~ivv~NK~Dl~~~~~  189 (300)
T TIGR00750       160 GDDLQGIKAG-LMEIADIYVVNKADGEGATN  189 (300)
T ss_pred             cHHHHHHHHH-HhhhccEEEEEcccccchhH
Confidence            4666554432 34578999999999986653


No 114
>PRK11058 GTPase HflX; Provisional
Probab=65.90  E-value=24  Score=31.91  Aligned_cols=15  Identities=33%  Similarity=0.620  Sum_probs=13.2

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|.|+|+||+|+.+
T Consensus       309 ~~pvIiV~NKiDL~~  323 (426)
T PRK11058        309 EIPTLLVMNKIDMLD  323 (426)
T ss_pred             CCCEEEEEEcccCCC
Confidence            379999999999975


No 115
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterized by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase.
Probab=65.79  E-value=17  Score=23.93  Aligned_cols=63  Identities=17%  Similarity=0.176  Sum_probs=39.8

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCC-hhHHHHHHhcCcceeceEEEEec--CCCCCHHHHHHH
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCN-ADELIDVINANRVYLPCIYAYNK--IDQISIEEVDRI  150 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t-~DdliDvi~~nrvY~P~iyv~NK--iD~is~eevd~i  150 (160)
                      .++||.    =..+++.|.+.+|.--++-+.++-. .+++..   ..+..+|++++-.+  +---+.++++.+
T Consensus         6 ~~~Cp~----C~~ak~~L~~~~i~~~~~di~~~~~~~~~~~~---~g~~~vP~v~~~g~~~~~G~~~~~~~~~   71 (72)
T TIGR02194         6 KNNCVQ----CKMTKKALEEHGIAFEEINIDEQPEAIDYVKA---QGFRQVPVIVADGDLSWSGFRPDKLKAL   71 (72)
T ss_pred             CCCCHH----HHHHHHHHHHCCCceEEEECCCCHHHHHHHHH---cCCcccCEEEECCCcEEeccCHHHHHhc
Confidence            356764    3568899999999888888876642 333332   24568999977554  222255666554


No 116
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=65.53  E-value=10  Score=28.95  Aligned_cols=24  Identities=13%  Similarity=-0.058  Sum_probs=17.1

Q ss_pred             HHHhcCcceeceEEEEecCCCCCH
Q psy7060         121 DVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       121 Dvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      +.+.....-.|.++|.||+|+...
T Consensus        96 ~~i~~~~~~~piilvgNK~Dl~~~  119 (189)
T cd04134          96 GEIREHCPGVKLVLVALKCDLREA  119 (189)
T ss_pred             HHHHHhCCCCCEEEEEEChhhccC
Confidence            344443346899999999998643


No 117
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=65.13  E-value=14  Score=31.07  Aligned_cols=28  Identities=18%  Similarity=0.264  Sum_probs=20.8

Q ss_pred             HHHHhcCcceeceEEEEecCCCCCHHHHHHH
Q psy7060         120 IDVINANRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       120 iDvi~~nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      +..+.+   .+|.|.|.||+|+.+.+|+..+
T Consensus       137 lk~l~~---~v~vi~VinK~D~l~~~e~~~~  164 (276)
T cd01850         137 MKRLSK---RVNIIPVIAKADTLTPEELKEF  164 (276)
T ss_pred             HHHHhc---cCCEEEEEECCCcCCHHHHHHH
Confidence            444443   5899999999999987766543


No 118
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=64.89  E-value=25  Score=29.48  Aligned_cols=27  Identities=26%  Similarity=0.270  Sum_probs=18.9

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCCHHHHH
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is~eevd  148 (160)
                      ++.+.+. +   +|.|+|+||+|+.+.+...
T Consensus        44 ~l~~~~~-~---kp~iiVlNK~DL~~~~~~~   70 (287)
T PRK09563         44 MIDKIIG-N---KPRLLILNKSDLADPEVTK   70 (287)
T ss_pred             hHHHHhC-C---CCEEEEEEchhcCCHHHHH
Confidence            3455443 3   5999999999998765443


No 119
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=64.83  E-value=9.5  Score=29.98  Aligned_cols=53  Identities=23%  Similarity=0.219  Sum_probs=29.5

Q ss_pred             HcCccceEEEeecCCChhHH------HHHHhcCc----ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         100 EYKIFNAEVLFREDCNADEL------IDVINANR----VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       100 EYkI~NA~V~ired~t~Ddl------iDvi~~nr----vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      .|+--+|-+++..-.+.+.+      ++-+...+    .=+|+++|.||+|+.     +.++...+++
T Consensus        77 ~~~~ad~iilv~D~~~~~S~~~~~~~~~~i~~~~~~~~~~~piiivgNK~Dl~~~~~~~~~~~~~~~~  144 (198)
T cd04142          77 GLRNSRAFILVYDICSPDSFHYVKLLRQQILETRPAGNKEPPIVVVGNKRDQQRHRFAPRHVLSVLVR  144 (198)
T ss_pred             hhccCCEEEEEEECCCHHHHHHHHHHHHHHHHhcccCCCCCCEEEEEECccccccccccHHHHHHHHH
Confidence            34545555555544344333      33343332    237999999999994     3345555543


No 120
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=64.71  E-value=52  Score=23.97  Aligned_cols=23  Identities=26%  Similarity=0.147  Sum_probs=16.8

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~  151 (160)
                      ..|.++|.||+|+..     .++...++
T Consensus       106 ~~piivv~nK~Dl~~~~~~~~~~~~~~~  133 (165)
T cd01865         106 NAQVILVGNKCDMEDERVVSSERGRQLA  133 (165)
T ss_pred             CCCEEEEEECcccCcccccCHHHHHHHH
Confidence            579999999999863     35555553


No 121
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=64.47  E-value=8  Score=25.46  Aligned_cols=23  Identities=30%  Similarity=0.247  Sum_probs=17.9

Q ss_pred             hcCcceeceEEEEecCCCCCHHH
Q psy7060         124 NANRVYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       124 ~~nrvY~P~iyv~NKiD~is~ee  146 (160)
                      .....-.|++++.||+|....++
T Consensus        97 ~~~~~~~~~ivv~nk~D~~~~~~  119 (157)
T cd00882          97 NKEGENIPIILVGNKIDLPEERV  119 (157)
T ss_pred             hhccCCCcEEEEEeccccccccc
Confidence            34556689999999999986544


No 122
>PLN03108 Rab family protein; Provisional
Probab=64.40  E-value=58  Score=25.51  Aligned_cols=26  Identities=27%  Similarity=0.308  Sum_probs=20.0

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      ..+|++.+.||+|+.     +.++.+++++.
T Consensus       110 ~~~piiiv~nK~Dl~~~~~~~~~~~~~~~~~  140 (210)
T PLN03108        110 ANMTIMLIGNKCDLAHRRAVSTEEGEQFAKE  140 (210)
T ss_pred             CCCcEEEEEECccCccccCCCHHHHHHHHHH
Confidence            368999999999985     45677777653


No 123
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=64.32  E-value=11  Score=28.57  Aligned_cols=14  Identities=29%  Similarity=0.266  Sum_probs=12.6

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      ..|.|+|.||+|+.
T Consensus       105 ~~piilvgnK~Dl~  118 (174)
T cd01871         105 NTPIILVGTKLDLR  118 (174)
T ss_pred             CCCEEEEeeChhhc
Confidence            58999999999984


No 124
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=64.08  E-value=7.6  Score=26.74  Aligned_cols=24  Identities=42%  Similarity=0.555  Sum_probs=18.4

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      +|.+++.||+|+.     +.+++..+++.
T Consensus       106 ~p~ivv~nK~D~~~~~~~~~~~~~~~~~~  134 (159)
T cd00154         106 IPIILVGNKIDLEDQRQVSTEEAQQFAKE  134 (159)
T ss_pred             CcEEEEEEcccccccccccHHHHHHHHHH
Confidence            6999999999995     44677666543


No 125
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=63.81  E-value=3.4  Score=29.21  Aligned_cols=15  Identities=40%  Similarity=0.580  Sum_probs=13.2

Q ss_pred             eceEEEEecCCCCCH
Q psy7060         130 LPCIYAYNKIDQISI  144 (160)
Q Consensus       130 ~P~iyv~NKiD~is~  144 (160)
                      +|.+++.||+|+...
T Consensus       102 ~~~iiv~NK~Dl~~~  116 (158)
T cd01879         102 LPVVVALNMIDEAEK  116 (158)
T ss_pred             CCEEEEEehhhhccc
Confidence            699999999999754


No 126
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=63.68  E-value=7.5  Score=34.74  Aligned_cols=18  Identities=39%  Similarity=0.532  Sum_probs=15.2

Q ss_pred             eceEEEEecCCCCCHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eev  147 (160)
                      .|.|+|+||+|+.+.+++
T Consensus       276 kP~IlVlNKiDl~~~~el  293 (390)
T PRK12298        276 KPRWLVFNKIDLLDEEEA  293 (390)
T ss_pred             CCEEEEEeCCccCChHHH
Confidence            699999999999876544


No 127
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=63.64  E-value=7.1  Score=27.67  Aligned_cols=23  Identities=30%  Similarity=0.231  Sum_probs=17.4

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      .|.++|.||+|+.     +.++...+++
T Consensus       111 ~piilv~nK~Dl~~~~~~~~~~~~~~~~  138 (168)
T cd04119         111 IVVVVCANKIDLTKHRAVSEDEGRLWAE  138 (168)
T ss_pred             ceEEEEEEchhcccccccCHHHHHHHHH
Confidence            7999999999986     4566555543


No 128
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=63.64  E-value=8.6  Score=27.33  Aligned_cols=24  Identities=25%  Similarity=0.183  Sum_probs=17.5

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      -+|++++.||+|+..     .+++..+++
T Consensus       105 ~~pivvv~nK~D~~~~~~~~~~~~~~~~~  133 (164)
T smart00175      105 NVVIMLVGNKSDLEDQRQVSREEAEAFAE  133 (164)
T ss_pred             CCeEEEEEEchhcccccCCCHHHHHHHHH
Confidence            479999999999874     245555543


No 129
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=63.45  E-value=7.6  Score=32.75  Aligned_cols=16  Identities=19%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             eceEEEEecCCCCCHH
Q psy7060         130 LPCIYAYNKIDQISIE  145 (160)
Q Consensus       130 ~P~iyv~NKiD~is~e  145 (160)
                      +|.+.|+||+|+.+..
T Consensus       110 ip~iIVlNK~DL~~~~  125 (287)
T cd01854         110 IEPVIVLTKADLLDDE  125 (287)
T ss_pred             CCEEEEEEHHHCCChH
Confidence            7999999999998653


No 130
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=63.32  E-value=7.7  Score=28.91  Aligned_cols=16  Identities=31%  Similarity=0.227  Sum_probs=13.5

Q ss_pred             ceeceEEEEecCCCCC
Q psy7060         128 VYLPCIYAYNKIDQIS  143 (160)
Q Consensus       128 vY~P~iyv~NKiD~is  143 (160)
                      --+|.++|.||+|+..
T Consensus        98 ~~~piilv~NK~Dl~~  113 (164)
T cd04162          98 PDLPLVVLANKQDLPA  113 (164)
T ss_pred             CCCcEEEEEeCcCCcC
Confidence            3479999999999864


No 131
>PRK00093 GTP-binding protein Der; Reviewed
Probab=63.31  E-value=6.7  Score=34.02  Aligned_cols=19  Identities=16%  Similarity=0.106  Sum_probs=15.4

Q ss_pred             eeceEEEEecCCCCCHHHH
Q psy7060         129 YLPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~eev  147 (160)
                      -.|+++|+||+|+.+.++.
T Consensus       284 ~~~~ivv~NK~Dl~~~~~~  302 (435)
T PRK00093        284 GRALVIVVNKWDLVDEKTM  302 (435)
T ss_pred             CCcEEEEEECccCCCHHHH
Confidence            4799999999999865443


No 132
>PRK13796 GTPase YqeH; Provisional
Probab=63.27  E-value=20  Score=31.44  Aligned_cols=52  Identities=17%  Similarity=0.061  Sum_probs=33.3

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecCC-----ChhHHHHHHhcCcceeceEEEEecCCCCC
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFREDC-----NADELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired~-----t~DdliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      ++.++.+.+|++-+=.+|.|..-=|+     +....+.-+.++   .|.++|+||+|+.+
T Consensus        54 ~~~~~~~~~l~~i~~~~~lIv~VVD~~D~~~s~~~~L~~~~~~---kpviLViNK~DLl~  110 (365)
T PRK13796         54 LTDDDFLKLLNGIGDSDALVVNVVDIFDFNGSWIPGLHRFVGN---NPVLLVGNKADLLP  110 (365)
T ss_pred             CCHHHHHHHHHhhcccCcEEEEEEECccCCCchhHHHHHHhCC---CCEEEEEEchhhCC
Confidence            67778889999988666554443333     222222222233   48999999999974


No 133
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=62.71  E-value=7  Score=33.66  Aligned_cols=16  Identities=19%  Similarity=0.179  Sum_probs=13.8

Q ss_pred             eceEEEEecCCCC-CHH
Q psy7060         130 LPCIYAYNKIDQI-SIE  145 (160)
Q Consensus       130 ~P~iyv~NKiD~i-s~e  145 (160)
                      +|+|+|.||+|+. +.+
T Consensus       284 ~~iiiv~NK~Dl~~~~~  300 (429)
T TIGR03594       284 KALVIVVNKWDLVKDEK  300 (429)
T ss_pred             CcEEEEEECcccCCCHH
Confidence            6999999999998 443


No 134
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=62.63  E-value=36  Score=26.01  Aligned_cols=14  Identities=21%  Similarity=-0.104  Sum_probs=12.6

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      ..|+|+|.||.|+.
T Consensus       118 ~~piilv~NK~Dl~  131 (182)
T PTZ00133        118 DAVLLVFANKQDLP  131 (182)
T ss_pred             CCCEEEEEeCCCCC
Confidence            47999999999986


No 135
>PRK10597 DNA damage-inducible protein I; Provisional
Probab=62.52  E-value=22  Score=26.18  Aligned_cols=50  Identities=18%  Similarity=0.226  Sum_probs=35.5

Q ss_pred             HHHHHHHHHHHhcCceeccCCCC----eEEEEecCcceEEecccCCchhhHHHHHHHHHH
Q psy7060           9 VQRGLLEKELESVGIRLNKKKPN----IYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHE   64 (160)
Q Consensus         9 ~q~~~le~ELe~~GIrLnkk~p~----I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~   64 (160)
                      .-...|+.||+.   ||.+..|+    |.+++..+-|+++.+..+-   |-+.+..+|.+
T Consensus        16 ga~~AL~~EL~k---Rl~~~fPd~~~~v~Vr~~s~n~lsv~g~~k~---dK~~i~eiLqE   69 (81)
T PRK10597         16 GAIDALAGELSR---RIQYAFPDNEGHVSVRYAAANNLSVIGATKE---DKDRISEILQE   69 (81)
T ss_pred             hHHHHHHHHHHH---HHHhhCCCCCccEEEeecCCCceEecCCCcc---hHHHHHHHHHH
Confidence            456788888886   78888887    6777777789999776443   34555555554


No 136
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=62.30  E-value=55  Score=24.48  Aligned_cols=22  Identities=18%  Similarity=-0.016  Sum_probs=17.2

Q ss_pred             eeceEEEEecCCCC---CHHHHHHH
Q psy7060         129 YLPCIYAYNKIDQI---SIEEVDRI  150 (160)
Q Consensus       129 Y~P~iyv~NKiD~i---s~eevd~i  150 (160)
                      -.|.++|.||+|+.   +.+++...
T Consensus       110 ~~piilv~NK~Dl~~~~~~~~i~~~  134 (168)
T cd04149         110 DALLLVFANKQDLPDAMKPHEIQEK  134 (168)
T ss_pred             CCcEEEEEECcCCccCCCHHHHHHH
Confidence            37999999999986   45666664


No 137
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=61.95  E-value=14  Score=28.31  Aligned_cols=14  Identities=21%  Similarity=0.195  Sum_probs=12.5

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|.++|.||.|+.
T Consensus       107 ~~piilvgNK~DL~  120 (191)
T cd01875         107 NVPILLVGTKKDLR  120 (191)
T ss_pred             CCCEEEEEeChhhh
Confidence            47999999999985


No 138
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=61.91  E-value=5.5  Score=28.64  Aligned_cols=22  Identities=27%  Similarity=0.157  Sum_probs=16.2

Q ss_pred             HhcCcceeceEEEEecCCCCCH
Q psy7060         123 INANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       123 i~~nrvY~P~iyv~NKiD~is~  144 (160)
                      +......+|.++|.||+|+...
T Consensus        98 ~~~~~~~~p~ivv~nK~Dl~~~  119 (171)
T cd00157          98 IRHYCPNVPIILVGTKIDLRDD  119 (171)
T ss_pred             HHhhCCCCCEEEEEccHHhhhc
Confidence            3333346999999999998744


No 139
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=61.90  E-value=4.4  Score=32.31  Aligned_cols=16  Identities=31%  Similarity=0.148  Sum_probs=13.8

Q ss_pred             ceeceEEEEecCCCCC
Q psy7060         128 VYLPCIYAYNKIDQIS  143 (160)
Q Consensus       128 vY~P~iyv~NKiD~is  143 (160)
                      ..+|.|+|.||+|+..
T Consensus       105 ~~~piilV~NK~Dl~~  120 (221)
T cd04148         105 EDRPIILVGNKSDLAR  120 (221)
T ss_pred             CCCCEEEEEEChhccc
Confidence            4689999999999853


No 140
>KOG4252|consensus
Probab=61.67  E-value=5.3  Score=34.73  Aligned_cols=94  Identities=23%  Similarity=0.334  Sum_probs=54.5

Q ss_pred             HHHHHhh--hhhhHHhhhcCccccccCCCcccCHHHHHHHH-------------H-HcCccceEEEeecCCChhHHH---
Q psy7060          60 LILHEYK--IFNAEQKKAGGIAFNSTCPLTQVNEKLVQLIL-------------H-EYKIFNAEVLFREDCNADELI---  120 (160)
Q Consensus        60 ~~l~~yk--i~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL-------------~-EYkI~NA~V~ired~t~Ddli---  120 (160)
                      +.+..|-  ||--+-|+.=|..|-  .---+++.++|+..|             + -|+=--|-|++-.--+...|.   
T Consensus        35 smiqryCkgifTkdykktIgvdfl--erqi~v~~Edvr~mlWdtagqeEfDaItkAyyrgaqa~vLVFSTTDr~SFea~~  112 (246)
T KOG4252|consen   35 SMIQRYCKGIFTKDYKKTIGVDFL--ERQIKVLIEDVRSMLWDTAGQEEFDAITKAYYRGAQASVLVFSTTDRYSFEATL  112 (246)
T ss_pred             HHHHHHhccccccccccccchhhh--hHHHHhhHHHHHHHHHHhccchhHHHHHHHHhccccceEEEEecccHHHHHHHH
Confidence            4455554  666666666665542  122234555555544             2 245556677765433333332   


Q ss_pred             ---HHHhcCcceeceEEEEecCCCC-----CHHHHHHHhcCCC
Q psy7060         121 ---DVINANRVYLPCIYAYNKIDQI-----SIEEVDRIARQPN  155 (160)
Q Consensus       121 ---Dvi~~nrvY~P~iyv~NKiD~i-----s~eevd~i~~~p~  155 (160)
                         .-+....--+|.++|-||||++     +.+|++.+|+.-|
T Consensus       113 ~w~~kv~~e~~~IPtV~vqNKIDlveds~~~~~evE~lak~l~  155 (246)
T KOG4252|consen  113 EWYNKVQKETERIPTVFVQNKIDLVEDSQMDKGEVEGLAKKLH  155 (246)
T ss_pred             HHHHHHHHHhccCCeEEeeccchhhHhhhcchHHHHHHHHHhh
Confidence               2233444568999999999988     4488888876543


No 141
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=61.47  E-value=5.9  Score=29.63  Aligned_cols=14  Identities=21%  Similarity=-0.050  Sum_probs=12.6

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|++++.||+|+.
T Consensus       116 ~~p~viv~NK~Dl~  129 (174)
T cd04153         116 KAVLLVLANKQDLK  129 (174)
T ss_pred             CCCEEEEEECCCCC
Confidence            37999999999986


No 142
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=61.46  E-value=56  Score=23.26  Aligned_cols=22  Identities=32%  Similarity=0.365  Sum_probs=16.3

Q ss_pred             eeceEEEEecCCCC---CHHHHHHH
Q psy7060         129 YLPCIYAYNKIDQI---SIEEVDRI  150 (160)
Q Consensus       129 Y~P~iyv~NKiD~i---s~eevd~i  150 (160)
                      -.|+++|.||+|+.   +.+++...
T Consensus       101 ~~piilv~nK~Dl~~~~~~~~i~~~  125 (160)
T cd04156         101 GVPVVLLANKQDLPGALTAEEITRR  125 (160)
T ss_pred             CCCEEEEEECcccccCcCHHHHHHH
Confidence            47999999999985   34555433


No 143
>PLN03118 Rab family protein; Provisional
Probab=60.92  E-value=69  Score=24.80  Aligned_cols=25  Identities=28%  Similarity=0.133  Sum_probs=17.3

Q ss_pred             ceeceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      .-.|.++|.||+|+..     .++...+++
T Consensus       119 ~~~~~ilv~NK~Dl~~~~~i~~~~~~~~~~  148 (211)
T PLN03118        119 QDCVKMLVGNKVDRESERDVSREEGMALAK  148 (211)
T ss_pred             CCCCEEEEEECccccccCccCHHHHHHHHH
Confidence            3468999999999863     355555544


No 144
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=60.53  E-value=15  Score=25.70  Aligned_cols=25  Identities=28%  Similarity=0.276  Sum_probs=18.7

Q ss_pred             ceeceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      ...|++++.||+|+..     .+++.++++
T Consensus       103 ~~~p~ivv~nK~D~~~~~~~~~~~~~~~~~  132 (160)
T cd00876         103 EDIPIVLVGNKCDLENERQVSKEEGKALAK  132 (160)
T ss_pred             CCCcEEEEEECCcccccceecHHHHHHHHH
Confidence            5789999999999874     355555543


No 145
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=60.38  E-value=13  Score=29.28  Aligned_cols=26  Identities=19%  Similarity=0.233  Sum_probs=20.5

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      --.|.|+|.||+|+.     +.++...+++.
T Consensus       109 ~~~piilVGNK~DL~~~~~v~~~~~~~~a~~  139 (189)
T cd04121         109 PGVPKILVGNRLHLAFKRQVATEQAQAYAER  139 (189)
T ss_pred             CCCCEEEEEECccchhccCCCHHHHHHHHHH
Confidence            357999999999974     56788877654


No 146
>PF13192 Thioredoxin_3:  Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B ....
Probab=60.32  E-value=18  Score=24.42  Aligned_cols=51  Identities=14%  Similarity=0.348  Sum_probs=35.5

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEE
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAY  136 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~  136 (160)
                      |.++||--....+.++.++.+++ .++++.  +   ..++-+.-.-+-...|++++=
T Consensus         6 ~~~~C~~C~~~~~~~~~~~~~~~-i~~ei~--~---~~~~~~~~~ygv~~vPalvIn   56 (76)
T PF13192_consen    6 FSPGCPYCPELVQLLKEAAEELG-IEVEII--D---IEDFEEIEKYGVMSVPALVIN   56 (76)
T ss_dssp             ECSSCTTHHHHHHHHHHHHHHTT-EEEEEE--E---TTTHHHHHHTT-SSSSEEEET
T ss_pred             eCCCCCCcHHHHHHHHHHHHhcC-CeEEEE--E---ccCHHHHHHcCCCCCCEEEEC
Confidence            56778887788889999999998 555443  2   255555544567788999663


No 147
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=60.12  E-value=12  Score=34.05  Aligned_cols=23  Identities=26%  Similarity=0.299  Sum_probs=16.4

Q ss_pred             eeceEEEEecCCCCCH-HHHHHHh
Q psy7060         129 YLPCIYAYNKIDQISI-EEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~-eevd~i~  151 (160)
                      -+|+|+|.||+|+... +.++.+.
T Consensus       274 ~kP~IVV~NK~DL~~~~e~l~~l~  297 (424)
T PRK12297        274 ERPQIVVANKMDLPEAEENLEEFK  297 (424)
T ss_pred             CCcEEEEEeCCCCcCCHHHHHHHH
Confidence            4799999999998533 4445553


No 148
>PF06207 DUF1002:  Protein of unknown function (DUF1002);  InterPro: IPR009343 This protein family has no known function. Its members are about 300 amino acids in length. It has so far been detected in Firmicute bacteria and some archaebacteria.
Probab=60.02  E-value=23  Score=30.11  Aligned_cols=53  Identities=19%  Similarity=0.287  Sum_probs=42.0

Q ss_pred             CCeEEEEecCc-ceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccceEE
Q psy7060          30 PNIYFKQKKAG-GIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEV  108 (160)
Q Consensus        30 p~I~ikkk~~G-GI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V  108 (160)
                      ..++|++.+.| ||++....|- +                                 +|.+++++.+.-|--=||-||+|
T Consensus        53 SSa~V~~~~~g~Gi~V~i~tp~-N---------------------------------It~VT~~mY~NAl~TAGv~da~I   98 (225)
T PF06207_consen   53 SSAYVTPTDKGSGIKVEIVTPN-N---------------------------------ITWVTEEMYANALITAGVTDADI   98 (225)
T ss_pred             EEEEEEECCCCCCeEEEEeccC-c---------------------------------ceeecHHHHHHHHHHcCCCcceE
Confidence            34789999999 9999872222 1                                 45599999999999999999999


Q ss_pred             EeecCCCh
Q psy7060         109 LFREDCNA  116 (160)
Q Consensus       109 ~ired~t~  116 (160)
                      .+.....+
T Consensus        99 ~Vasp~~V  106 (225)
T PF06207_consen   99 YVASPFPV  106 (225)
T ss_pred             EEeccccC
Confidence            99876554


No 149
>COG2229 Predicted GTPase [General function prediction only]
Probab=59.91  E-value=24  Score=29.79  Aligned_cols=51  Identities=25%  Similarity=0.332  Sum_probs=33.7

Q ss_pred             ccceEEEeecCCChh----HHHHHHhc-CcceeceEEEEecCCCC---CHHHHHHHhcCCC
Q psy7060         103 IFNAEVLFREDCNAD----ELIDVINA-NRVYLPCIYAYNKIDQI---SIEEVDRIARQPN  155 (160)
Q Consensus       103 I~NA~V~ired~t~D----dliDvi~~-nrvY~P~iyv~NKiD~i---s~eevd~i~~~p~  155 (160)
                      -.-|.|++..-.+.+    ++++.+.. |+  +|-+++.||-|+.   ++|.+..+...++
T Consensus        92 a~gaivlVDss~~~~~~a~~ii~f~~~~~~--ip~vVa~NK~DL~~a~ppe~i~e~l~~~~  150 (187)
T COG2229          92 AVGAIVLVDSSRPITFHAEEIIDFLTSRNP--IPVVVAINKQDLFDALPPEKIREALKLEL  150 (187)
T ss_pred             cceEEEEEecCCCcchHHHHHHHHHhhccC--CCEEEEeeccccCCCCCHHHHHHHHHhcc
Confidence            334566665544433    45555543 22  9999999999998   5588877766663


No 150
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=59.33  E-value=13  Score=29.73  Aligned_cols=25  Identities=20%  Similarity=0.143  Sum_probs=17.9

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      .-+|.|+|.||+|+.     +.++...+++
T Consensus       104 ~~~piilVgNK~DL~~~~~v~~~~~~~~a~  133 (202)
T cd04120         104 EDAELLLVGNKLDCETDREISRQQGEKFAQ  133 (202)
T ss_pred             CCCcEEEEEECcccccccccCHHHHHHHHH
Confidence            357999999999984     3455555553


No 151
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=59.28  E-value=5.8  Score=35.75  Aligned_cols=18  Identities=28%  Similarity=0.311  Sum_probs=14.7

Q ss_pred             eceEEEEecCCCCCHHHH
Q psy7060         130 LPCIYAYNKIDQISIEEV  147 (160)
Q Consensus       130 ~P~iyv~NKiD~is~eev  147 (160)
                      .|.++|+||+|+.+....
T Consensus       322 ~piiiV~NK~DL~~~~~~  339 (449)
T PRK05291        322 KPVIVVLNKADLTGEIDL  339 (449)
T ss_pred             CCcEEEEEhhhccccchh
Confidence            699999999999865443


No 152
>PRK15494 era GTPase Era; Provisional
Probab=59.11  E-value=35  Score=29.54  Aligned_cols=14  Identities=43%  Similarity=0.456  Sum_probs=12.1

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.|+|.||+|+.+
T Consensus       161 ~p~IlViNKiDl~~  174 (339)
T PRK15494        161 IVPIFLLNKIDIES  174 (339)
T ss_pred             CCEEEEEEhhcCcc
Confidence            58899999999874


No 153
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=59.06  E-value=5.8  Score=28.43  Aligned_cols=14  Identities=50%  Similarity=0.700  Sum_probs=12.6

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.++|+||+|+.+
T Consensus       103 ~p~ivv~NK~Dl~~  116 (168)
T cd01887         103 VPFIVALNKIDKPN  116 (168)
T ss_pred             CCEEEEEEceeccc
Confidence            69999999999874


No 154
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=58.93  E-value=15  Score=26.73  Aligned_cols=16  Identities=19%  Similarity=0.225  Sum_probs=13.2

Q ss_pred             cceeceEEEEecCCCC
Q psy7060         127 RVYLPCIYAYNKIDQI  142 (160)
Q Consensus       127 rvY~P~iyv~NKiD~i  142 (160)
                      .--+|++++.||+|+.
T Consensus       102 ~~~~piivv~nK~Dl~  117 (174)
T cd04135         102 APNVPYLLVGTQIDLR  117 (174)
T ss_pred             CCCCCEEEEeEchhhh
Confidence            3457999999999975


No 155
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=58.83  E-value=8.4  Score=32.43  Aligned_cols=49  Identities=12%  Similarity=0.230  Sum_probs=26.6

Q ss_pred             HHHHHHHHcCccceEEEeecC---CC--hhHHHHHHhcCcceeceEEEEecCCCCC
Q psy7060          93 LVQLILHEYKIFNAEVLFRED---CN--ADELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus        93 ~V~~IL~EYkI~NA~V~ired---~t--~DdliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      ......+.++.-.+-+++-.-   +.  ...++..+....  +|.|+++||+|+..
T Consensus        77 f~~~~~~~l~~aD~ailVVDa~~g~~~~t~~~~~~~~~~~--~p~ivviNK~D~~~  130 (270)
T cd01886          77 FTIEVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYN--VPRIAFVNKMDRTG  130 (270)
T ss_pred             HHHHHHHHHHHcCEEEEEEECCCCCCHHHHHHHHHHHHcC--CCEEEEEECCCCCC
Confidence            344444445444444444221   11  124455444333  69999999999974


No 156
>PRK00098 GTPase RsgA; Reviewed
Probab=58.45  E-value=12  Score=31.81  Aligned_cols=14  Identities=36%  Similarity=0.368  Sum_probs=12.6

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      =+|.++|+||+|+.
T Consensus       111 ~ip~iIVlNK~DL~  124 (298)
T PRK00098        111 GIKPIIVLNKIDLL  124 (298)
T ss_pred             CCCEEEEEEhHHcC
Confidence            37999999999997


No 157
>PRK13675 GTP cyclohydrolase; Provisional
Probab=57.71  E-value=14  Score=32.69  Aligned_cols=26  Identities=19%  Similarity=0.437  Sum_probs=19.3

Q ss_pred             cCccc----eEEEe--ec--CCChhHHHHHHhcC
Q psy7060         101 YKIFN----AEVLF--RE--DCNADELIDVINAN  126 (160)
Q Consensus       101 YkI~N----A~V~i--re--d~t~DdliDvi~~n  126 (160)
                      |+-||    |.|.+  +.  ++.++|||+.++.+
T Consensus       191 ~~~HnQRs~~~l~v~~~~~~~i~iedLI~~~E~~  224 (308)
T PRK13675        191 MATHNQRGRGTLTIEVPGDEDVSLEDIIDIIESS  224 (308)
T ss_pred             CCCccCceEEEEEEEeCCCCccCHHHHHHHHHHh
Confidence            56677    55666  44  58999999999875


No 158
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=57.40  E-value=42  Score=27.69  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=19.0

Q ss_pred             ceeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         128 VYLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       128 vY~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      .-+|.|+|.||+|+.     +.+++..++.
T Consensus       112 ~~~piIivgNK~Dl~~~~~v~~~ei~~~~~  141 (247)
T cd04143         112 VKIPMVICGNKADRDFPREVQRDEVEQLVG  141 (247)
T ss_pred             CCCcEEEEEECccchhccccCHHHHHHHHH
Confidence            458999999999985     4466666644


No 159
>TIGR02200 GlrX_actino Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Probab=57.31  E-value=24  Score=22.43  Aligned_cols=53  Identities=15%  Similarity=0.145  Sum_probs=34.1

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEe
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYN  137 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~N  137 (160)
                      .+.||...    .++..|++.++..-.+-+.++-...+....++.+...+|+++.-+
T Consensus         7 ~~~C~~C~----~~~~~L~~~~~~~~~idi~~~~~~~~~~~~~~~~~~~vP~i~~~~   59 (77)
T TIGR02200         7 TTWCGYCA----QLMRTLDKLGAAYEWVDIEEDEGAADRVVSVNNGNMTVPTVKFAD   59 (77)
T ss_pred             CCCChhHH----HHHHHHHHcCCceEEEeCcCCHhHHHHHHHHhCCCceeCEEEECC
Confidence            45676543    367788888876666666655444455555555678999986444


No 160
>COG3052 CitD Citrate lyase, gamma subunit [Energy production and conversion]
Probab=57.17  E-value=14  Score=28.56  Aligned_cols=61  Identities=15%  Similarity=0.158  Sum_probs=42.2

Q ss_pred             CCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccceEE
Q psy7060          29 KPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEV  108 (160)
Q Consensus        29 ~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V  108 (160)
                      --.|+|.+...|||.+.-.....+       .|               |=          -=+.+|...|.+|++.||.|
T Consensus        16 DvmIri~P~~~~gI~i~i~SsV~k-------QF---------------G~----------~I~~tV~~~La~l~V~~A~V   63 (98)
T COG3052          16 DVMIRIAPLDTQGIDLQINSSVEK-------QF---------------GD----------AIRQTVLEVLARLGVRGAQV   63 (98)
T ss_pred             ceEEEEccCCCCCeEEEeehHHHH-------HH---------------HH----------HHHHHHHHHHHHhCcccceE
Confidence            346888899999998865332221       11               10          22778999999999999999


Q ss_pred             EeecCCChhHHHH
Q psy7060         109 LFREDCNADELID  121 (160)
Q Consensus       109 ~ired~t~DdliD  121 (160)
                      .+...=-+|=++.
T Consensus        64 ~v~DKGALdcvl~   76 (98)
T COG3052          64 NVDDKGALDCILR   76 (98)
T ss_pred             EEeccchHHHHHH
Confidence            9987665655443


No 161
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=56.62  E-value=73  Score=23.91  Aligned_cols=21  Identities=19%  Similarity=0.050  Sum_probs=15.7

Q ss_pred             eceEEEEecCCCC---CHHHHHHH
Q psy7060         130 LPCIYAYNKIDQI---SIEEVDRI  150 (160)
Q Consensus       130 ~P~iyv~NKiD~i---s~eevd~i  150 (160)
                      +|.++|.||.|+.   +.+++...
T Consensus       115 ~piilv~NK~Dl~~~~~~~~i~~~  138 (175)
T smart00177      115 AVILVFANKQDLPDAMKAAEITEK  138 (175)
T ss_pred             CcEEEEEeCcCcccCCCHHHHHHH
Confidence            7999999999986   33555443


No 162
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=56.56  E-value=12  Score=26.97  Aligned_cols=22  Identities=32%  Similarity=0.299  Sum_probs=16.2

Q ss_pred             eceEEEEecCCCCC-----HHHHHHHh
Q psy7060         130 LPCIYAYNKIDQIS-----IEEVDRIA  151 (160)
Q Consensus       130 ~P~iyv~NKiD~is-----~eevd~i~  151 (160)
                      +|.++|.||+|+.+     .+++..++
T Consensus       106 ~~iivv~nK~D~~~~~~~~~~~~~~~~  132 (161)
T cd04113         106 IVVILVGNKSDLADQREVTFLEASRFA  132 (161)
T ss_pred             CeEEEEEEchhcchhccCCHHHHHHHH
Confidence            69999999999863     34555554


No 163
>PF06857 ACP:  Malonate decarboxylase delta subunit (MdcD);  InterPro: IPR023439 This family consists of the acyl carrier protein found in malonate decarboxylase and citrate lyase. This subunit has the same covalently bound prosthetic group, derived from and similar to coenzyme A, as does citrate lyase, although this protein and the acyl carrier protein of citrate lyase do not show significant sequence similarity. Both malonyl and acetyl groups are transferred to the prosthetic group for catalysis.
Probab=56.22  E-value=33  Score=25.33  Aligned_cols=30  Identities=20%  Similarity=0.203  Sum_probs=24.0

Q ss_pred             CHHHHHHHHHHcCccceEEEeecCCChhHH
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFREDCNADEL  119 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ired~t~Ddl  119 (160)
                      =++.|...|.+|++-||.|.+..-=-+|=.
T Consensus        44 i~~vi~~~l~~~~i~~~~v~i~D~GAld~v   73 (87)
T PF06857_consen   44 IRAVIRETLEELGIEDAKVEINDKGALDCV   73 (87)
T ss_pred             HHHHHHHHHHhcCCCceEEEEEeCCCCHHH
Confidence            367899999999999999999875444433


No 164
>KOG1752|consensus
Probab=56.17  E-value=24  Score=26.62  Aligned_cols=64  Identities=16%  Similarity=0.284  Sum_probs=48.1

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh--cCcceeceEEEEecCCCCCHHHHHHH
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN--ANRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~--~nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      |.||.-+.    ++.+|+++++.=+.|.+.++-.-.|+.+++.  .-+.=.|.+++-.|-= =+.+++.++
T Consensus        22 s~C~~c~~----~k~ll~~~~v~~~vvELD~~~~g~eiq~~l~~~tg~~tvP~vFI~Gk~i-GG~~dl~~l   87 (104)
T KOG1752|consen   22 SSCPYCHR----AKELLSDLGVNPKVVELDEDEDGSEIQKALKKLTGQRTVPNVFIGGKFI-GGASDLMAL   87 (104)
T ss_pred             CcCchHHH----HHHHHHhCCCCCEEEEccCCCCcHHHHHHHHHhcCCCCCCEEEECCEEE-cCHHHHHHH
Confidence            67887664    8999999999999999999988889999988  3444679998866641 134444444


No 165
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=56.15  E-value=10  Score=29.37  Aligned_cols=25  Identities=20%  Similarity=0.381  Sum_probs=19.5

Q ss_pred             eceEEEEecCCC---------------CCHHHHHHHhcCC
Q psy7060         130 LPCIYAYNKIDQ---------------ISIEEVDRIARQP  154 (160)
Q Consensus       130 ~P~iyv~NKiD~---------------is~eevd~i~~~p  154 (160)
                      .|.|+|.||.|+               ++.++...+++..
T Consensus       106 ~piilvgnK~Dl~~~~~~~~~~~~~~~v~~~~~~~~a~~~  145 (176)
T cd04133         106 VPIVLVGTKLDLRDDKQYLADHPGASPITTAQGEELRKQI  145 (176)
T ss_pred             CCEEEEEeChhhccChhhhhhccCCCCCCHHHHHHHHHHc
Confidence            799999999998               4566777776543


No 166
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=55.86  E-value=13  Score=30.42  Aligned_cols=24  Identities=29%  Similarity=0.427  Sum_probs=17.2

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCC
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      .+++.+..  .=+|.++++||+|+..
T Consensus       107 ~~~~~~~~--~~~P~iivvNK~D~~~  130 (237)
T cd04168         107 ILWRLLRK--LNIPTIIFVNKIDRAG  130 (237)
T ss_pred             HHHHHHHH--cCCCEEEEEECccccC
Confidence            45555543  2369999999999874


No 167
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=55.47  E-value=11  Score=29.90  Aligned_cols=13  Identities=38%  Similarity=0.478  Sum_probs=11.7

Q ss_pred             eceEEEEecCCCC
Q psy7060         130 LPCIYAYNKIDQI  142 (160)
Q Consensus       130 ~P~iyv~NKiD~i  142 (160)
                      .|.|+|+||+|+.
T Consensus       138 ~~iiivvNK~Dl~  150 (219)
T cd01883         138 KQLIVAVNKMDDV  150 (219)
T ss_pred             CeEEEEEEccccc
Confidence            5788899999998


No 168
>PRK13768 GTPase; Provisional
Probab=55.26  E-value=7.8  Score=32.10  Aligned_cols=23  Identities=48%  Similarity=0.580  Sum_probs=18.5

Q ss_pred             ceeceEEEEecCCCCCHHHHHHH
Q psy7060         128 VYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~eevd~i  150 (160)
                      .-+|.|.|+||+|..+.++.+.+
T Consensus       161 ~~~~~i~v~nK~D~~~~~~~~~~  183 (253)
T PRK13768        161 LGLPQIPVLNKADLLSEEELERI  183 (253)
T ss_pred             cCCCEEEEEEhHhhcCchhHHHH
Confidence            45799999999999987665544


No 169
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=54.97  E-value=14  Score=26.03  Aligned_cols=23  Identities=26%  Similarity=0.301  Sum_probs=16.6

Q ss_pred             eceEEEEecCCCCC-----HHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQIS-----IEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~is-----~eevd~i~~  152 (160)
                      +|.++|.||+|+..     .++++.+++
T Consensus       106 ~piiiv~nK~D~~~~~~~~~~~~~~~~~  133 (162)
T cd04123         106 ISLVIVGNKIDLERQRVVSKSEAEEYAK  133 (162)
T ss_pred             CeEEEEEECcccccccCCCHHHHHHHHH
Confidence            69999999999873     345555543


No 170
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=54.86  E-value=17  Score=28.70  Aligned_cols=14  Identities=29%  Similarity=0.301  Sum_probs=12.3

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -.|.|+|.||+|+.
T Consensus       120 ~~piilvgNK~DL~  133 (195)
T cd01873         120 RVPVILVGCKLDLR  133 (195)
T ss_pred             CCCEEEEEEchhcc
Confidence            57999999999974


No 171
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=54.58  E-value=57  Score=24.03  Aligned_cols=13  Identities=23%  Similarity=-0.041  Sum_probs=12.0

Q ss_pred             eceEEEEecCCCC
Q psy7060         130 LPCIYAYNKIDQI  142 (160)
Q Consensus       130 ~P~iyv~NKiD~i  142 (160)
                      .|.+++.||+|+.
T Consensus       102 ~piilv~NK~Dl~  114 (159)
T cd04150         102 AVLLVFANKQDLP  114 (159)
T ss_pred             CCEEEEEECCCCC
Confidence            6999999999986


No 172
>PLN03110 Rab GTPase; Provisional
Probab=54.53  E-value=47  Score=26.21  Aligned_cols=24  Identities=25%  Similarity=0.209  Sum_probs=17.7

Q ss_pred             eceEEEEecCCCC-----CHHHHHHHhcC
Q psy7060         130 LPCIYAYNKIDQI-----SIEEVDRIARQ  153 (160)
Q Consensus       130 ~P~iyv~NKiD~i-----s~eevd~i~~~  153 (160)
                      +|.++|.||+|+.     +.++...++..
T Consensus       118 ~piiiv~nK~Dl~~~~~~~~~~~~~l~~~  146 (216)
T PLN03110        118 IVIMMAGNKSDLNHLRSVAEEDGQALAEK  146 (216)
T ss_pred             CeEEEEEEChhcccccCCCHHHHHHHHHH
Confidence            6999999999984     34566666543


No 173
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=54.35  E-value=19  Score=27.30  Aligned_cols=14  Identities=29%  Similarity=0.166  Sum_probs=12.5

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      ..|.|+|.||+|+.
T Consensus       105 ~~piilvgnK~Dl~  118 (187)
T cd04129         105 NVPVILVGLKKDLR  118 (187)
T ss_pred             CCCEEEEeeChhhh
Confidence            48999999999984


No 174
>TIGR02183 GRXA Glutaredoxin, GrxA family. This model includes the E. coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase.
Probab=53.65  E-value=45  Score=23.02  Aligned_cols=68  Identities=12%  Similarity=0.222  Sum_probs=38.3

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEE-----eecCC-ChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHhcCC
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVL-----FREDC-NADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIARQP  154 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~-----ired~-t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~~~p  154 (160)
                      ++||.-    ..+++.|.+.++-+..+.     +.++- ...++.+.....+..+|.|++=.+. .-.-+++..+.+..
T Consensus         8 ~~Cp~C----~~ak~~L~~~~~~~~~i~~~~idi~~~~~~~~~l~~~~g~~~~tVP~ifi~g~~-igG~~dl~~~~~~~   81 (86)
T TIGR02183         8 PGCPYC----VRAKQLAEKLAIERADFEFRYIDIHAEGISKADLEKTVGKPVETVPQIFVDEKH-VGGCTDFEQLVKEN   81 (86)
T ss_pred             CCCccH----HHHHHHHHHhCcccCCCcEEEEECCCCHHHHHHHHHHhCCCCCCcCeEEECCEE-ecCHHHHHHHHHhc
Confidence            567764    457788888765443332     33222 2334555443234689999875544 33667777665543


No 175
>PF01189 Nol1_Nop2_Fmu:  NOL1/NOP2/sun family;  InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins.  In the archaea and bacteria, they are annotated as putative nucleolar protein, Sun (Fmu) family protein or tRNA/rRNA cytosine-C5-methylase. The majority have the S-adenosyl methionine (SAM) binding domain and are related to Escherichia coli Fmu (Sun) protein (16S rRNA m5C 967 methyltransferase) whose structure has been determined [].  In the eukaryota, the majority are annotated as being 'hypothetical protein', nucleolar protein or the Nop2/Sun (Fmu) family. Unlike their bacterial homologues, few of the eukaryotic members in this family have a the SAM binding signature. Despite this, Saccharomyces cerevisiae (Baker's yeast) Nop2p is a probable RNA m5C methyltransferase []. It is essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis []; localized to the nucleolus and is essential for viability []. Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing []. There is substantial identity between Nop2p and Homo sapiens (Human) p120 (NOL1), which is also called the proliferation-associated nucleolar antigen [, ].; PDB: 3M4X_A 2FRX_B 2YXL_A 1IXK_A 1SQG_A 1SQF_A 3M6U_B 3M6V_B 3M6W_A 3M6X_A ....
Probab=53.64  E-value=7.6  Score=32.98  Aligned_cols=45  Identities=33%  Similarity=0.520  Sum_probs=29.5

Q ss_pred             HHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCc-hhhHHHHHHHHHHh
Q psy7060           9 VQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLT-QVNEKLVQLILHEY   65 (160)
Q Consensus         9 ~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt-~~~~~~v~~~l~~y   65 (160)
                      .|+.+|+.-++-+|+-            .+.||.-+-+||.+. .-||+.|+.||.++
T Consensus       193 ~Q~~iL~~a~~~~~~~------------~k~gG~lvYsTCS~~~eENE~vV~~fl~~~  238 (283)
T PF01189_consen  193 LQREILDNAAKLLNID------------FKPGGRLVYSTCSLSPEENEEVVEKFLKRH  238 (283)
T ss_dssp             HHHHHHHHHHHCEHHH------------BEEEEEEEEEESHHHGGGTHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHhhccc------------ccCCCeEEEEeccHHHHHHHHHHHHHHHhC
Confidence            4777777777776665            456788888888765 23455555555544


No 176
>PRK01889 GTPase RsgA; Reviewed
Probab=53.63  E-value=20  Score=31.44  Aligned_cols=26  Identities=8%  Similarity=0.027  Sum_probs=17.2

Q ss_pred             hHHHHHHhcCcceeceEEEEecCCCCCH
Q psy7060         117 DELIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       117 DdliDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      |.+.-.+....  +|.++|+||+|+.+.
T Consensus       132 dr~L~~a~~~~--i~piIVLNK~DL~~~  157 (356)
T PRK01889        132 ERYLALAWESG--AEPVIVLTKADLCED  157 (356)
T ss_pred             HHHHHHHHHcC--CCEEEEEEChhcCCC
Confidence            34444444444  377999999999864


No 177
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=52.80  E-value=13  Score=25.56  Aligned_cols=13  Identities=38%  Similarity=0.417  Sum_probs=10.5

Q ss_pred             ceeceEEEEecCC
Q psy7060         128 VYLPCIYAYNKID  140 (160)
Q Consensus       128 vY~P~iyv~NKiD  140 (160)
                      ..+|+|+|.||.|
T Consensus       107 ~~~piilv~nK~D  119 (119)
T PF08477_consen  107 KNIPIILVGNKSD  119 (119)
T ss_dssp             SCSEEEEEEE-TC
T ss_pred             CCCCEEEEEeccC
Confidence            3499999999998


No 178
>KOG1489|consensus
Probab=52.30  E-value=13  Score=34.24  Aligned_cols=36  Identities=28%  Similarity=0.358  Sum_probs=21.9

Q ss_pred             cCcceeceEEEEecCCCCCHH-H-HHHHh---cCCCceeeC
Q psy7060         125 ANRVYLPCIYAYNKIDQISIE-E-VDRIA---RQPNSVVVR  160 (160)
Q Consensus       125 ~nrvY~P~iyv~NKiD~is~e-e-vd~i~---~~p~~v~is  160 (160)
                      .+-.=.|.++|.||||+...| + +..++   ..|+-+++|
T Consensus       308 k~L~~rp~liVaNKiD~~eae~~~l~~L~~~lq~~~V~pvs  348 (366)
T KOG1489|consen  308 KGLADRPALIVANKIDLPEAEKNLLSSLAKRLQNPHVVPVS  348 (366)
T ss_pred             hhhccCceEEEEeccCchhHHHHHHHHHHHHcCCCcEEEee
Confidence            344557999999999985322 2 14442   234456665


No 179
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=51.71  E-value=14  Score=30.34  Aligned_cols=13  Identities=31%  Similarity=0.529  Sum_probs=11.9

Q ss_pred             eceEEEEecCCCC
Q psy7060         130 LPCIYAYNKIDQI  142 (160)
Q Consensus       130 ~P~iyv~NKiD~i  142 (160)
                      +|.|+|+||+|+.
T Consensus       126 ~p~ilviNKiD~~  138 (222)
T cd01885         126 VKPVLVINKIDRL  138 (222)
T ss_pred             CCEEEEEECCCcc
Confidence            6999999999975


No 180
>PRK12296 obgE GTPase CgtA; Reviewed
Probab=51.21  E-value=12  Score=35.21  Aligned_cols=19  Identities=32%  Similarity=0.312  Sum_probs=15.4

Q ss_pred             ceeceEEEEecCCCCCHHH
Q psy7060         128 VYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       128 vY~P~iyv~NKiD~is~ee  146 (160)
                      ..+|+|+|.||+|+...++
T Consensus       283 ~~kP~IVVlNKiDL~da~e  301 (500)
T PRK12296        283 AERPRLVVLNKIDVPDARE  301 (500)
T ss_pred             cCCCEEEEEECccchhhHH
Confidence            4579999999999976543


No 181
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha. This model represents the counterpart of bacterial EF-Tu for the Archaea (aEF-1 alpha) and Eukaryotes (eEF-1 alpha). The trusted cutoff is set fairly high so that incomplete sequences will score between suggested and trusted cutoff levels.
Probab=51.06  E-value=64  Score=28.48  Aligned_cols=14  Identities=36%  Similarity=0.437  Sum_probs=11.8

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.|+|+||+|+.+
T Consensus       142 ~~iIVviNK~Dl~~  155 (426)
T TIGR00483       142 NQLIVAINKMDSVN  155 (426)
T ss_pred             CeEEEEEEChhccC
Confidence            37888999999973


No 182
>TIGR02189 GlrX-like_plant Glutaredoxin-like family. This family of glutaredoxin-like proteins is aparrently limited to plants. Multiple isoforms are found in A. thaliana and O.sativa.
Probab=50.99  E-value=47  Score=23.91  Aligned_cols=64  Identities=14%  Similarity=0.251  Sum_probs=44.1

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhc--CcceeceEEEEecCCCCCHHHHHHH
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINA--NRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~--nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      ++||.-.    .++++|.+++|.-.++-+.++-...++.+.+..  ++.=+|.|++=.+. .-.-+++..+
T Consensus        16 ~~Cp~C~----~ak~~L~~~~i~~~~vdid~~~~~~~~~~~l~~~tg~~tvP~Vfi~g~~-iGG~ddl~~l   81 (99)
T TIGR02189        16 SSCCMCH----VVKRLLLTLGVNPAVHEIDKEPAGKDIENALSRLGCSPAVPAVFVGGKL-VGGLENVMAL   81 (99)
T ss_pred             CCCHHHH----HHHHHHHHcCCCCEEEEcCCCccHHHHHHHHHHhcCCCCcCeEEECCEE-EcCHHHHHHH
Confidence            5677643    688899999998888888888777888777762  45566999765432 1133444444


No 183
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=50.54  E-value=63  Score=24.24  Aligned_cols=14  Identities=21%  Similarity=0.007  Sum_probs=11.8

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.|+|.||+|+.+
T Consensus       107 ~~iilVgnK~Dl~~  120 (170)
T cd04108         107 VLLFLVGTKKDLSS  120 (170)
T ss_pred             CeEEEEEEChhcCc
Confidence            46899999999864


No 184
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=50.27  E-value=20  Score=34.15  Aligned_cols=18  Identities=17%  Similarity=0.113  Sum_probs=15.0

Q ss_pred             eeceEEEEecCCCCCHHH
Q psy7060         129 YLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~ee  146 (160)
                      -+|+|+|+||+|+.+.+.
T Consensus       561 ~~piIiV~NK~DL~~~~~  578 (712)
T PRK09518        561 GRALVLVFNKWDLMDEFR  578 (712)
T ss_pred             CCCEEEEEEchhcCChhH
Confidence            479999999999987543


No 185
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=50.26  E-value=44  Score=26.35  Aligned_cols=15  Identities=33%  Similarity=0.512  Sum_probs=13.3

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|.++|.||.|+..
T Consensus       109 ~~pvliv~NK~Dl~~  123 (203)
T cd04105         109 KIPVLIACNKQDLFT  123 (203)
T ss_pred             CCCEEEEecchhhcc
Confidence            589999999999874


No 186
>PRK00093 GTP-binding protein Der; Reviewed
Probab=50.20  E-value=18  Score=31.38  Aligned_cols=40  Identities=13%  Similarity=0.189  Sum_probs=23.1

Q ss_pred             HHHHHhcCcceeceEEEEecCCCCCH-HHHHHHhcC--CCceeeC
Q psy7060         119 LIDVINANRVYLPCIYAYNKIDQISI-EEVDRIARQ--PNSVVVR  160 (160)
Q Consensus       119 liDvi~~nrvY~P~iyv~NKiD~is~-eevd~i~~~--p~~v~is  160 (160)
                      +.+.+...  =+|.|+|.||+|..+. ++.....++  ++.+++|
T Consensus       101 ~~~~l~~~--~~piilv~NK~D~~~~~~~~~~~~~lg~~~~~~iS  143 (435)
T PRK00093        101 IAKILRKS--NKPVILVVNKVDGPDEEADAYEFYSLGLGEPYPIS  143 (435)
T ss_pred             HHHHHHHc--CCcEEEEEECccCccchhhHHHHHhcCCCCCEEEE
Confidence            44444432  4799999999997652 333333333  2445554


No 187
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=50.03  E-value=15  Score=29.30  Aligned_cols=52  Identities=10%  Similarity=0.127  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHcCccce-EEEeecC--CChh--HHHHHHhcCcceece-EEEEecCCCCCH
Q psy7060          91 EKLVQLILHEYKIFNA-EVLFRED--CNAD--ELIDVINANRVYLPC-IYAYNKIDQISI  144 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA-~V~ired--~t~D--dliDvi~~nrvY~P~-iyv~NKiD~is~  144 (160)
                      .+.+....+....-.+ -+.+...  .+..  +++..+....  +|+ |+++||+|+.+.
T Consensus        76 ~~~~~~~~~~~~~~D~~ilVvda~~g~~~~~~~~~~~~~~~~--~~~iIvviNK~D~~~~  133 (195)
T cd01884          76 ADYIKNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVG--VPYIVVFLNKADMVDD  133 (195)
T ss_pred             HHHHHHHHHHhhhCCEEEEEEECCCCCcHHHHHHHHHHHHcC--CCcEEEEEeCCCCCCc
Confidence            3455556555544443 3333322  2222  3444444333  585 588999999753


No 188
>COG0536 Obg Predicted GTPase [General function prediction only]
Probab=49.90  E-value=15  Score=33.96  Aligned_cols=21  Identities=38%  Similarity=0.485  Sum_probs=17.1

Q ss_pred             eceEEEEecCCCC-CHHHHHHH
Q psy7060         130 LPCIYAYNKIDQI-SIEEVDRI  150 (160)
Q Consensus       130 ~P~iyv~NKiD~i-s~eevd~i  150 (160)
                      +|.|+|.||+|+. +.|+++.+
T Consensus       276 K~~ivv~NKiD~~~~~e~~~~~  297 (369)
T COG0536         276 KPRIVVLNKIDLPLDEEELEEL  297 (369)
T ss_pred             CceEEEEeccCCCcCHHHHHHH
Confidence            6899999999955 77777665


No 189
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=49.60  E-value=19  Score=26.48  Aligned_cols=24  Identities=25%  Similarity=0.214  Sum_probs=17.6

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHhc
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIAR  152 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~~  152 (160)
                      -+|++++.||.|+.     +.++...+++
T Consensus       105 ~~~iilvgnK~Dl~~~~~v~~~~~~~~~~  133 (161)
T cd04117         105 GVQKILIGNKADEEQKRQVGDEQGNKLAK  133 (161)
T ss_pred             CCeEEEEEECcccccccCCCHHHHHHHHH
Confidence            47999999999985     3455555554


No 190
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=49.55  E-value=10  Score=27.31  Aligned_cols=14  Identities=36%  Similarity=0.401  Sum_probs=12.4

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      =+|+++|.||+|+.
T Consensus       106 ~~piviv~nK~Dl~  119 (163)
T cd04176         106 KVPIILVGNKVDLE  119 (163)
T ss_pred             CCCEEEEEECccch
Confidence            37999999999985


No 191
>PRK03003 GTP-binding protein Der; Reviewed
Probab=49.25  E-value=15  Score=33.11  Aligned_cols=16  Identities=25%  Similarity=0.260  Sum_probs=13.8

Q ss_pred             eeceEEEEecCCCCCH
Q psy7060         129 YLPCIYAYNKIDQISI  144 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~  144 (160)
                      -+|+|+|.||+|+.+.
T Consensus       322 ~~piIiV~NK~Dl~~~  337 (472)
T PRK03003        322 GRALVLAFNKWDLVDE  337 (472)
T ss_pred             CCCEEEEEECcccCCh
Confidence            4699999999999853


No 192
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=49.04  E-value=27  Score=26.63  Aligned_cols=33  Identities=30%  Similarity=0.328  Sum_probs=21.6

Q ss_pred             HHHHHHhcC-cceeceEEEEecCCCC---CHHHHHHH
Q psy7060         118 ELIDVINAN-RVYLPCIYAYNKIDQI---SIEEVDRI  150 (160)
Q Consensus       118 dliDvi~~n-rvY~P~iyv~NKiD~i---s~eevd~i  150 (160)
                      +|-+.++.. -.-+|.+++.||.|+.   +.+++...
T Consensus       103 ~L~~ll~~~~~~~~piLIl~NK~D~~~~~~~~~i~~~  139 (175)
T PF00025_consen  103 ELKELLNDPELKDIPILILANKQDLPDAMSEEEIKEY  139 (175)
T ss_dssp             HHHHHHTSGGGTTSEEEEEEESTTSTTSSTHHHHHHH
T ss_pred             chhhhcchhhcccceEEEEeccccccCcchhhHHHhh
Confidence            344444432 2358999999999986   45666654


No 193
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=48.68  E-value=72  Score=30.21  Aligned_cols=14  Identities=50%  Similarity=0.392  Sum_probs=12.4

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.|.|+||+|+.+
T Consensus       123 ipiIiViNKiDl~~  136 (595)
T TIGR01393       123 LEIIPVINKIDLPS  136 (595)
T ss_pred             CCEEEEEECcCCCc
Confidence            69999999999863


No 194
>TIGR02181 GRX_bact Glutaredoxin, GrxC family. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides.
Probab=48.43  E-value=44  Score=22.00  Aligned_cols=64  Identities=16%  Similarity=0.215  Sum_probs=40.9

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCC-ChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDC-NADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~-t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      .++||.    =..++.+|+++++.-..+-+..+- ..+++.+. . ++...|.|++=.+. ..+-+++..+.
T Consensus         6 ~~~Cp~----C~~a~~~L~~~~i~~~~~di~~~~~~~~~~~~~-~-g~~~vP~i~i~g~~-igg~~~~~~~~   70 (79)
T TIGR02181         6 KPYCPY----CTRAKALLSSKGVTFTEIRVDGDPALRDEMMQR-S-GRRTVPQIFIGDVH-VGGCDDLYALD   70 (79)
T ss_pred             cCCChh----HHHHHHHHHHcCCCcEEEEecCCHHHHHHHHHH-h-CCCCcCEEEECCEE-EcChHHHHHHH
Confidence            355664    356899999999988888776653 23444432 3 37788999775543 22556665553


No 195
>cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of ICAD/DFF45, and the CAD/DFF40 and CIDE nucleases during apoptosis. The CIDE-N domain is also found in the FSP27/CIDE-C protein.
Probab=47.81  E-value=16  Score=26.88  Aligned_cols=59  Identities=20%  Similarity=0.421  Sum_probs=45.5

Q ss_pred             HhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCc--cceEEEeecC---CChhHHHHHHhcCcce
Q psy7060          64 EYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKI--FNAEVLFRED---CNADELIDVINANRVY  129 (160)
Q Consensus        64 ~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI--~NA~V~ired---~t~DdliDvi~~nrvY  129 (160)
                      -|||.|.+....=||+-+|-       +++......-+.+  ....+.+.+|   +.-+|.-..+..|-++
T Consensus         4 p~kV~~~~r~~k~GV~A~sL-------~eL~~K~~~~l~l~~~~~~lvL~eDGTeVddEeYF~tLp~nT~l   67 (78)
T cd01615           4 PFKVCDSDRSRKKGVAASSL-------EELLSKACEKLKLPSAPVTLVLEEDGTEVDDEEYFQTLPDNTVL   67 (78)
T ss_pred             CEEEecCCCCeeEEEEcCCH-------HHHHHHHHHHcCCCCCCeEEEEeCCCcEEccHHHHhcCCCCcEE
Confidence            37888999888889998874       7788899999999  4556677777   4457777777777655


No 196
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional
Probab=47.77  E-value=17  Score=33.54  Aligned_cols=56  Identities=18%  Similarity=0.270  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHcCccc-eEEEeecCC---C--hhHHHHHHhcCcceeceEEEEecCCCCCHHHH
Q psy7060          91 EKLVQLILHEYKIFN-AEVLFREDC---N--ADELIDVINANRVYLPCIYAYNKIDQISIEEV  147 (160)
Q Consensus        91 e~~V~~IL~EYkI~N-A~V~ired~---t--~DdliDvi~~nrvY~P~iyv~NKiD~is~eev  147 (160)
                      ++.++..+..-..-. |-+.+..+-   .  ..+-+..+..-.+ .|.|+|+||+|+.+.+++
T Consensus       128 ~~fi~~m~~g~~~~D~alLVVda~~g~~~~qT~ehl~i~~~lgi-~~iIVvlNKiDlv~~~~~  189 (460)
T PTZ00327        128 DILMATMLNGAAVMDAALLLIAANESCPQPQTSEHLAAVEIMKL-KHIIILQNKIDLVKEAQA  189 (460)
T ss_pred             HHHHHHHHHHHhhCCEEEEEEECCCCccchhhHHHHHHHHHcCC-CcEEEEEecccccCHHHH
Confidence            566677666554333 444444331   1  1233333332222 367899999999875543


No 197
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=47.71  E-value=20  Score=28.09  Aligned_cols=13  Identities=31%  Similarity=0.473  Sum_probs=10.2

Q ss_pred             ceEEEEecCCCCC
Q psy7060         131 PCIYAYNKIDQIS  143 (160)
Q Consensus       131 P~iyv~NKiD~is  143 (160)
                      |.|+|+||+|+..
T Consensus       132 ~iIvviNK~D~~~  144 (208)
T cd04166         132 HVVVAVNKMDLVD  144 (208)
T ss_pred             cEEEEEEchhccc
Confidence            3566899999974


No 198
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=47.25  E-value=32  Score=28.08  Aligned_cols=15  Identities=20%  Similarity=-0.013  Sum_probs=12.9

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|.|+|.||+|+..
T Consensus       100 ~~piIlVgNK~DL~~  114 (220)
T cd04126         100 DCLFAVVGNKLDLTE  114 (220)
T ss_pred             CCcEEEEEECccccc
Confidence            479999999999864


No 199
>TIGR00475 selB selenocysteine-specific elongation factor SelB. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes.
Probab=46.61  E-value=71  Score=30.07  Aligned_cols=18  Identities=33%  Similarity=0.610  Sum_probs=14.8

Q ss_pred             ec-eEEEEecCCCCCHHHH
Q psy7060         130 LP-CIYAYNKIDQISIEEV  147 (160)
Q Consensus       130 ~P-~iyv~NKiD~is~eev  147 (160)
                      +| .|+|+||+|+.+.+.+
T Consensus       103 i~~iIVVlNK~Dlv~~~~~  121 (581)
T TIGR00475       103 IPHTIVVITKADRVNEEEI  121 (581)
T ss_pred             CCeEEEEEECCCCCCHHHH
Confidence            57 9999999999876543


No 200
>cd02966 TlpA_like_family TlpA-like family; composed of  TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.
Probab=46.57  E-value=61  Score=20.90  Aligned_cols=43  Identities=23%  Similarity=0.400  Sum_probs=19.8

Q ss_pred             CHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEec
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNK  138 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NK  138 (160)
                      +.+.++..+.+++ .+-.+....+   .++.+....+  ..|+++++++
T Consensus        64 ~~~~~~~~~~~~~-~~~~~~~~~~---~~~~~~~~~~--~~P~~~l~d~  106 (116)
T cd02966          64 DPAAVKAFLKKYG-ITFPVLLDPD---GELAKAYGVR--GLPTTFLIDR  106 (116)
T ss_pred             CHHHHHHHHHHcC-CCcceEEcCc---chHHHhcCcC--ccceEEEECC
Confidence            4556666666665 2333332221   2223322222  5577777654


No 201
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=46.38  E-value=21  Score=26.99  Aligned_cols=15  Identities=20%  Similarity=0.213  Sum_probs=12.9

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -.|.|+|.||+|+.+
T Consensus       105 ~~piilvgnK~Dl~~  119 (175)
T cd01874         105 KTPFLLVGTQIDLRD  119 (175)
T ss_pred             CCCEEEEEECHhhhh
Confidence            479999999999854


No 202
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=46.26  E-value=13  Score=28.51  Aligned_cols=15  Identities=27%  Similarity=0.569  Sum_probs=13.5

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      .+|+|+|.||+|+..
T Consensus       104 ~~piilv~NK~Dl~~  118 (198)
T cd04147         104 FVPIVVVGNKADSLE  118 (198)
T ss_pred             CCcEEEEEEcccccc
Confidence            589999999999875


No 203
>PF06858 NOG1:  Nucleolar GTP-binding protein 1 (NOG1);  InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1). The NOG1 family includes eukaryotic, bacterial and archaeal proteins. In Saccharomyces cerevisiae, the NOG1 gene has been shown to be essential for cell viability, suggesting that NOG1 may play an important role in nucleolar functions. In particular, NOG1 is believed to be functionally linked to ribosome biogenesis, which occurs in the nucleolus. In eukaryotes, NOG1 mutants were found to disrupt the biogenesis of the 60S ribosomal subunit []. The DRG and OBG proteins as well as the prokaryotic NOG-like proteins are homologous throughout their length to the amino half of eukaryotic NOG1, which contains the GTP binding motifs (IPR006073 from INTERPRO); the N-terminal GTP-binding motif is required for function.; GO: 0005525 GTP binding; PDB: 2E87_A.
Probab=46.21  E-value=12  Score=26.18  Aligned_cols=12  Identities=50%  Similarity=0.634  Sum_probs=7.8

Q ss_pred             eeceEEEEecCC
Q psy7060         129 YLPCIYAYNKID  140 (160)
Q Consensus       129 Y~P~iyv~NKiD  140 (160)
                      =.|-+.|+||+|
T Consensus        47 ~~P~i~V~nK~D   58 (58)
T PF06858_consen   47 NKPVIVVLNKID   58 (58)
T ss_dssp             TS-EEEEE--TT
T ss_pred             CCCEEEEEeccC
Confidence            469999999998


No 204
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=46.01  E-value=13  Score=28.29  Aligned_cols=14  Identities=43%  Similarity=0.316  Sum_probs=12.5

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|.++|.||+|+.
T Consensus       117 ~~p~iiv~NK~Dl~  130 (194)
T cd01891         117 GLKPIVVINKIDRP  130 (194)
T ss_pred             CCCEEEEEECCCCC
Confidence            46999999999986


No 205
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma. eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.
Probab=45.22  E-value=89  Score=27.65  Aligned_cols=55  Identities=20%  Similarity=0.347  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHcCccce-EEEeecC--C---ChhHHHHHHhcCcceeceEEEEecCCCCCHHH
Q psy7060          91 EKLVQLILHEYKIFNA-EVLFRED--C---NADELIDVINANRVYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA-~V~ired--~---t~DdliDvi~~nrvY~P~iyv~NKiD~is~ee  146 (160)
                      ++.++..+.....-.+ -+.+..+  +   ...+.+..+....+ .|.++|+||+|+.+.++
T Consensus        91 ~~f~~~~~~g~~~aD~aIlVVDa~~g~~~~qt~e~l~~l~~~gi-~~iIVvvNK~Dl~~~~~  151 (406)
T TIGR03680        91 ETLMATMLSGAALMDGALLVIAANEPCPQPQTKEHLMALEIIGI-KNIVIVQNKIDLVSKEK  151 (406)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCccccchHHHHHHHHHcCC-CeEEEEEEccccCCHHH
Confidence            5666666666543333 3333332  1   11222333322222 46899999999987543


No 206
>COG0523 Putative GTPases (G3E family) [General function prediction only]
Probab=45.12  E-value=19  Score=31.78  Aligned_cols=18  Identities=28%  Similarity=0.532  Sum_probs=14.7

Q ss_pred             EEEEecCCCCCHHHHHHH
Q psy7060         133 IYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       133 iyv~NKiD~is~eevd~i  150 (160)
                      ++++||+|+++.++++.+
T Consensus       149 ~ivlNK~Dlv~~~~l~~l  166 (323)
T COG0523         149 VIVLNKTDLVDAEELEAL  166 (323)
T ss_pred             EEEEecccCCCHHHHHHH
Confidence            578999999998876554


No 207
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=44.94  E-value=26  Score=25.64  Aligned_cols=14  Identities=29%  Similarity=0.309  Sum_probs=12.3

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|.+++.||+|+.
T Consensus       106 ~~piiiv~nK~D~~  119 (168)
T cd04177         106 NVPMVLVGNKADLE  119 (168)
T ss_pred             CCCEEEEEEChhcc
Confidence            47999999999985


No 208
>PRK03003 GTP-binding protein Der; Reviewed
Probab=44.37  E-value=23  Score=31.90  Aligned_cols=24  Identities=29%  Similarity=0.336  Sum_probs=16.9

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCC
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      ++.+.+..  .=+|+|+|.||+|+..
T Consensus       137 ~i~~~l~~--~~~piilV~NK~Dl~~  160 (472)
T PRK03003        137 AVARVLRR--SGKPVILAANKVDDER  160 (472)
T ss_pred             HHHHHHHH--cCCCEEEEEECccCCc
Confidence            34555542  3379999999999864


No 209
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=43.78  E-value=31  Score=27.42  Aligned_cols=52  Identities=17%  Similarity=0.167  Sum_probs=29.0

Q ss_pred             CHHHHHHHHHHcCccceEEEeecCCChhHHHHHH-hcCcceeceEEEEecCCCC
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFREDCNADELIDVI-NANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi-~~nrvY~P~iyv~NKiD~i  142 (160)
                      +|+..+..|.+-+..=..+.+.. -++++=.... .---.-+|.++|+||+|..
T Consensus        66 ee~v~~~~l~~~~~D~ii~VvDa-~~l~r~l~l~~ql~e~g~P~vvvlN~~D~a  118 (156)
T PF02421_consen   66 EERVARDYLLSEKPDLIIVVVDA-TNLERNLYLTLQLLELGIPVVVVLNKMDEA  118 (156)
T ss_dssp             HHHHHHHHHHHTSSSEEEEEEEG-GGHHHHHHHHHHHHHTTSSEEEEEETHHHH
T ss_pred             HHHHHHHHHhhcCCCEEEEECCC-CCHHHHHHHHHHHHHcCCCEEEEEeCHHHH
Confidence            45666777776664434444433 3333222211 1112338999999999976


No 210
>PTZ00369 Ras-like protein; Provisional
Probab=43.54  E-value=24  Score=26.82  Aligned_cols=14  Identities=36%  Similarity=0.287  Sum_probs=12.2

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|.++|.||+|+.
T Consensus       110 ~~piiiv~nK~Dl~  123 (189)
T PTZ00369        110 RVPMILVGNKCDLD  123 (189)
T ss_pred             CCCEEEEEECcccc
Confidence            46999999999984


No 211
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=43.21  E-value=1.4e+02  Score=24.50  Aligned_cols=14  Identities=14%  Similarity=0.038  Sum_probs=12.4

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -.|.|+|.||+|+.
T Consensus       105 ~~piiLVgnK~DL~  118 (222)
T cd04173         105 NAKVVLVGCKLDMR  118 (222)
T ss_pred             CCCEEEEEECcccc
Confidence            47999999999984


No 212
>PF05193 Peptidase_M16_C:  Peptidase M16 inactive domain;  InterPro: IPR007863 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. These metallopeptidases belong to MEROPS peptidase family M16 (clan ME). They include proteins, which are classified as non-peptidase homologues either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.  The peptidases in this group of sequences include:  Insulinase, insulin-degrading enzyme (3.4.24.56 from EC) Mitochondrial processing peptidase alpha subunit, (Alpha-MPP, 3.4.24.64 from EC) Pitrlysin, Protease III precursor (3.4.24.55 from EC) Nardilysin, (3.4.24.61 from EC) Ubiquinol-cytochrome C reductase complex core protein I,mitochondrial precursor (1.10.2.2 from EC) Coenzyme PQQ synthesis protein F (3.4.99 from EC)  These proteins do not share many regions of sequence similarity; the most noticeable is in the N-terminal section. This region includes a conserved histidine followed, two residues later by a glutamate and another histidine. In pitrilysin, it has been shown [] that this H-x-x-E-H motif is involved in enzymatic activity; the two histidines bind zinc and the glutamate is necessary for catalytic activity. The mitochondrial processing peptidase consists of two structurally related domains. One is the active peptidase whereas the other, the C-terminal region, is inactive. The two domains hold the substrate like a clamp [].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis; PDB: 1BE3_B 1PP9_B 2A06_B 1SQB_B 1SQP_B 1L0N_B 1SQX_B 1NU1_B 1L0L_B 2FYU_B ....
Probab=43.05  E-value=61  Score=22.78  Aligned_cols=37  Identities=19%  Similarity=0.320  Sum_probs=29.7

Q ss_pred             cCHHHHHHHHHH-cCccceEEEeecCCChhHHHHHHhc
Q psy7060          89 VNEKLVQLILHE-YKIFNAEVLFREDCNADELIDVINA  125 (160)
Q Consensus        89 ~~e~~V~~IL~E-YkI~NA~V~ired~t~DdliDvi~~  125 (160)
                      +|.+++++..++ |.=.|+.+.+-||++.|++...+..
T Consensus         2 it~e~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~   39 (184)
T PF05193_consen    2 ITLEDLRAFYKKFYRPSNMTLVIVGDIDPDELEKLIEK   39 (184)
T ss_dssp             --HHHHHHHHHHHSSGGGEEEEEEESSGHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHhcCccceEEEEEcCccHHHHHHHHHh
Confidence            567788888775 4778999999999999999988763


No 213
>CHL00071 tufA elongation factor Tu
Probab=42.97  E-value=23  Score=31.36  Aligned_cols=54  Identities=20%  Similarity=0.228  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHcCccceE-EEeecC--CChh--HHHHHHhcCcceec-eEEEEecCCCCCHHH
Q psy7060          91 EKLVQLILHEYKIFNAE-VLFRED--CNAD--ELIDVINANRVYLP-CIYAYNKIDQISIEE  146 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~-V~ired--~t~D--dliDvi~~nrvY~P-~iyv~NKiD~is~ee  146 (160)
                      .+.++...+....-.+- +.+..+  ..-.  +++..+.  ..-+| .|+|+||+|+.+.++
T Consensus        86 ~~~~~~~~~~~~~~D~~ilVvda~~g~~~qt~~~~~~~~--~~g~~~iIvvvNK~D~~~~~~  145 (409)
T CHL00071         86 ADYVKNMITGAAQMDGAILVVSAADGPMPQTKEHILLAK--QVGVPNIVVFLNKEDQVDDEE  145 (409)
T ss_pred             HHHHHHHHHHHHhCCEEEEEEECCCCCcHHHHHHHHHHH--HcCCCEEEEEEEccCCCCHHH
Confidence            35566666555444433 333222  2222  3344433  23358 568999999997543


No 214
>PRK12739 elongation factor G; Reviewed
Probab=42.95  E-value=22  Score=33.80  Aligned_cols=25  Identities=24%  Similarity=0.268  Sum_probs=17.4

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCCH
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      +++..+..  .-+|+|+++||+|+...
T Consensus       116 ~i~~~~~~--~~~p~iv~iNK~D~~~~  140 (691)
T PRK12739        116 TVWRQADK--YGVPRIVFVNKMDRIGA  140 (691)
T ss_pred             HHHHHHHH--cCCCEEEEEECCCCCCC
Confidence            44444433  33799999999999853


No 215
>TIGR00485 EF-Tu translation elongation factor TU. This alignment models orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts, one of several GTP-binding translation factors found by the more general pfam model GTP_EFTU. The eukaryotic conterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this model. EF-Tu is one of the most abundant proteins in bacteria, as well as one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=42.80  E-value=34  Score=29.97  Aligned_cols=19  Identities=37%  Similarity=0.412  Sum_probs=14.3

Q ss_pred             cceeceE-EEEecCCCCCHH
Q psy7060         127 RVYLPCI-YAYNKIDQISIE  145 (160)
Q Consensus       127 rvY~P~i-yv~NKiD~is~e  145 (160)
                      ...+|.+ +|+||+|+.+.+
T Consensus       125 ~~gi~~iIvvvNK~Dl~~~~  144 (394)
T TIGR00485       125 QVGVPYIVVFLNKCDMVDDE  144 (394)
T ss_pred             HcCCCEEEEEEEecccCCHH
Confidence            3357887 589999998654


No 216
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=42.56  E-value=19  Score=28.27  Aligned_cols=14  Identities=21%  Similarity=0.109  Sum_probs=12.3

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.++++||+|+.+
T Consensus       149 ~a~iiv~NK~Dl~~  162 (207)
T TIGR00073       149 EADLIVINKADLAE  162 (207)
T ss_pred             hCCEEEEEHHHccc
Confidence            47899999999985


No 217
>PRK13674 putative GTP cyclohydrolase; Provisional
Probab=42.47  E-value=21  Score=31.03  Aligned_cols=42  Identities=26%  Similarity=0.446  Sum_probs=29.9

Q ss_pred             CccccccCCCcccCHHHHHHHHHHcCccc----eEE--EeecC--CChhHHHHHHhcC
Q psy7060          77 GIAFNSTCPLTQVNEKLVQLILHEYKIFN----AEV--LFRED--CNADELIDVINAN  126 (160)
Q Consensus        77 ~~~~~~~~~~~~~~e~~V~~IL~EYkI~N----A~V--~ired--~t~DdliDvi~~n  126 (160)
                      .+...||||-        -+-|.+|+-||    |.+  .++++  +.++||||.++.+
T Consensus       147 ~V~~~T~CPC--------S~~is~~~~HnQRs~~~i~v~~~~~~~i~iedLI~~~E~~  196 (271)
T PRK13674        147 EVPVSSLCPC--------SKAISRYTAHSQRSVATVKVRLAADAQLWIEDLIDLAEAA  196 (271)
T ss_pred             EEEEEECCcC--------hHhHccCCCccccEEEEEEEEeCCCCcCCHHHHHHHHHHh
Confidence            4556899994        34445689997    444  44556  7799999999865


No 218
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=42.37  E-value=26  Score=25.50  Aligned_cols=15  Identities=33%  Similarity=0.301  Sum_probs=12.9

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|.++|.||+|+..
T Consensus       105 ~~piilv~nK~Dl~~  119 (175)
T cd01870         105 NVPIILVGNKKDLRN  119 (175)
T ss_pred             CCCEEEEeeChhccc
Confidence            369999999999864


No 219
>PHA01631 hypothetical protein
Probab=42.30  E-value=22  Score=29.94  Aligned_cols=49  Identities=22%  Similarity=0.424  Sum_probs=35.8

Q ss_pred             HHHHHHHHHHcCccceEE--EeecCCChhHHHHHHhcCcceeceEEEEecC
Q psy7060          91 EKLVQLILHEYKIFNAEV--LFREDCNADELIDVINANRVYLPCIYAYNKI  139 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V--~ired~t~DdliDvi~~nrvY~P~iyv~NKi  139 (160)
                      .+++..||++|.=-|-++  .+..|+.+-.+-..+.+.++|-|||.|++|-
T Consensus        57 Ak~Ll~Iln~~s~i~DDi~~iIDSDV~ipn~~~~~~~~~v~t~CiPA~~kp  107 (176)
T PHA01631         57 AKQLLTIVNFAKNIEDDIIAIIDSDLIIPNLREIIPNERVFTPCYWLYYDW  107 (176)
T ss_pred             HHHHHHHHHhhccCCccEEEEeccceEecCccccccCCCccceeeeeeecC
Confidence            356778888887777777  5677776665543344459999999999985


No 220
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=42.19  E-value=22  Score=26.45  Aligned_cols=14  Identities=29%  Similarity=0.437  Sum_probs=12.8

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      =+|+++|.||+|+.
T Consensus       104 ~~piiiv~nK~Dl~  117 (166)
T cd00877         104 NIPIVLCGNKVDIK  117 (166)
T ss_pred             CCcEEEEEEchhcc
Confidence            58999999999986


No 221
>PRK09866 hypothetical protein; Provisional
Probab=42.15  E-value=39  Score=33.84  Aligned_cols=13  Identities=38%  Similarity=0.411  Sum_probs=12.2

Q ss_pred             ceEEEEecCCCCC
Q psy7060         131 PCIYAYNKIDQIS  143 (160)
Q Consensus       131 P~iyv~NKiD~is  143 (160)
                      |.++|+||+|+.+
T Consensus       291 PVILVVNKIDl~d  303 (741)
T PRK09866        291 PLYVLVNKFDQQD  303 (741)
T ss_pred             CEEEEEEcccCCC
Confidence            9999999999986


No 222
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=41.45  E-value=29  Score=25.99  Aligned_cols=14  Identities=21%  Similarity=0.045  Sum_probs=12.4

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.++|.||+|+..
T Consensus       106 ~piilv~nK~Dl~~  119 (193)
T cd04118         106 CKIYLCGTKSDLIE  119 (193)
T ss_pred             CCEEEEEEcccccc
Confidence            69999999999863


No 223
>PLN03126 Elongation factor Tu; Provisional
Probab=41.34  E-value=23  Score=32.62  Aligned_cols=54  Identities=22%  Similarity=0.224  Sum_probs=29.5

Q ss_pred             HHHHHHHHHHcCccc-eEEEeec--CCCh--hHHHHHHhcCcceec-eEEEEecCCCCCHHH
Q psy7060          91 EKLVQLILHEYKIFN-AEVLFRE--DCNA--DELIDVINANRVYLP-CIYAYNKIDQISIEE  146 (160)
Q Consensus        91 e~~V~~IL~EYkI~N-A~V~ire--d~t~--DdliDvi~~nrvY~P-~iyv~NKiD~is~ee  146 (160)
                      ++.++..+.....-. |-+.+..  ....  .+.+..+.  ..=+| .|+++||+|+.+.++
T Consensus       155 ~~f~~~~~~g~~~aD~ailVVda~~G~~~qt~e~~~~~~--~~gi~~iIvvvNK~Dl~~~~~  214 (478)
T PLN03126        155 ADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAK--QVGVPNMVVFLNKQDQVDDEE  214 (478)
T ss_pred             HHHHHHHHHHHhhCCEEEEEEECCCCCcHHHHHHHHHHH--HcCCCeEEEEEecccccCHHH
Confidence            556666665554333 4444432  2222  23444433  33358 678999999997543


No 224
>cd06535 CIDE_N_CAD CIDE_N domain of CAD nuclease. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of CAD/DFF40 and ICAD/DFF45 during apoptosis. In normal cells, DFF exists in the nucleus as a heterodimer composed of CAD/DFF40 as a latent nuclease and its chaperone and inhibitor subunit ICAD/DFF45. Apoptotic activation of caspase-3 results in the cleavage of DFF45/ICAD and the release of active DFF40/CAD nuclease.
Probab=40.86  E-value=23  Score=26.09  Aligned_cols=57  Identities=16%  Similarity=0.174  Sum_probs=43.0

Q ss_pred             hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccc--eEEEeecC---CChhHHHHHHhcCcce
Q psy7060          65 YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFN--AEVLFRED---CNADELIDVINANRVY  129 (160)
Q Consensus        65 yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~N--A~V~ired---~t~DdliDvi~~nrvY  129 (160)
                      |||.|.+....=||+-+|-       +++......-+.+..  ..+...||   +| ||+-..+..|-++
T Consensus         5 ~kV~~~~rs~k~GV~A~sL-------~eL~~K~~~~l~l~~~~~~l~L~eDGTeVt-EeyF~tLp~nT~l   66 (77)
T cd06535           5 VKIRSLNSAQKYGVAAKNL-------KELLRKGCRLLQLPCAGSRLCLYEDGTEVT-EEYFPTLPDNTEL   66 (77)
T ss_pred             eEEecCCCCeeEeEEcCCH-------HHHHHHHHHHhCCCCCCcEEEEecCCcEeh-HHHHhcCCCCcEE
Confidence            6777777777778887764       778888888999984  46777887   54 7777777777665


No 225
>PF14297 DUF4373:  Domain of unknown function (DUF4373)
Probab=40.48  E-value=23  Score=24.92  Aligned_cols=20  Identities=40%  Similarity=0.725  Sum_probs=17.7

Q ss_pred             ccCHHHHHHHHHHcCccceE
Q psy7060          88 QVNEKLVQLILHEYKIFNAE  107 (160)
Q Consensus        88 ~~~e~~V~~IL~EYkI~NA~  107 (160)
                      +++++.|++|+.+|+.|+.+
T Consensus        57 ~~~~~~v~~II~~~~LF~~~   76 (87)
T PF14297_consen   57 GVSEEYVEEIINEYGLFDIE   76 (87)
T ss_pred             CcCHHHHHHHHHHhCCcccC
Confidence            48899999999999999954


No 226
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]
Probab=40.43  E-value=22  Score=32.74  Aligned_cols=47  Identities=19%  Similarity=0.212  Sum_probs=28.2

Q ss_pred             CChhHHHHHHhcC-cceeceEEEEecCCCCCHH---HHHHHhcC-C----CceeeC
Q psy7060         114 CNADELIDVINAN-RVYLPCIYAYNKIDQISIE---EVDRIARQ-P----NSVVVR  160 (160)
Q Consensus       114 ~t~DdliDvi~~n-rvY~P~iyv~NKiD~is~e---evd~i~~~-p----~~v~is  160 (160)
                      .+-+|+.-.-.-+ ..-+|.|||.||.|....+   .++++... +    ..|++|
T Consensus       190 ~~~e~~~~l~~l~llt~KP~lyvaN~~e~~~~~~n~~~~~i~~~~~~~~~~vV~~s  245 (372)
T COG0012         190 WSEEDLEALASLNLLTAKPMLYVANVSEDDLANLNEYVKRLKELAAKENAEVVPVS  245 (372)
T ss_pred             CCHHHHHHHHHhhhhhcCCeEEEEECCcccccchhHHHHHHHHHhhhcCCcEEEee
Confidence            4445444333334 3457999999999988633   36666333 2    256665


No 227
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=39.53  E-value=1.1e+02  Score=29.29  Aligned_cols=52  Identities=17%  Similarity=0.256  Sum_probs=30.4

Q ss_pred             HHHHHHHHHHcCccceEEEeecC---CC-hh-HHHHHHhcCcceeceEEEEecCCCCCH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFRED---CN-AD-ELIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ired---~t-~D-dliDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      .........-|.--++-+.+-.-   .+ .| ++++.+..  .-+|+|+|.||+|+...
T Consensus       342 ~~~~~~~~~~~~~aD~iL~VvDa~~~~~~~d~~i~~~Lr~--~~~pvIlV~NK~D~~~~  398 (712)
T PRK09518        342 SAIASQAQIAVSLADAVVFVVDGQVGLTSTDERIVRMLRR--AGKPVVLAVNKIDDQAS  398 (712)
T ss_pred             HHHHHHHHHHHHhCCEEEEEEECCCCCCHHHHHHHHHHHh--cCCCEEEEEECcccccc
Confidence            33444555555555555555331   22 23 35566643  34799999999998753


No 228
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=39.05  E-value=31  Score=27.23  Aligned_cols=24  Identities=29%  Similarity=0.282  Sum_probs=17.4

Q ss_pred             eceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         130 LPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       130 ~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      .|.++|.||+|+..     .++.+.+++.
T Consensus       110 ~~iilvgNK~Dl~~~~~v~~~~~~~~~~~  138 (211)
T cd04111         110 PVFILVGHKCDLESQRQVTREEAEKLAKD  138 (211)
T ss_pred             CeEEEEEEccccccccccCHHHHHHHHHH
Confidence            57889999999863     4666666543


No 229
>KOG2484|consensus
Probab=38.83  E-value=35  Score=32.21  Aligned_cols=58  Identities=22%  Similarity=0.339  Sum_probs=42.6

Q ss_pred             CHHHHHHHHHHcC--ccceEEEee-----c--CCChhHHHHHHh---cCcceeceEEEEecCCCCCHHHHHHH
Q psy7060          90 NEKLVQLILHEYK--IFNAEVLFR-----E--DCNADELIDVIN---ANRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus        90 ~e~~V~~IL~EYk--I~NA~V~ir-----e--d~t~DdliDvi~---~nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      +++..++...|++  |-.++|.+.     .  -+.--+.++++.   ||   +.-|.|+||+|+++.|-++.-
T Consensus       129 ~~~s~kaY~ke~rkvve~sDVVleVlDARDPlgtR~~~vE~~V~~~~gn---KkLILVLNK~DLVPrEv~e~W  198 (435)
T KOG2484|consen  129 NEESKKAYDKEFRKVVEASDVVLEVLDARDPLGTRCPEVEEAVLQAHGN---KKLILVLNKIDLVPREVVEKW  198 (435)
T ss_pred             chhhHHHHHHHHHHHHhhhheEEEeeeccCCCCCCChhHHHHHHhccCC---ceEEEEeehhccCCHHHHHHH
Confidence            4566777777775  677888774     1  245567777775   77   456899999999999888754


No 230
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=38.62  E-value=44  Score=23.86  Aligned_cols=53  Identities=23%  Similarity=0.328  Sum_probs=31.4

Q ss_pred             cCccceEEEeecCC------ChhHHHHHHhcCcc-eeceEEEEecCCCCC-----HHHHHHHhcC
Q psy7060         101 YKIFNAEVLFREDC------NADELIDVINANRV-YLPCIYAYNKIDQIS-----IEEVDRIARQ  153 (160)
Q Consensus       101 YkI~NA~V~ired~------t~DdliDvi~~nrv-Y~P~iyv~NKiD~is-----~eevd~i~~~  153 (160)
                      |+=.+|-+.+-.-.      ++..+...+...+- -.|.+++.||.|+..     .++..++++.
T Consensus        69 ~~~~~~~ii~fd~~~~~S~~~~~~~~~~i~~~~~~~~~iivvg~K~D~~~~~~v~~~~~~~~~~~  133 (162)
T PF00071_consen   69 YRNSDAIIIVFDVTDEESFENLKKWLEEIQKYKPEDIPIIVVGNKSDLSDEREVSVEEAQEFAKE  133 (162)
T ss_dssp             HTTESEEEEEEETTBHHHHHTHHHHHHHHHHHSTTTSEEEEEEETTTGGGGSSSCHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccceeeeccccccccccchhhHHHHHHHH
Confidence            44455555554221      23344455554454 479999999999763     4667777554


No 231
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=38.59  E-value=43  Score=22.34  Aligned_cols=59  Identities=17%  Similarity=0.085  Sum_probs=31.4

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhc-CcceeceEEEEecC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINA-NRVYLPCIYAYNKI  139 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~-nrvY~P~iyv~NKi  139 (160)
                      .+.||.-..-...++.+..+|+-...-+...=||+.++--+.... +....|+++++++-
T Consensus        26 a~wC~~C~~~~~~~~~~~~~~~~~~~~~~~~id~~~~~~~~~~~~~~i~~~Pt~~~~~~g   85 (104)
T cd02997          26 APWCGHCKKMKPEFTKAATELKEDGKGVLAAVDCTKPEHDALKEEYNVKGFPTFKYFENG   85 (104)
T ss_pred             CCCCHHHHHhCHHHHHHHHHHhhCCceEEEEEECCCCccHHHHHhCCCccccEEEEEeCC
Confidence            455776555555566666666532222222335554322233332 33477999999854


No 232
>COG1161 Predicted GTPases [General function prediction only]
Probab=38.42  E-value=23  Score=30.70  Aligned_cols=55  Identities=20%  Similarity=0.130  Sum_probs=32.9

Q ss_pred             HHHHHHHHHHcCccceEEEe----ecC-CC-hhHHHHHHhcCcceeceEEEEecCCCCCHHHHHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLF----RED-CN-ADELIDVINANRVYLPCIYAYNKIDQISIEEVDR  149 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~i----red-~t-~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~  149 (160)
                      -+.....++++-.+...|.-    |.. -| -.++.+.+.++.    .|+|+||+|+.+.+....
T Consensus        21 ~~k~~~~~~~~~~~~d~vvevvDar~P~~s~~~~l~~~v~~k~----~i~vlNK~DL~~~~~~~~   81 (322)
T COG1161          21 MKKAKRQLKEVLKSVDVVVEVVDARDPLGTRNPELERIVKEKP----KLLVLNKADLAPKEVTKK   81 (322)
T ss_pred             hHHHHHHHHHhcccCCEEEEEEeccccccccCccHHHHHccCC----cEEEEehhhcCCHHHHHH
Confidence            34466677777666554432    322 22 344555555543    399999999998755443


No 233
>TIGR00294 conserved hypothetical protein TIGR00294.
Probab=38.41  E-value=33  Score=29.75  Aligned_cols=26  Identities=15%  Similarity=0.330  Sum_probs=19.3

Q ss_pred             cCccc----eEEEe----ecCCChhHHHHHHhcC
Q psy7060         101 YKIFN----AEVLF----REDCNADELIDVINAN  126 (160)
Q Consensus       101 YkI~N----A~V~i----red~t~DdliDvi~~n  126 (160)
                      |+-||    |.+.+    +.++.++||||.++.+
T Consensus       189 ~~aHnQRs~~~i~v~~~~~~~~~~edli~~~E~~  222 (308)
T TIGR00294       189 FATHNQRGRGRIFTEVPSLPSIVIADLIDIAESS  222 (308)
T ss_pred             CcCccCCcEEEEEEEeCCCCccCHHHHHHHHHHh
Confidence            67787    55555    4468999999999864


No 234
>PRK12736 elongation factor Tu; Reviewed
Probab=38.40  E-value=1e+02  Score=27.13  Aligned_cols=53  Identities=17%  Similarity=0.187  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHcCccceEEEe-ecC--CCh--hHHHHHHhcCcceece-EEEEecCCCCCHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLF-RED--CNA--DELIDVINANRVYLPC-IYAYNKIDQISIE  145 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~i-red--~t~--DdliDvi~~nrvY~P~-iyv~NKiD~is~e  145 (160)
                      ++.+...++....-.+-+++ ..+  ...  .+.+..+...  -+|. |+|+||+|+.+.+
T Consensus        86 ~~f~~~~~~~~~~~d~~llVvd~~~g~~~~t~~~~~~~~~~--g~~~~IvviNK~D~~~~~  144 (394)
T PRK12736         86 ADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQV--GVPYLVVFLNKVDLVDDE  144 (394)
T ss_pred             HHHHHHHHHHHhhCCEEEEEEECCCCCchhHHHHHHHHHHc--CCCEEEEEEEecCCcchH
Confidence            45556665554433333333 221  122  2444444333  3685 6889999998543


No 235
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=38.38  E-value=62  Score=21.46  Aligned_cols=59  Identities=14%  Similarity=0.145  Sum_probs=36.9

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCC
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKID  140 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD  140 (160)
                      +.+.|+.-+.=...++.+..+|+=..--...+=||+..++.....  -...|+++++.+-.
T Consensus        26 ~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~id~~~~~~~~~~~--~~~~Pt~~~~~~~~   84 (104)
T cd02995          26 YAPWCGHCKALAPIYEELAEKLKGDDNVVIAKMDATANDVPSEFV--VDGFPTILFFPAGD   84 (104)
T ss_pred             ECCCCHHHHHHhhHHHHHHHHhcCCCCEEEEEEeCcchhhhhhcc--CCCCCEEEEEcCCC
Confidence            467788777666777777777754322333345666666544332  25679999997543


No 236
>smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation.
Probab=38.37  E-value=26  Score=25.54  Aligned_cols=58  Identities=17%  Similarity=0.347  Sum_probs=44.4

Q ss_pred             hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCcc--ceEEEeecC---CChhHHHHHHhcCcce
Q psy7060          65 YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIF--NAEVLFRED---CNADELIDVINANRVY  129 (160)
Q Consensus        65 yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~--NA~V~ired---~t~DdliDvi~~nrvY  129 (160)
                      |||.|.+....=||+-+|-       +++......-+.+.  ...+.+.+|   +.-+|.-..+..|-++
T Consensus         3 ~kV~~~~r~~k~GV~A~sL-------~eL~~K~~~~l~l~~~~~~l~L~eDGT~VddEeyF~tLp~nt~l   65 (74)
T smart00266        3 FKVRDHDRNVRKGVAASSL-------EELLSKVCDKLALPDSPVTLVLEEDGTIVDDEEYFQTLPDNTEL   65 (74)
T ss_pred             EEEecCCCCeeEEEEcCCH-------HHHHHHHHHHhCCCCCCcEEEEecCCcEEccHHHHhcCCCCcEE
Confidence            6788888888888888774       77888899999998  577777888   4456677777677654


No 237
>TIGR01608 citD citrate lyase acyl carrier protein. This is a model of the acyl carrier protein (aka gamma subunit) of the holoenzyme citrate lyase (EC 4.1.3.6) composed of alpha (EC 2.8.3.10), beta (EC 4.1.3.34), and acyl carrier protein subunits in a stoichiometric relationship of 6:6:6. Citrate lyase is an enzyme which converts citrate to oxaloacetate. In bacteria, this reaction is involved in citrate fermentation. The acyl carrier protein covalently binds the coenzyme of citrate lyase. The seed contains an experimentally characterized member from Leuconostoc mesenteroides. The model covers a wide range of Gram positive bacteria. For Gram negative bacteria, it appears that only gamma proteobacteria hit this model. The model is quite robust with queries scoring either quite well or quite poorly against the model. There are currently no hits in-between the noise cutoff and trusted cutoff.
Probab=38.31  E-value=61  Score=24.67  Aligned_cols=30  Identities=23%  Similarity=0.138  Sum_probs=24.2

Q ss_pred             HHHHHHHHHHcCccceEEEeecCCChhHHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFREDCNADELI  120 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ired~t~Ddli  120 (160)
                      .+.|...|.++++.||.|.+...=-+|=.|
T Consensus        46 r~~v~etL~~lgV~~~~v~v~DkGALDc~I   75 (92)
T TIGR01608        46 ESTVKETLKLLGVENAVVKVVDKGALNCVI   75 (92)
T ss_pred             HHHHHHHHHHcCCceEEEEEEeCChHHHHH
Confidence            578999999999999999998755555444


No 238
>PRK13580 serine hydroxymethyltransferase; Provisional
Probab=38.11  E-value=44  Score=31.51  Aligned_cols=37  Identities=22%  Similarity=0.194  Sum_probs=25.6

Q ss_pred             HHHHHHHHhcCceeccC-CCCeEEEEecCcceEEeccc
Q psy7060          12 GLLEKELESVGIRLNKK-KPNIYFKQKKAGGIAFNSTC   48 (160)
Q Consensus        12 ~~le~ELe~~GIrLnkk-~p~I~ikkk~~GGI~i~~t~   48 (160)
                      ..+++.|++.||.+|+- +|.+--..-...||||..+.
T Consensus       384 ~~a~~~L~e~GI~vn~i~~Ptvp~g~~~~srLRIg~~A  421 (493)
T PRK13580        384 RQAESALLDAGIVTNRNSIPSDPNGAWYTSGIRLGTPA  421 (493)
T ss_pred             HHHHHHHHHCCeEEccccCCCCCCCCCCCceEEeccch
Confidence            46888999999999974 45543222236789997654


No 239
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=37.86  E-value=32  Score=32.46  Aligned_cols=48  Identities=25%  Similarity=0.196  Sum_probs=28.5

Q ss_pred             ccceEEE-eecCCCh--hHHHHHHhc-CcceeceEEEEecCCCCCHHHHHHH
Q psy7060         103 IFNAEVL-FREDCNA--DELIDVINA-NRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       103 I~NA~V~-ired~t~--DdliDvi~~-nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      +-.|+.. +--|.+-  ++--..+.. .+.=+|++.|+||+|+.+..+...+
T Consensus       294 i~~ADlvL~v~D~~~~~~~~d~~~~~~~~~~~~~i~v~NK~DL~~~~~~~~~  345 (454)
T COG0486         294 IEEADLVLFVLDASQPLDKEDLALIELLPKKKPIIVVLNKADLVSKIELESE  345 (454)
T ss_pred             HHhCCEEEEEEeCCCCCchhhHHHHHhcccCCCEEEEEechhcccccccchh
Confidence            4556543 3344443  222222333 5555789999999999987665544


No 240
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=37.66  E-value=23  Score=26.57  Aligned_cols=23  Identities=9%  Similarity=0.065  Sum_probs=16.9

Q ss_pred             eceEEEEecCCCC-------CHHHHHHHhc
Q psy7060         130 LPCIYAYNKIDQI-------SIEEVDRIAR  152 (160)
Q Consensus       130 ~P~iyv~NKiD~i-------s~eevd~i~~  152 (160)
                      +|.++|.||.|+.       +.++.+.+++
T Consensus       100 ~piilvgnK~Dl~~~~~~~v~~~~~~~~~~  129 (158)
T cd04103         100 IPLILVGTQDAISESNPRVIDDARARQLCA  129 (158)
T ss_pred             CCEEEEeeHHHhhhcCCcccCHHHHHHHHH
Confidence            7999999999973       3455566664


No 241
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=37.63  E-value=45  Score=25.09  Aligned_cols=15  Identities=20%  Similarity=-0.020  Sum_probs=12.7

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -.|.+.+.||+|+..
T Consensus        91 ~~~ii~v~nK~Dl~~  105 (158)
T PRK15467         91 SKRQIAVISKTDMPD  105 (158)
T ss_pred             CCCeEEEEEccccCc
Confidence            468999999999864


No 242
>PF03029 ATP_bind_1:  Conserved hypothetical ATP binding protein;  InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity.; GO: 0000166 nucleotide binding; PDB: 1YR7_A 1YRA_B 1YR8_A 1YR6_A 1YR9_A 1YRB_A 2OXR_A.
Probab=37.55  E-value=20  Score=29.78  Aligned_cols=18  Identities=39%  Similarity=0.540  Sum_probs=13.4

Q ss_pred             CcceeceEEEEecCCCCC
Q psy7060         126 NRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       126 nrvY~P~iyv~NKiD~is  143 (160)
                      -|.-+|.|.|+||+|+++
T Consensus       153 ~~~~lP~vnvlsK~Dl~~  170 (238)
T PF03029_consen  153 LRLELPHVNVLSKIDLLS  170 (238)
T ss_dssp             HHHTSEEEEEE--GGGS-
T ss_pred             hhCCCCEEEeeeccCccc
Confidence            367899999999999998


No 243
>PRK15367 type III secretion system protein SsaD; Provisional
Probab=37.33  E-value=3.5e+02  Score=25.31  Aligned_cols=120  Identities=16%  Similarity=0.156  Sum_probs=75.5

Q ss_pred             HHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCccc
Q psy7060          10 QRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQV   89 (160)
Q Consensus        10 q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~   89 (160)
                      .+..+.+.|..-|.      ..|...-...|.+.+.+-|..+. .-..+|.+|.           +-||.|-.-.-   .
T Consensus       140 ~~~~l~~~L~~p~l------~~V~~~W~~dg~l~LsGyC~~s~-~~~~Lq~~L~-----------~~gi~yr~~lv---c  198 (395)
T PRK15367        140 LPLRVKFLLDKSNI------HYVRAQWKEDGSLQLSGYCSSSE-QMQKVRATLE-----------SWGVMYRDGVI---C  198 (395)
T ss_pred             hHHHHHHHhhcccc------cceEEEECCCCcEEEEEEECChH-HHHHHHHHHH-----------hcCceeeecce---e
Confidence            45566666655543      56888888889999999998764 2333444443           44666633221   1


Q ss_pred             CHH---HHHHHHHHcCccceEEE--------eecCCChh----HHHHHHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          90 NEK---LVQLILHEYKIFNAEVL--------FREDCNAD----ELIDVINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        90 ~e~---~V~~IL~EYkI~NA~V~--------ired~t~D----dliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      ++.   .|+.||+.|+.++++|.        |.++++.+    .+...+ .+--=+--.-+.|.++.-...-++++.
T Consensus       199 ~D~L~~~V~~IL~~~GY~~i~V~~~~pG~v~I~G~Iq~~~~w~~V~~lL-~~vpGL~gW~v~n~~~g~~~~li~~L~  274 (395)
T PRK15367        199 DDLLIREVQDVLIKMGYPHAEVSSEGPGSVLIHDDIQMDQQWRKVQPLL-ADIPGLLHWQISHSHQSQGDDIISAII  274 (395)
T ss_pred             HHHHHHHHHHHHHHcCcCceEEecCCCCeEEEEeeecCCcchHHHHHHH-HhCcCcceEEEEeccchhHHHHHHHHH
Confidence            233   57889999999999887        66666644    444444 333334445677777766666666653


No 244
>TIGR02475 CobW cobalamin biosynthesis protein CobW. A broader CobW family is delineated by two PFAM models which identify the N- and C-terminal domains (pfam02492 and pfam07683).
Probab=37.29  E-value=30  Score=30.31  Aligned_cols=19  Identities=21%  Similarity=0.317  Sum_probs=16.3

Q ss_pred             eEEEEecCCCCCHHHHHHH
Q psy7060         132 CIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       132 ~iyv~NKiD~is~eevd~i  150 (160)
                      -++++||+|+.+.++++++
T Consensus       176 D~IvlnK~Dl~~~~~l~~~  194 (341)
T TIGR02475       176 DLVILNKADLLDAAGLARV  194 (341)
T ss_pred             CEEEEeccccCCHHHHHHH
Confidence            4689999999999888766


No 245
>PRK10076 pyruvate formate lyase II activase; Provisional
Probab=37.26  E-value=37  Score=27.97  Aligned_cols=100  Identities=12%  Similarity=0.108  Sum_probs=50.7

Q ss_pred             cCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCccc--CHHHHHHHHHHcCccceEEEeec---
Q psy7060          38 KAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQV--NEKLVQLILHEYKIFNAEVLFRE---  112 (160)
Q Consensus        38 ~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~--~e~~V~~IL~EYkI~NA~V~ire---  112 (160)
                      ..|||.|++.-|+.+  .+.+..++..-|       +. ||   .||--|..  +.+.++.++.--..++.++.--.   
T Consensus        38 sggGVt~SGGEPllq--~~fl~~l~~~~k-------~~-gi---~~~leTnG~~~~~~~~~l~~~~D~~l~DiK~~d~~~  104 (213)
T PRK10076         38 SGGGVTLSGGEVLMQ--AEFATRFLQRLR-------LW-GV---SCAIETAGDAPASKLLPLAKLCDEVLFDLKIMDATQ  104 (213)
T ss_pred             CCCEEEEeCchHHcC--HHHHHHHHHHHH-------Hc-CC---CEEEECCCCCCHHHHHHHHHhcCEEEEeeccCCHHH
Confidence            568888888888876  444444444332       22 33   33333332  56667777765556666665421   


Q ss_pred             -----CCChhHHHHHH---h-cCcceeceEEEEecC-CCCCHHHHHHHhc
Q psy7060         113 -----DCNADELIDVI---N-ANRVYLPCIYAYNKI-DQISIEEVDRIAR  152 (160)
Q Consensus       113 -----d~t~DdliDvi---~-~nrvY~P~iyv~NKi-D~is~eevd~i~~  152 (160)
                           -++.+.+.+-+   . .+.-+.-.+.++-.. |  +.|+++++++
T Consensus       105 ~~~~tG~~~~~il~nl~~l~~~g~~v~iR~~vIPg~nd--~~e~i~~ia~  152 (213)
T PRK10076        105 ARDVVKMNLPRVLENLRLLVSEGVNVIPRLPLIPGFTL--SRENMQQALD  152 (213)
T ss_pred             HHHHHCCCHHHHHHHHHHHHhCCCcEEEEEEEECCCCC--CHHHHHHHHH
Confidence                 13344444433   2 222233334444443 4  5677766653


No 246
>KOG1487|consensus
Probab=37.25  E-value=21  Score=32.75  Aligned_cols=71  Identities=21%  Similarity=0.226  Sum_probs=45.2

Q ss_pred             HHHHHHHHHhhhhhhHHhhh---------cCcccc-----ccCCCcccCHHHHHHHHHHcCccceEEEeec-CCChhHHH
Q psy7060          56 KLVQLILHEYKIFNAEQKKA---------GGIAFN-----STCPLTQVNEKLVQLILHEYKIFNAEVLFRE-DCNADELI  120 (160)
Q Consensus        56 ~~v~~~l~~yki~n~~~~~~---------~~~~~~-----~~~~~~~~~e~~V~~IL~EYkI~NA~V~ire-d~t~Ddli  120 (160)
                      .+++++|.+|++|||+..-+         |-+.+|     +..-|.+++.=.+..+==+|+|-||.-.--+ +-|.|++.
T Consensus       194 D~~rsil~eyR~hsAdi~Lr~DaT~DdLIdvVegnr~yVp~iyvLNkIdsISiEELdii~~iphavpISA~~~wn~d~lL  273 (358)
T KOG1487|consen  194 DLQRSILSEYRIHSADIALRFDATADDLIDVVEGNRIYVPCIYVLNKIDSISIEELDIIYTIPHAVPISAHTGWNFDKLL  273 (358)
T ss_pred             HHHHHHHHHhhhcchheeeecCcchhhhhhhhccCceeeeeeeeecccceeeeeccceeeeccceeecccccccchHHHH
Confidence            37899999999999997543         335555     2223444443333333346888887543333 57889998


Q ss_pred             HHHhcC
Q psy7060         121 DVINAN  126 (160)
Q Consensus       121 Dvi~~n  126 (160)
                      +.+-+.
T Consensus       274 ~~mwey  279 (358)
T KOG1487|consen  274 EKMWEY  279 (358)
T ss_pred             HHHhhc
Confidence            888664


No 247
>PTZ00099 rab6; Provisional
Probab=36.75  E-value=72  Score=24.71  Aligned_cols=23  Identities=26%  Similarity=-0.010  Sum_probs=16.4

Q ss_pred             eeceEEEEecCCCC-----CHHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQI-----SIEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~i-----s~eevd~i~  151 (160)
                      =.|.|+|.||+|+.     +.++...++
T Consensus        85 ~~piilVgNK~DL~~~~~v~~~e~~~~~  112 (176)
T PTZ00099         85 DVIIALVGNKTDLGDLRKVTYEEGMQKA  112 (176)
T ss_pred             CCeEEEEEECcccccccCCCHHHHHHHH
Confidence            36889999999985     445555544


No 248
>KOG0395|consensus
Probab=36.69  E-value=33  Score=27.67  Aligned_cols=23  Identities=35%  Similarity=0.263  Sum_probs=17.5

Q ss_pred             eeceEEEEecCCCCC-----HHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQIS-----IEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~is-----~eevd~i~  151 (160)
                      .+|.+.|-||+|+..     .||-..+|
T Consensus       108 ~~PivlVGNK~Dl~~~R~V~~eeg~~la  135 (196)
T KOG0395|consen  108 DVPIILVGNKCDLERERQVSEEEGKALA  135 (196)
T ss_pred             CCCEEEEEEcccchhccccCHHHHHHHH
Confidence            389999999999974     46655554


No 249
>PLN03127 Elongation factor Tu; Provisional
Probab=36.57  E-value=51  Score=30.05  Aligned_cols=26  Identities=31%  Similarity=0.383  Sum_probs=16.9

Q ss_pred             HHHHHHhcCcceece-EEEEecCCCCCHH
Q psy7060         118 ELIDVINANRVYLPC-IYAYNKIDQISIE  145 (160)
Q Consensus       118 dliDvi~~nrvY~P~-iyv~NKiD~is~e  145 (160)
                      +.+..+.  ..-+|. |+|+||+|+.+.+
T Consensus       167 e~l~~~~--~~gip~iIvviNKiDlv~~~  193 (447)
T PLN03127        167 EHILLAR--QVGVPSLVVFLNKVDVVDDE  193 (447)
T ss_pred             HHHHHHH--HcCCCeEEEEEEeeccCCHH
Confidence            3444443  334695 6889999998643


No 250
>PRK05433 GTP-binding protein LepA; Provisional
Probab=36.47  E-value=69  Score=30.37  Aligned_cols=14  Identities=43%  Similarity=0.382  Sum_probs=12.4

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.|.|+||+|+..
T Consensus       127 lpiIvViNKiDl~~  140 (600)
T PRK05433        127 LEIIPVLNKIDLPA  140 (600)
T ss_pred             CCEEEEEECCCCCc
Confidence            69999999999863


No 251
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=36.21  E-value=1.2e+02  Score=24.17  Aligned_cols=15  Identities=27%  Similarity=0.375  Sum_probs=12.8

Q ss_pred             ceeceEEEEecCCCC
Q psy7060         128 VYLPCIYAYNKIDQI  142 (160)
Q Consensus       128 vY~P~iyv~NKiD~i  142 (160)
                      --+|.|+|.||+|+.
T Consensus        98 ~~~piilvgNK~Dl~  112 (200)
T smart00176       98 ENIPIVLCGNKVDVK  112 (200)
T ss_pred             CCCCEEEEEECcccc
Confidence            357999999999974


No 252
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative. This model describes a small family of proteins believed to aid in the export of various class II bacteriocins, which are ribosomally-synthesized, non-lantibiotic bacterial peptide antibiotics. Members of this family are found in operons for pediocin PA-1 from Pediococcus acidilactici and brochocin-C from Brochothrix campestris.
Probab=35.95  E-value=1.8e+02  Score=21.55  Aligned_cols=72  Identities=13%  Similarity=0.099  Sum_probs=43.6

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCccceEEEeecC-----CChhHHHHHHh-----cCcceeceEEEEecC--------CC
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKIFNAEVLFRED-----CNADELIDVIN-----ANRVYLPCIYAYNKI--------DQ  141 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired-----~t~DdliDvi~-----~nrvY~P~iyv~NKi--------D~  141 (160)
                      ..++||--+.=...++.+..+.+..=.-|-+.++     .+-+++.+...     .+-.++|+++++++=        +.
T Consensus        31 ~~~~Cp~C~~~~P~l~~~~~~~~~~~y~vdvd~~~~~~~~~~~~~~~~~~~~~i~~~i~~~PT~v~~k~Gk~v~~~~G~~  110 (122)
T TIGR01295        31 GRKTCPYCRKFSGTLSGVVAQTKAPIYYIDSENNGSFEMSSLNDLTAFRSRFGIPTSFMGTPTFVHITDGKQVSVRCGSS  110 (122)
T ss_pred             ECCCChhHHHHhHHHHHHHHhcCCcEEEEECCCccCcCcccHHHHHHHHHHcCCcccCCCCCEEEEEeCCeEEEEEeCCC
Confidence            4688999888777888888885532122222211     11223333332     345679999999884        35


Q ss_pred             CCHHHHHHHh
Q psy7060         142 ISIEEVDRIA  151 (160)
Q Consensus       142 is~eevd~i~  151 (160)
                      .+.+++..+.
T Consensus       111 ~~~~~l~~~~  120 (122)
T TIGR01295       111 TTAQELQDIA  120 (122)
T ss_pred             CCHHHHHHHh
Confidence            5677777663


No 253
>TIGR00550 nadA quinolinate synthetase complex, A subunit. This protein, termed NadA, plays a role in the synthesis of pyridine, a precursor to NAD. The quinolinate synthetase complex consists of A protein (this protein) and B protein. B protein converts L-aspartate to iminoaspartate, an unstable reaction product which in the absence of A protein is spontaneously hydrolyzed to form oxaloacetate. The A protein, NadA, converts iminoaspartate to quinolate.
Probab=35.47  E-value=61  Score=28.59  Aligned_cols=52  Identities=17%  Similarity=0.274  Sum_probs=37.0

Q ss_pred             HHHHh-hhhhhHHhhhcCcc--ccccCCCccc-CHHHHHHHHHHcCccceEEEeecCCChh
Q psy7060          61 ILHEY-KIFNAEQKKAGGIA--FNSTCPLTQV-NEKLVQLILHEYKIFNAEVLFREDCNAD  117 (160)
Q Consensus        61 ~l~~y-ki~n~~~~~~~~~~--~~~~~~~~~~-~e~~V~~IL~EYkI~NA~V~ired~t~D  117 (160)
                      ||++| ||.|-+++.   +.  .++.||+-+. +.+.++.+-++|  -||.|+..-+++.+
T Consensus        63 fMae~a~~l~p~k~v---ilp~~~a~C~~a~~~~~~~i~~lk~~~--Pda~vvah~n~~ae  118 (310)
T TIGR00550        63 FMGETAKILNPEKTV---LMPDLGAGCSMADMCPPEEFKKLKERH--PDAFVVTYVNTTAE  118 (310)
T ss_pred             hHHHHHHHhCCCCEE---EccCCCCCCccccccCHHHHHHHHHHC--CCCEEEEECCCCHH
Confidence            66666 344666432   33  5889999765 889999988888  57888777777765


No 254
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1. S100A1 is a calcium-binding protein belonging to a large S100 vertebrate-specific protein family within the EF-hand superfamily of calcium-binding proteins. Note that the S-100 hierarchy, to which this S-100A1 group belongs, contains only S-100 EF-hand domains, other EF-hands have been modeled separately. As is the case with many other members of S100 protein family, S100A1 is implicated in intracellular and extracellular regulatory activities, including interaction with myosin-associated twitchin kinase, actin-capping protein CapZ, sinapsin I, and tubulin. Structural data suggests that S100A1 proteins exist within cells as antiparallel homodimers, while heterodimers  with S100A4 and S100B also has been reported. Upon binding calcium S100A1 changes conformation to expose a hydrophobic cleft which is the interaction site of S100A1 with its more that 20 known target  proteins.
Probab=35.43  E-value=42  Score=23.29  Aligned_cols=31  Identities=13%  Similarity=0.227  Sum_probs=19.8

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN  124 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~  124 (160)
                      .+++.++.+++++...+     .+.++.++++..+.
T Consensus        49 ~s~~~v~~i~~~~D~d~-----~G~I~f~eF~~l~~   79 (92)
T cd05025          49 KDADAVDKIMKELDENG-----DGEVDFQEFVVLVA   79 (92)
T ss_pred             CCHHHHHHHHHHHCCCC-----CCcCcHHHHHHHHH
Confidence            36677777777765533     34577777776654


No 255
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=34.85  E-value=22  Score=30.70  Aligned_cols=24  Identities=25%  Similarity=0.236  Sum_probs=17.1

Q ss_pred             HHHHHhcCcceeceEEEEecCCCCCH
Q psy7060         119 LIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       119 liDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      +...+...  =+|.++|+||+|+.+.
T Consensus        99 i~~~l~~~--~~piilVvNK~D~~~~  122 (429)
T TIGR03594        99 IAKWLRKS--GKPVILVANKIDGKKE  122 (429)
T ss_pred             HHHHHHHh--CCCEEEEEECccCCcc
Confidence            44555432  3699999999998764


No 256
>KOG2485|consensus
Probab=34.82  E-value=88  Score=28.71  Aligned_cols=55  Identities=20%  Similarity=0.259  Sum_probs=38.4

Q ss_pred             HHHHHHHHHHcCccceEEEeecC----CChhHHHHHHhcCcceeceEEEEecCCCCCHHHHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFRED----CNADELIDVINANRVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ired----~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd  148 (160)
                      .+.+++|=+.-+..++.|-+|.-    -+..++.+-...   =.|-|+||||.|+.+.-+..
T Consensus        34 akalr~i~~~l~~~D~iiEvrDaRiPLssrn~~~~~~~~---~k~riiVlNK~DLad~~~~k   92 (335)
T KOG2485|consen   34 AKALRAIQNRLPLVDCIIEVRDARIPLSSRNELFQDFLP---PKPRIIVLNKMDLADPKEQK   92 (335)
T ss_pred             HHHHHHHHhhcccccEEEEeeccccCCccccHHHHHhcC---CCceEEEEecccccCchhhh
Confidence            45677887888889999999873    223333333333   57999999999999854433


No 257
>COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only]
Probab=34.79  E-value=42  Score=25.87  Aligned_cols=39  Identities=26%  Similarity=0.410  Sum_probs=31.4

Q ss_pred             cccCCCcccCHHHHHHHHHHcC-ccceEEEeecC--CChhHH
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYK-IFNAEVLFRED--CNADEL  119 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYk-I~NA~V~ired--~t~Ddl  119 (160)
                      ++.||++.+=...|++.|.+.. +.+++|.+.-+  -|.|.+
T Consensus        59 ~~gCP~~~~i~~~v~~al~~~~~v~~v~V~l~~~p~Wt~~~m  100 (111)
T COG2151          59 SPGCPLAEVIADQVEAALEEIPGVEDVEVELTLSPPWTPDRM  100 (111)
T ss_pred             CCCCCccHHHHHHHHHHHHhcCCcceEEEEEEEcCCCchhhc
Confidence            3789999999999999999997 88888877655  444443


No 258
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=34.73  E-value=28  Score=27.68  Aligned_cols=15  Identities=27%  Similarity=0.375  Sum_probs=13.0

Q ss_pred             ceeceEEEEecCCCC
Q psy7060         128 VYLPCIYAYNKIDQI  142 (160)
Q Consensus       128 vY~P~iyv~NKiD~i  142 (160)
                      -.+|.++|.||+|+.
T Consensus       116 ~~~piilvgNK~Dl~  130 (219)
T PLN03071        116 ENIPIVLCGNKVDVK  130 (219)
T ss_pred             CCCcEEEEEEchhhh
Confidence            358999999999985


No 259
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.
Probab=34.52  E-value=30  Score=31.40  Aligned_cols=16  Identities=38%  Similarity=0.295  Sum_probs=13.2

Q ss_pred             eeceEEEEecCCCCCH
Q psy7060         129 YLPCIYAYNKIDQISI  144 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~  144 (160)
                      -.|.|+|.||+|+...
T Consensus       310 ~~piIlV~NK~Dl~~~  325 (442)
T TIGR00450       310 KKPFILVLNKIDLKIN  325 (442)
T ss_pred             CCCEEEEEECccCCCc
Confidence            3699999999998643


No 260
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=33.56  E-value=35  Score=27.14  Aligned_cols=44  Identities=23%  Similarity=0.197  Sum_probs=25.5

Q ss_pred             EEEeecCCChhH-HHHHHhcCcceeceEEEEecCCCC-CHHHHHHH
Q psy7060         107 EVLFREDCNADE-LIDVINANRVYLPCIYAYNKIDQI-SIEEVDRI  150 (160)
Q Consensus       107 ~V~ired~t~Dd-liDvi~~nrvY~P~iyv~NKiD~i-s~eevd~i  150 (160)
                      .|.+--|+|-.. +.--=+++-.=.|+|=|++|+|+. +.+.+++.
T Consensus        66 ~V~ll~dat~~~~~~pP~fa~~f~~pvIGVITK~Dl~~~~~~i~~a  111 (143)
T PF10662_consen   66 VVLLLQDATEPRSVFPPGFASMFNKPVIGVITKIDLPSDDANIERA  111 (143)
T ss_pred             EEEEEecCCCCCccCCchhhcccCCCEEEEEECccCccchhhHHHH
Confidence            344445555432 222222222336999999999999 66666654


No 261
>TIGR00484 EF-G translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.
Probab=33.30  E-value=43  Score=31.81  Aligned_cols=24  Identities=29%  Similarity=0.322  Sum_probs=16.9

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCC
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      +++..+.  +.-+|+|+++||+|+..
T Consensus       118 ~~~~~~~--~~~~p~ivviNK~D~~~  141 (689)
T TIGR00484       118 TVWRQAN--RYEVPRIAFVNKMDKTG  141 (689)
T ss_pred             HHHHHHH--HcCCCEEEEEECCCCCC
Confidence            3444433  33479999999999984


No 262
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=33.21  E-value=1.5e+02  Score=28.37  Aligned_cols=54  Identities=20%  Similarity=0.239  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHcCccceEEEee-cC--CChh--HHHHHHhcCcceec-eEEEEecCCCCCHHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFR-ED--CNAD--ELIDVINANRVYLP-CIYAYNKIDQISIEE  146 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ir-ed--~t~D--dliDvi~~nrvY~P-~iyv~NKiD~is~ee  146 (160)
                      ++.++..+..+.--.+.+++- -+  +..+  +.++.+....  +| .|+|+||+|+.+.+.
T Consensus        62 e~fi~~m~~g~~~~D~~lLVVda~eg~~~qT~ehl~il~~lg--i~~iIVVlNKiDlv~~~~  121 (614)
T PRK10512         62 EKFLSNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLTG--NPMLTVALTKADRVDEAR  121 (614)
T ss_pred             HHHHHHHHHHhhcCCEEEEEEECCCCCcHHHHHHHHHHHHcC--CCeEEEEEECCccCCHHH
Confidence            666777776654444333332 11  1122  3344443222  46 479999999987543


No 263
>PF12307 DUF3631:  Protein of unknown function (DUF3631);  InterPro: IPR022081  This domain is found in uncharacterised proteins and in tripartite motif containing (TRIM) protein 41. This protein functions as an E3 ligase that catalyzes the ubiquitin-mediated degradation of protein kinase C []. 
Probab=32.97  E-value=65  Score=26.87  Aligned_cols=36  Identities=17%  Similarity=0.348  Sum_probs=29.5

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecC----CChhHHHHHHh
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFRED----CNADELIDVIN  124 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired----~t~DdliDvi~  124 (160)
                      +|...+...|++|+|....|.|-+.    .+.++|.|+..
T Consensus       143 Lt~r~La~~L~~ygI~s~~ir~~~~~~KGY~r~~f~DAw~  182 (184)
T PF12307_consen  143 LTPRQLAKLLKEYGIRSKNIRFGGSQAKGYRREDFADAWA  182 (184)
T ss_pred             CCHHHHHHHHHHCCCCCCceeeCCCCCCceeHHHHHHHHH
Confidence            5688899999999999999998443    46788888764


No 264
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=32.65  E-value=35  Score=28.66  Aligned_cols=14  Identities=36%  Similarity=0.527  Sum_probs=12.5

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.++++||+|+..
T Consensus       124 ~P~iivvNK~D~~~  137 (267)
T cd04169         124 IPIITFINKLDREG  137 (267)
T ss_pred             CCEEEEEECCccCC
Confidence            69999999999864


No 265
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri
Probab=32.63  E-value=46  Score=21.05  Aligned_cols=53  Identities=19%  Similarity=0.244  Sum_probs=26.6

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhc-CcceeceEEEEec
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINA-NRVYLPCIYAYNK  138 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~-nrvY~P~iyv~NK  138 (160)
                      .++||.-+.-...++.+-.++    ..+.+.. +++|+.-+.... +...+|++++-+|
T Consensus         8 ~~~C~~C~~~~~~l~~l~~~~----~~i~~~~-id~~~~~~l~~~~~i~~vPti~i~~~   61 (67)
T cd02973           8 SPTCPYCPDAVQAANRIAALN----PNISAEM-IDAAEFPDLADEYGVMSVPAIVINGK   61 (67)
T ss_pred             CCCCCCcHHHHHHHHHHHHhC----CceEEEE-EEcccCHhHHHHcCCcccCEEEECCE
Confidence            467887755555555444333    2233322 233333333332 4456899987554


No 266
>PLN00043 elongation factor 1-alpha; Provisional
Probab=32.49  E-value=48  Score=30.14  Aligned_cols=52  Identities=13%  Similarity=0.156  Sum_probs=29.0

Q ss_pred             CHHHHHHHHHHcCccceEEEeecCCCh----------hHHHHHHh-cCcceece-EEEEecCCCC
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFREDCNA----------DELIDVIN-ANRVYLPC-IYAYNKIDQI  142 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ired~t~----------DdliDvi~-~nrvY~P~-iyv~NKiD~i  142 (160)
                      -++-++.....+..-++-+++-. ++-          .+....+. .+..=+|. |+++||+|+.
T Consensus        95 h~df~~~~~~g~~~aD~aIlVVd-a~~G~~e~g~~~~~qT~eh~~~~~~~gi~~iIV~vNKmD~~  158 (447)
T PLN00043         95 HRDFIKNMITGTSQADCAVLIID-STTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDAT  158 (447)
T ss_pred             HHHHHHHHHhhhhhccEEEEEEE-cccCceecccCCCchHHHHHHHHHHcCCCcEEEEEEcccCC
Confidence            46677777776665554444422 221          23333322 33444665 7789999986


No 267
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou
Probab=32.39  E-value=72  Score=19.52  Aligned_cols=51  Identities=25%  Similarity=0.309  Sum_probs=29.9

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCC-hhHHHHHHhcCcceeceEEEEe
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCN-ADELIDVINANRVYLPCIYAYN  137 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t-~DdliDvi~~nrvY~P~iyv~N  137 (160)
                      .++||-..    .++.+|.+.++.-..+.+..+-. .+++. .+++ ..-+|+|+.-+
T Consensus         7 ~~~c~~c~----~~~~~l~~~~i~~~~~~i~~~~~~~~~~~-~~~~-~~~vP~i~~~~   58 (73)
T cd02976           7 KPDCPYCK----ATKRFLDERGIPFEEVDVDEDPEALEELK-KLNG-YRSVPVVVIGD   58 (73)
T ss_pred             CCCChhHH----HHHHHHHHCCCCeEEEeCCCCHHHHHHHH-HHcC-CcccCEEEECC
Confidence            34566543    47888999887666666654322 22222 2333 45679998755


No 268
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=32.27  E-value=30  Score=28.25  Aligned_cols=25  Identities=24%  Similarity=0.359  Sum_probs=17.2

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCCH
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQISI  144 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is~  144 (160)
                      .+.+.+...+  +|.++++||+|....
T Consensus       107 ~~~~~~~~~~--~p~iivvNK~D~~~~  131 (268)
T cd04170         107 KLWEFADEAG--IPRIIFINKMDRERA  131 (268)
T ss_pred             HHHHHHHHcC--CCEEEEEECCccCCC
Confidence            3444444333  699999999998853


No 269
>PF07927 YcfA:  YcfA-like protein;  InterPro: IPR012933 This entry represents UPF0395, which contains viral, archaeal and bacterial proteins. It includes YncN of Escherichia coli K12. Most of these proteins are hypothetical proteins of unknown function. ; GO: 0016788 hydrolase activity, acting on ester bonds; PDB: 1WHZ_A.
Probab=32.15  E-value=1.3e+02  Score=18.91  Aligned_cols=51  Identities=22%  Similarity=0.185  Sum_probs=26.1

Q ss_pred             HHHHHHHhcCceeccCCCCeEEEEecCcce-EEecccCCchhhHHHHHHHHH
Q psy7060          13 LLEKELESVGIRLNKKKPNIYFKQKKAGGI-AFNSTCPLTQVNEKLVQLILH   63 (160)
Q Consensus        13 ~le~ELe~~GIrLnkk~p~I~ikkk~~GGI-~i~~t~~lt~~~~~~v~~~l~   63 (160)
                      -+.+.|+..|..+.+.+++=.+-....++. .+...-+-.++..-+|+.||.
T Consensus         3 el~k~L~~~G~~~~r~~GSH~~~~~~~~~~~~~vp~h~~~ei~~~~~k~ilk   54 (56)
T PF07927_consen    3 ELIKLLEKAGFEEVRQKGSHHIFRHPGGRKIVTVPPHPGKEIKPGTVKQILK   54 (56)
T ss_dssp             HHHHHHHHTT-EEEEEETTEEEEE-TTS-E-EEEE-SSS-S--HHHHHHHHH
T ss_pred             HHHHHHHHCCCEEecCCCCEEEEEeCCCCcceEeCCCCccccCHHHHHHHHH
Confidence            477889999999887666655555555553 222211222344555555553


No 270
>PRK12735 elongation factor Tu; Reviewed
Probab=32.11  E-value=39  Score=29.79  Aligned_cols=25  Identities=28%  Similarity=0.248  Sum_probs=16.2

Q ss_pred             HHHHHHhcCcceeceE-EEEecCCCCCH
Q psy7060         118 ELIDVINANRVYLPCI-YAYNKIDQISI  144 (160)
Q Consensus       118 dliDvi~~nrvY~P~i-yv~NKiD~is~  144 (160)
                      +.+..+....  +|.| +|+||+|+.+.
T Consensus       118 e~l~~~~~~g--i~~iivvvNK~Dl~~~  143 (396)
T PRK12735        118 EHILLARQVG--VPYIVVFLNKCDMVDD  143 (396)
T ss_pred             HHHHHHHHcC--CCeEEEEEEecCCcch
Confidence            3444444333  6877 47999999854


No 271
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=32.08  E-value=35  Score=30.45  Aligned_cols=16  Identities=38%  Similarity=0.420  Sum_probs=13.0

Q ss_pred             ceEEEEecCCCCCHHH
Q psy7060         131 PCIYAYNKIDQISIEE  146 (160)
Q Consensus       131 P~iyv~NKiD~is~ee  146 (160)
                      |.++|+||+|+.+.++
T Consensus       141 ~iiVVlNK~Dl~~~~~  156 (411)
T PRK04000        141 NIVIVQNKIDLVSKER  156 (411)
T ss_pred             cEEEEEEeeccccchh
Confidence            6899999999987543


No 272
>cd06538 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins. The CIDE-N (cell death-inducing DFF45-like effector, N-terminal) domain is found in the FSP27/CIDE-C protein, which has been identified as a n adipocyte lipid droplet protein that negatively regulates lipolysis and promotes triglyceride accumulation. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C). Based on sequence similarity with DFF40 and DFF45, CIDE proteins were initially characterized as mitochondrial activators of apoptosis. The CIDE-N domain of FSP27 is sufficient to increase apoptosis in vitro when overexpressed.
Probab=31.99  E-value=34  Score=25.26  Aligned_cols=58  Identities=22%  Similarity=0.450  Sum_probs=43.3

Q ss_pred             hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccc-eEEEeecC---CChhHHHHHHhcCcce
Q psy7060          65 YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFN-AEVLFRED---CNADELIDVINANRVY  129 (160)
Q Consensus        65 yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~N-A~V~ired---~t~DdliDvi~~nrvY  129 (160)
                      |||.|.+....=||+-+|-       +++..+...-+.+.. ..+...||   +.-+|.-..+..|-++
T Consensus         5 ~kV~~~~rs~k~GV~A~sL-------~eL~~K~~~~l~l~~~~~lvL~eDGT~Vd~EeyF~tLp~nt~l   66 (79)
T cd06538           5 FRVSNADRSLRKGIMADSL-------EDLLNKVLDALLLDCISSLVLDEDGTGVDTEEFFQALADNTVF   66 (79)
T ss_pred             EEEecCCCceeEeEEcCCH-------HHHHHHHHHHcCCCCccEEEEecCCcEEccHHHHhhCCCCcEE
Confidence            7888888888888888774       778888888899943 23666777   4457777777777665


No 273
>COG5324 Uncharacterized conserved protein [Function unknown]
Probab=31.98  E-value=34  Score=33.85  Aligned_cols=74  Identities=22%  Similarity=0.262  Sum_probs=53.6

Q ss_pred             HHHHHHHhhhhhhHHhhhcCccc-cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceE
Q psy7060          58 VQLILHEYKIFNAEQKKAGGIAF-NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCI  133 (160)
Q Consensus        58 v~~~l~~yki~n~~~~~~~~~~~-~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~i  133 (160)
                      ..-|+..||-|||+.|.-.-.-- ----|+ ..+.+-.++|+++++ .|--.++-+|.+-||..-+++-.--|.|+.
T Consensus       502 mn~f~k~ykp~~~~~~~d~~~d~~ield~~-~~sl~nar~i~n~~~-k~~p~lip~~p~ddd~~~a~~~a~ey~pt~  576 (758)
T COG5324         502 MNTFYKQYKPFDAGNKHDANYDDIIELDPL-IGSLENARRIVNYFK-KNIPELIPNDPSDDDYAAALNYAVEYVPTY  576 (758)
T ss_pred             HHHHHHhcCCCCCCCCccccccceeecccc-cchhhhHHHHHHHHH-hhCccccCCCCCchHHHHHHhhhhhcCchh
Confidence            34588999999998875432211 011121 234567899999886 466778999999999999999988999974


No 274
>PTZ00062 glutaredoxin; Provisional
Probab=31.74  E-value=1.1e+02  Score=25.39  Aligned_cols=66  Identities=14%  Similarity=0.136  Sum_probs=41.7

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      -.++||..    ..++.+|++++|.=.++-+.+|-.+.+-.....|-+. .|.||+=.+. .-..+++.++.
T Consensus       124 ~~p~C~~C----~~~k~~L~~~~i~y~~~DI~~d~~~~~~l~~~sg~~T-vPqVfI~G~~-IGG~d~l~~l~  189 (204)
T PTZ00062        124 TFPFCRFS----NAVVNMLNSSGVKYETYNIFEDPDLREELKVYSNWPT-YPQLYVNGEL-IGGHDIIKELY  189 (204)
T ss_pred             CCCCChhH----HHHHHHHHHcCCCEEEEEcCCCHHHHHHHHHHhCCCC-CCeEEECCEE-EcChHHHHHHH
Confidence            33467764    3588999999998777777766444444444555555 4999976553 12445555553


No 275
>PF06183 DinI:  DinI-like family;  InterPro: IPR010391 This family of short proteins includes DNA-damage-inducible protein I (DinI) and related proteins. The SOS response, a set of cellular phenomena exhibited by eubacteria, is initiated by various causes that include DNA damage-induced replication arrest, and is positively regulated by the co- protease activity of RecA. Escherichia coli DinI, a LexA-regulated SOS gene product, shuts off the initiation of the SOS response when overexpressed in vivo. Biochemical and genetic studies indicated that DinI physically interacts with RecA to inhibit its co-protease activity []. The structure of DinI is known [].; PDB: 1GHH_A.
Probab=31.05  E-value=80  Score=22.06  Aligned_cols=49  Identities=22%  Similarity=0.354  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHhcCceeccCCCCeEEEEecC--cceEEecccCCchhhHHHHHHHHHH
Q psy7060          10 QRGLLEKELESVGIRLNKKKPNIYFKQKKA--GGIAFNSTCPLTQVNEKLVQLILHE   64 (160)
Q Consensus        10 q~~~le~ELe~~GIrLnkk~p~I~ikkk~~--GGI~i~~t~~lt~~~~~~v~~~l~~   64 (160)
                      -+..|+.||.   =||.+..|+..++-+.+  -|+++.++..-   +-+.+..+|.+
T Consensus         5 a~~AL~~EL~---kRl~~~yPd~~v~Vr~~s~~~l~v~g~~~~---~k~~i~~iLqe   55 (65)
T PF06183_consen    5 ALEALESELT---KRLHRQYPDAEVRVRPGSANGLSVSGGKKD---DKERIEEILQE   55 (65)
T ss_dssp             HHHHHHHHHH---HHHHHH-SS-EEEEEEESS-EEEEES--HH---HHHHHHHHHHH
T ss_pred             HHHHHHHHHH---HHHHHHCCCceEeeeecccCccccCCcCch---HHHHHHHHHHH
Confidence            3678888888   47888888766655555  47777764321   23445555443


No 276
>PLN00023 GTP-binding protein; Provisional
Probab=30.85  E-value=53  Score=29.66  Aligned_cols=15  Identities=33%  Similarity=0.279  Sum_probs=13.0

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      -+|+++|.||+|+..
T Consensus       151 ~ipIILVGNK~DL~~  165 (334)
T PLN00023        151 PVPYIVIGNKADIAP  165 (334)
T ss_pred             CCcEEEEEECccccc
Confidence            479999999999854


No 277
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed
Probab=29.95  E-value=29  Score=32.18  Aligned_cols=32  Identities=28%  Similarity=0.469  Sum_probs=26.9

Q ss_pred             HHhhhcCccccccCCCccc-CHHHHHHHHHHcC
Q psy7060          71 EQKKAGGIAFNSTCPLTQV-NEKLVQLILHEYK  102 (160)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~-~e~~V~~IL~EYk  102 (160)
                      .-=+.||+.+=|||-++.- ||+.|..+|++|.
T Consensus       230 ~~LkpGG~LVYSTCT~~~eENE~vV~~~L~~~~  262 (470)
T PRK11933        230 HALKPGGTLVYSTCTLNREENQAVCLWLKETYP  262 (470)
T ss_pred             HHcCCCcEEEEECCCCCHHHHHHHHHHHHHHCC
Confidence            3446899999999998876 8889999999874


No 278
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=29.94  E-value=95  Score=23.56  Aligned_cols=55  Identities=22%  Similarity=0.199  Sum_probs=34.4

Q ss_pred             CHHHHHHHHHHcCccceEEEeecCCCh----hHHHH----HHhcCc-ceeceEEEEecCCCCCH
Q psy7060          90 NEKLVQLILHEYKIFNAEVLFREDCNA----DELID----VINANR-VYLPCIYAYNKIDQISI  144 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~ired~t~----DdliD----vi~~nr-vY~P~iyv~NKiD~is~  144 (160)
                      +.+..+.+...|-..-.-+++--|.+.    ++++.    .+.... -..|.+.+.||+|+.+.
T Consensus        63 gq~~~~~~~~~y~~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~iilv~nK~Dl~~~  126 (219)
T COG1100          63 GQEEYRSLRPEYYRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVPILLVGNKIDLFDE  126 (219)
T ss_pred             CHHHHHHHHHHHhcCCCEEEEEEecccchhhhHHHHHHHHHHHHhCCCCceEEEEecccccccc
Confidence            678888899888444433333334433    33333    333333 36799999999999855


No 279
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH - GSH reductase - GSH - GRX domain of hybrid - PRX domain of hybrid - peroxide substrate.
Probab=29.91  E-value=1.5e+02  Score=19.21  Aligned_cols=52  Identities=17%  Similarity=0.341  Sum_probs=32.2

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEec
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNK  138 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NK  138 (160)
                      -++||.-    ..++++|+++++.=-++-+.++-..+++. .+ ..+..+|.|++=.+
T Consensus         8 ~~~Cp~C----~~ak~~L~~~~i~~~~~~v~~~~~~~~~~-~~-~g~~~vP~ifi~g~   59 (72)
T cd03029           8 KPGCPFC----ARAKAALQENGISYEEIPLGKDITGRSLR-AV-TGAMTVPQVFIDGE   59 (72)
T ss_pred             CCCCHHH----HHHHHHHHHcCCCcEEEECCCChhHHHHH-HH-hCCCCcCeEEECCE
Confidence            3567653    35789999998887666665544333222 11 35678899975444


No 280
>PRK11200 grxA glutaredoxin 1; Provisional
Probab=29.72  E-value=62  Score=21.89  Aligned_cols=65  Identities=11%  Similarity=0.108  Sum_probs=34.0

Q ss_pred             ccCCCcccCHHHHHHHHHH-----cCccceEEEeecCC-ChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          82 STCPLTQVNEKLVQLILHE-----YKIFNAEVLFREDC-NADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~E-----YkI~NA~V~ired~-t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      ++||.-.    .+++.|.+     -++.=..+-+.++- +.+++..........+|.|++=.+. .-.-+++..+.
T Consensus         9 ~~C~~C~----~a~~~L~~l~~~~~~i~~~~idi~~~~~~~~el~~~~~~~~~~vP~ifi~g~~-igg~~~~~~~~   79 (85)
T PRK11200          9 PGCPYCV----RAKELAEKLSEERDDFDYRYVDIHAEGISKADLEKTVGKPVETVPQIFVDQKH-IGGCTDFEAYV   79 (85)
T ss_pred             CCChhHH----HHHHHHHhhcccccCCcEEEEECCCChHHHHHHHHHHCCCCCcCCEEEECCEE-EcCHHHHHHHH
Confidence            4677654    45555555     35555556565543 2445544332223578999864433 22445555543


No 281
>PF13590 DUF4136:  Domain of unknown function (DUF4136)
Probab=29.69  E-value=77  Score=23.05  Aligned_cols=25  Identities=20%  Similarity=0.367  Sum_probs=21.8

Q ss_pred             HHHHHHHHHhcCceeccCCCCeEEE
Q psy7060          11 RGLLEKELESVGIRLNKKKPNIYFK   35 (160)
Q Consensus        11 ~~~le~ELe~~GIrLnkk~p~I~ik   35 (160)
                      +..++++|++.|.+.....|++.|.
T Consensus        41 ~~~v~~~L~~~G~~~~~~~aDl~V~   65 (151)
T PF13590_consen   41 QDAVEQELAAKGYRRVPENADLLVS   65 (151)
T ss_pred             HHHHHHHHHHCCCeecccCCCEEEE
Confidence            4688999999999999889998874


No 282
>PF00462 Glutaredoxin:  Glutaredoxin;  InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system [].  Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.  This entry represents Glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis; PDB: 1QFN_A 1GRX_A 1EGO_A 1EGR_A 3RHC_A 3RHB_A 3IPZ_A 1NHO_A 3GX8_A 3D5J_A ....
Probab=29.63  E-value=1.1e+02  Score=19.25  Aligned_cols=49  Identities=27%  Similarity=0.318  Sum_probs=31.8

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCC-ChhHHHHHHhcCcceeceEEEE
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDC-NADELIDVINANRVYLPCIYAY  136 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~-t~DdliDvi~~nrvY~P~iyv~  136 (160)
                      .+||-.    ..++++|+++++.=.++-+..+- ..++|.+..  ...-.|+|++=
T Consensus         7 ~~C~~C----~~~~~~L~~~~i~y~~~dv~~~~~~~~~l~~~~--g~~~~P~v~i~   56 (60)
T PF00462_consen    7 PGCPYC----KKAKEFLDEKGIPYEEVDVDEDEEAREELKELS--GVRTVPQVFID   56 (60)
T ss_dssp             TTSHHH----HHHHHHHHHTTBEEEEEEGGGSHHHHHHHHHHH--SSSSSSEEEET
T ss_pred             CCCcCH----HHHHHHHHHcCCeeeEcccccchhHHHHHHHHc--CCCccCEEEEC
Confidence            456533    45889999999887777777763 333333333  55566999873


No 283
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase.
Probab=29.20  E-value=33  Score=28.47  Aligned_cols=32  Identities=34%  Similarity=0.508  Sum_probs=27.1

Q ss_pred             HhhhcCccccccCCCccc-CHHHHHHHHHHcCc
Q psy7060          72 QKKAGGIAFNSTCPLTQV-NEKLVQLILHEYKI  103 (160)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~-~e~~V~~IL~EYkI  103 (160)
                      --+.||..+=|||.++.- ||+.|+.+|++|.=
T Consensus       188 ~lkpgG~lvYstcs~~~~Ene~vv~~~l~~~~~  220 (264)
T TIGR00446       188 ALKPGGVLVYSTCSLEPEENEAVVDYLLEKRPD  220 (264)
T ss_pred             hcCCCCEEEEEeCCCChHHHHHHHHHHHHhCCC
Confidence            346799999999999886 68899999998753


No 284
>PRK10824 glutaredoxin-4; Provisional
Probab=29.07  E-value=1.4e+02  Score=22.71  Aligned_cols=50  Identities=14%  Similarity=0.139  Sum_probs=34.2

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh--cCcceeceEEEEec
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN--ANRVYLPCIYAYNK  138 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~--~nrvY~P~iyv~NK  138 (160)
                      ++||..    ..++++|.++++.-..+-+.+|   .++.+.+.  .++--+|.|++=.|
T Consensus        28 p~Cpyc----~~ak~lL~~~~i~~~~idi~~d---~~~~~~l~~~sg~~TVPQIFI~G~   79 (115)
T PRK10824         28 PSCGFS----AQAVQALSACGERFAYVDILQN---PDIRAELPKYANWPTFPQLWVDGE   79 (115)
T ss_pred             CCCchH----HHHHHHHHHcCCCceEEEecCC---HHHHHHHHHHhCCCCCCeEEECCE
Confidence            468874    4688999999988877766655   24444443  25566799998554


No 285
>PRK09435 membrane ATPase/protein kinase; Provisional
Probab=29.02  E-value=37  Score=30.11  Aligned_cols=31  Identities=23%  Similarity=0.158  Sum_probs=19.5

Q ss_pred             CChhHHHHHHhcCcceeceEEEEecCCCCCHH
Q psy7060         114 CNADELIDVINANRVYLPCIYAYNKIDQISIE  145 (160)
Q Consensus       114 ~t~DdliDvi~~nrvY~P~iyv~NKiD~is~e  145 (160)
                      .+-|++.....+. .=+..|+|+||+|+.+.+
T Consensus       180 ~~gd~iq~~k~gi-~E~aDIiVVNKaDl~~~~  210 (332)
T PRK09435        180 GAGDELQGIKKGI-MELADLIVINKADGDNKT  210 (332)
T ss_pred             CchHHHHHHHhhh-hhhhheEEeehhcccchh
Confidence            5556665544322 223459999999998643


No 286
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=28.69  E-value=78  Score=24.30  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=10.0

Q ss_pred             eceEEEEecCCCC
Q psy7060         130 LPCIYAYNKIDQI  142 (160)
Q Consensus       130 ~P~iyv~NKiD~i  142 (160)
                      .| |.|.||+|+.
T Consensus       106 ~p-ilVgnK~Dl~  117 (182)
T cd04128         106 IP-ILVGTKYDLF  117 (182)
T ss_pred             CE-EEEEEchhcc
Confidence            56 7889999985


No 287
>PF02492 cobW:  CobW/HypB/UreG, nucleotide-binding domain;  InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase []. In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase [].  There are at least two distinct cobalamin biosynthetic pathways in bacteria []:  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway []; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis []; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii subsp. shermanii.   Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) []. There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. CobW proteins are generally found proximal to the trimeric cobaltochelatase subunit CobN, which is essential for vitamin B12 (cobalamin) biosynthesis []. They contain a P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. CobW might be involved in cobalt reduction leading to cobalt(I) corrinoids. This entry represents CobW-like proteins, including P47K (P31521 from SWISSPROT), a Pseudomonas chlororaphis protein needed for nitrile hydratase expression [], and urease accessory protein UreG, which acts as a chaperone in the activation of urease upon insertion of nickel into the active site [].; PDB: 2WSM_B 1NIJ_A 2HF9_A 2HF8_B.
Probab=28.50  E-value=25  Score=27.16  Aligned_cols=19  Identities=37%  Similarity=0.593  Sum_probs=12.9

Q ss_pred             eEEEEecCCCCCHHH-HHHH
Q psy7060         132 CIYAYNKIDQISIEE-VDRI  150 (160)
Q Consensus       132 ~iyv~NKiD~is~ee-vd~i  150 (160)
                      -++++||+|+++.++ ++++
T Consensus       144 DvIvlnK~D~~~~~~~i~~~  163 (178)
T PF02492_consen  144 DVIVLNKIDLVSDEQKIERV  163 (178)
T ss_dssp             SEEEEE-GGGHHHH--HHHH
T ss_pred             CEEEEeccccCChhhHHHHH
Confidence            368999999998873 3554


No 288
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=28.49  E-value=1.1e+02  Score=25.74  Aligned_cols=23  Identities=4%  Similarity=0.017  Sum_probs=19.5

Q ss_pred             HhcCcceeceEEEEecCCCCCHH
Q psy7060         123 INANRVYLPCIYAYNKIDQISIE  145 (160)
Q Consensus       123 i~~nrvY~P~iyv~NKiD~is~e  145 (160)
                      .+|..+|.++|+|.+|+|...++
T Consensus       143 ~fG~~i~~~~ivV~T~~d~~~p~  165 (249)
T cd01853         143 SFGPSIWRNAIVVLTHAASSPPD  165 (249)
T ss_pred             HhChhhHhCEEEEEeCCccCCCC
Confidence            36789999999999999998554


No 289
>KOG1490|consensus
Probab=28.48  E-value=24  Score=34.53  Aligned_cols=62  Identities=29%  Similarity=0.338  Sum_probs=37.8

Q ss_pred             CCCcccCHHHHHHHHHHcCccceEEEee---cCC--ChhHH------HHHHhcCcceeceEEEEecCCCCCHHHHH
Q psy7060          84 CPLTQVNEKLVQLILHEYKIFNAEVLFR---EDC--NADEL------IDVINANRVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus        84 ~~~~~~~e~~V~~IL~EYkI~NA~V~ir---ed~--t~Ddl------iDvi~~nrvY~P~iyv~NKiD~is~eevd  148 (160)
                      -|+.+.|.-+.+.|-.=--+..|..+|-   |.|  |+.+=      |.-+++|+   |.|.|+||+|...+|.++
T Consensus       228 ~plEdrN~IEmqsITALAHLraaVLYfmDLSe~CGySva~QvkLfhsIKpLFaNK---~~IlvlNK~D~m~~edL~  300 (620)
T KOG1490|consen  228 RPEEDRNIIEMQIITALAHLRSAVLYFMDLSEMCGYSVAAQVKLYHSIKPLFANK---VTILVLNKIDAMRPEDLD  300 (620)
T ss_pred             cchhhhhHHHHHHHHHHHHhhhhheeeeechhhhCCCHHHHHHHHHHhHHHhcCC---ceEEEeecccccCccccC
Confidence            4666666656666544444556666553   233  33332      44566775   789999999999765543


No 290
>PRK00007 elongation factor G; Reviewed
Probab=28.25  E-value=58  Score=31.07  Aligned_cols=24  Identities=21%  Similarity=0.238  Sum_probs=17.1

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCCC
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQIS  143 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~is  143 (160)
                      .+++.+..  .-+|+|+++||+|...
T Consensus       118 ~~~~~~~~--~~~p~iv~vNK~D~~~  141 (693)
T PRK00007        118 TVWRQADK--YKVPRIAFVNKMDRTG  141 (693)
T ss_pred             HHHHHHHH--cCCCEEEEEECCCCCC
Confidence            34444443  3379999999999984


No 291
>PF04320 DUF469:  Protein with unknown function (DUF469);  InterPro: IPR007416 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases.
Probab=28.16  E-value=1.8e+02  Score=22.33  Aligned_cols=38  Identities=21%  Similarity=0.315  Sum_probs=28.5

Q ss_pred             CCChhHHHHHHhcCccee--------ceEEEEecCCCCCHHHHHHH
Q psy7060         113 DCNADELIDVINANRVYL--------PCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       113 d~t~DdliDvi~~nrvY~--------P~iyv~NKiD~is~eevd~i  150 (160)
                      |..+|++||+|++|-...        -.+++..|+...+.|.-..+
T Consensus        33 D~~~D~fId~Ie~~gL~~~Ggg~~~~eG~vc~~~~gs~tee~R~~v   78 (101)
T PF04320_consen   33 DAFVDAFIDVIEPNGLAFGGGGYEQWEGFVCLQRYGSCTEEDRAAV   78 (101)
T ss_pred             HHHHHHHHHHHHhCCCEEecCCccCEeEEEEeccCCCCCHHHHHHH
Confidence            456799999999887653        36777778888887766554


No 292
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism]
Probab=28.11  E-value=35  Score=30.94  Aligned_cols=53  Identities=32%  Similarity=0.337  Sum_probs=35.1

Q ss_pred             hcCccccccCCCcccCHHHHH-HHHHHcCccce-----------EEEeecCCChhHHHHHHhcCc
Q psy7060          75 AGGIAFNSTCPLTQVNEKLVQ-LILHEYKIFNA-----------EVLFREDCNADELIDVINANR  127 (160)
Q Consensus        75 ~~~~~~~~~~~~~~~~e~~V~-~IL~EYkI~NA-----------~V~ired~t~DdliDvi~~nr  127 (160)
                      +-|+.++--.=+|.=-.+.+. .||..|.++|.           |++.|.+||+++|++-|..=|
T Consensus        98 ~~g~kv~lGiw~tdd~~~~~~~til~ay~~~~~~d~v~~v~VGnEal~r~~~tasql~~~I~~vr  162 (305)
T COG5309          98 ASGFKVFLGIWPTDDIHDAVEKTILSAYLPYNGWDDVTTVTVGNEALNRNDLTASQLIEYIDDVR  162 (305)
T ss_pred             hcCceEEEEEeeccchhhhHHHHHHHHHhccCCCCceEEEEechhhhhcCCCCHHHHHHHHHHHH
Confidence            344444433333322233333 89999998885           567899999999999887544


No 293
>PF05511 ATP-synt_F6:  Mitochondrial ATP synthase coupling factor 6;  InterPro: IPR008387 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit F6 (or coupling factor 6) found in the F0 complex of F-ATPases in mitochondria. The F6 subunit is part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In mitochondria, the peripheral stalk is composed of one copy each of subunits OSCP (oligomycin sensitivity conferral protein), F6, B and D []. There is no homologue of subunit F6 in bacterial or chloroplast F-ATPase, whose peripheral stalks are composed of one copy of the delta subunit (homologous to OSCP), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria.  More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o); PDB: 2WSS_V 2CLY_C 1VZS_A.
Probab=28.06  E-value=36  Score=26.16  Aligned_cols=48  Identities=15%  Similarity=0.238  Sum_probs=32.8

Q ss_pred             HHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccce
Q psy7060          59 QLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNA  106 (160)
Q Consensus        59 ~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA  106 (160)
                      |+||.|-+=++-.+|.+||=-..++--...-=++++.++-+.|+.-++
T Consensus        39 klFldKIREY~~Ksks~gGklVD~~Pe~~kel~eel~kL~r~YG~g~~   86 (99)
T PF05511_consen   39 KLFLDKIREYNQKSKSSGGKLVDAGPEYEKELNEELEKLARQYGGGSG   86 (99)
T ss_dssp             HHHHHHHHHHHHHHTTTSS-STT--THHHHHHHHHHHHHHHHHHSS--
T ss_pred             HHHHHHHHHHHHHhccCCCCCCCCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            799999999999999999966666544444334566677777876654


No 294
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=27.92  E-value=36  Score=27.38  Aligned_cols=15  Identities=33%  Similarity=0.476  Sum_probs=13.1

Q ss_pred             eceEEEEecCCCCCH
Q psy7060         130 LPCIYAYNKIDQISI  144 (160)
Q Consensus       130 ~P~iyv~NKiD~is~  144 (160)
                      +|.|+|-||.|+...
T Consensus       130 ~PiilVGnK~Dl~~~  144 (202)
T cd04102         130 IPLLVIGTKLDQIPE  144 (202)
T ss_pred             ceEEEEEECccchhh
Confidence            699999999998653


No 295
>KOG1122|consensus
Probab=27.83  E-value=68  Score=30.60  Aligned_cols=45  Identities=36%  Similarity=0.512  Sum_probs=35.2

Q ss_pred             HHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCc-hhhHHHHHHHHHHh
Q psy7060          10 QRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLT-QVNEKLVQLILHEY   65 (160)
Q Consensus        10 q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt-~~~~~~v~~~l~~y   65 (160)
                      .+.-|.++|-..+|-+-+.           |||-+-|||..+ .-||..|.-+|.||
T Consensus       345 ~~~~LQr~LllsAi~lv~~-----------GGvLVYSTCSI~~~ENE~vV~yaL~K~  390 (460)
T KOG1122|consen  345 RYAHLQRELLLSAIDLVKA-----------GGVLVYSTCSITVEENEAVVDYALKKR  390 (460)
T ss_pred             HhHHHHHHHHHHHHhhccC-----------CcEEEEEeeecchhhhHHHHHHHHHhC
Confidence            4556777777777777654           999999999876 44788888888887


No 296
>CHL00053 rps7 ribosomal protein S7
Probab=27.79  E-value=2.1e+02  Score=22.72  Aligned_cols=93  Identities=18%  Similarity=0.290  Sum_probs=59.1

Q ss_pred             HHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCH
Q psy7060          12 GLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNE   91 (160)
Q Consensus        12 ~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e   91 (160)
                      .+|.+.++++       .|.+.++....||....-..++..    --+.+|+=.-|-.+-.+++| -         .+.+
T Consensus        60 ~vl~~Ai~N~-------~P~~evk~~r~gG~~~qvPv~v~~----~rr~~lAirWil~~ar~r~~-~---------~~~~  118 (155)
T CHL00053         60 SVLRQAIRNV-------TPDVEVKARRVGGSTYQVPIEIGS----TRGKALAIRWLLKASRKRSG-R---------NMAF  118 (155)
T ss_pred             HHHHHHHHhC-------CCcEEEEEEeeCCEEEEEeeEcCH----HHHHHHHHHHHHHHHHhcCC-C---------CHHH
Confidence            4556666554       588999999999998766666642    35566666665555444432 1         2457


Q ss_pred             HHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCccee
Q psy7060          92 KLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYL  130 (160)
Q Consensus        92 ~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~  130 (160)
                      .+..+|+.-|+-....+.-+     ||+...-..||.|.
T Consensus       119 ~La~Eii~A~~~~g~aikkK-----~e~hk~A~aNRa~~  152 (155)
T CHL00053        119 KLSSELVDAAKGSGNAIRKK-----EETHRMAEANRAFA  152 (155)
T ss_pred             HHHHHHHHHHhCCCchhhhH-----HHHHHHHHHhHhHh
Confidence            78878887776655433333     56666667777663


No 297
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]
Probab=27.78  E-value=1.1e+02  Score=26.97  Aligned_cols=40  Identities=38%  Similarity=0.609  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCc-hhhHHHHHHHHHHh
Q psy7060          10 QRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLT-QVNEKLVQLILHEY   65 (160)
Q Consensus        10 q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt-~~~~~~v~~~l~~y   65 (160)
                      |+.+|...+.-+                +.||.=+-|||.++ .-||+.|+.||.++
T Consensus       267 Q~~iL~~a~~~l----------------k~GG~LVYSTCS~~~eENE~vV~~~L~~~  307 (355)
T COG0144         267 QKEILAAALKLL----------------KPGGVLVYSTCSLTPEENEEVVERFLERH  307 (355)
T ss_pred             HHHHHHHHHHhc----------------CCCCEEEEEccCCchhcCHHHHHHHHHhC


No 298
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=27.54  E-value=49  Score=30.23  Aligned_cols=14  Identities=29%  Similarity=0.354  Sum_probs=11.9

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.|+|+||+|+.+
T Consensus       161 ~~iIvvvNKiD~~~  174 (474)
T PRK05124        161 KHLVVAVNKMDLVD  174 (474)
T ss_pred             CceEEEEEeecccc
Confidence            37889999999983


No 299
>COG0218 Predicted GTPase [General function prediction only]
Probab=27.48  E-value=50  Score=27.97  Aligned_cols=53  Identities=19%  Similarity=0.296  Sum_probs=31.2

Q ss_pred             HHHHHHHHc-----CccceEEEeecC--CChh--HHHHHHhcCcceeceEEEEecCCCCCHHHH
Q psy7060          93 LVQLILHEY-----KIFNAEVLFRED--CNAD--ELIDVINANRVYLPCIYAYNKIDQISIEEV  147 (160)
Q Consensus        93 ~V~~IL~EY-----kI~NA~V~ired--~t~D--dliDvi~~nrvY~P~iyv~NKiD~is~eev  147 (160)
                      .++..+.+|     .|-=+.+++...  .+.+  ++++.+  ...=+|.++|.||+|-++..+.
T Consensus        92 ~w~~~i~~YL~~R~~L~~vvlliD~r~~~~~~D~em~~~l--~~~~i~~~vv~tK~DKi~~~~~  153 (200)
T COG0218          92 KWKKLIEEYLEKRANLKGVVLLIDARHPPKDLDREMIEFL--LELGIPVIVVLTKADKLKKSER  153 (200)
T ss_pred             HHHHHHHHHHhhchhheEEEEEEECCCCCcHHHHHHHHHH--HHcCCCeEEEEEccccCChhHH
Confidence            344444444     333344555443  3332  344444  3445699999999999987665


No 300
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein 
Probab=27.40  E-value=1.4e+02  Score=20.73  Aligned_cols=63  Identities=14%  Similarity=0.187  Sum_probs=39.7

Q ss_pred             cCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHHh
Q psy7060          83 TCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus        83 ~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i~  151 (160)
                      .||..    ..++++|.+.++.=.++-+.+|-.+.+-...+.|.+. .|.|++=.+. .-+-+++..+.
T Consensus        22 ~Cp~C----~~ak~~L~~~~i~y~~idv~~~~~~~~~l~~~~g~~t-vP~vfi~g~~-iGG~~~l~~l~   84 (90)
T cd03028          22 RCGFS----RKVVQILNQLGVDFGTFDILEDEEVRQGLKEYSNWPT-FPQLYVNGEL-VGGCDIVKEMH   84 (90)
T ss_pred             CCcHH----HHHHHHHHHcCCCeEEEEcCCCHHHHHHHHHHhCCCC-CCEEEECCEE-EeCHHHHHHHH
Confidence            56653    4688999999988777777776433333344455544 6999774432 22556665553


No 301
>KOG1532|consensus
Probab=27.39  E-value=47  Score=30.66  Aligned_cols=18  Identities=39%  Similarity=0.427  Sum_probs=14.9

Q ss_pred             eeceEEEEecCCCCCHHH
Q psy7060         129 YLPCIYAYNKIDQISIEE  146 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~ee  146 (160)
                      =+|.|+|+||.|..+.+-
T Consensus       181 klp~ivvfNK~Dv~d~~f  198 (366)
T KOG1532|consen  181 KLPFIVVFNKTDVSDSEF  198 (366)
T ss_pred             cCCeEEEEecccccccHH
Confidence            369999999999986643


No 302
>PF08765 Mor:  Mor transcription activator family;  InterPro: IPR014875 Mor (Middle operon regulator) is a sequence specific DNA binding protein. It mediates transcription activation through its interactions with the C-terminal domains of the alpha and sigma subunits of bacterial RNA polymerase. The N-terminal region of Mor is the dimerisation region, and the C-terminal contains a helix-turn-helix motif which binds DNA []. ; PDB: 1RR7_A.
Probab=26.83  E-value=28  Score=25.58  Aligned_cols=41  Identities=15%  Similarity=0.169  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHcC-ccceEEEeecCCChhHHHHHHhcCcceec
Q psy7060          91 EKLVQLILHEYK-IFNAEVLFREDCNADELIDVINANRVYLP  131 (160)
Q Consensus        91 e~~V~~IL~EYk-I~NA~V~ired~t~DdliDvi~~nrvY~P  131 (160)
                      .+.+...|.+++ ++-...-.-+.-.++.|.....|..+|+|
T Consensus        11 ~~~i~~~l~~~g~i~~~~a~~ig~~~~~~L~~~~gG~~iyiP   52 (108)
T PF08765_consen   11 ADVIAAELERLGEIDAELAEIIGEEVALKLCRYFGGQQIYIP   52 (108)
T ss_dssp             HHHHHHHHHHTS-S-----TTSHHHHHHHHHHHH-SS-----
T ss_pred             HHHHHHHHHHcCCcchhHHHHHHHHHHHHHHHHHCCEeEEee
Confidence            456788888888 77433333344567888889999999999


No 303
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=26.45  E-value=1.7e+02  Score=19.02  Aligned_cols=62  Identities=15%  Similarity=0.185  Sum_probs=39.1

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEecCCCC-CHHHHHHH
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYNKIDQI-SIEEVDRI  150 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NKiD~i-s~eevd~i  150 (160)
                      +.||.    =+.++.+|.+.+|.-..+-+.++-...+-+-.+.+. ...|.+++=++  .+ +.+|+.+|
T Consensus         9 ~~C~~----C~ka~~~L~~~gi~~~~~di~~~~~~~~el~~~~g~-~~vP~v~i~~~--~iGg~~~~~~~   71 (73)
T cd03027           9 LGCED----CTAVRLFLREKGLPYVEINIDIFPERKAELEERTGS-SVVPQIFFNEK--LVGGLTDLKSL   71 (73)
T ss_pred             CCChh----HHHHHHHHHHCCCceEEEECCCCHHHHHHHHHHhCC-CCcCEEEECCE--EEeCHHHHHhh
Confidence            45654    456899999999988888777765433333344454 45699977554  23 44555443


No 304
>COG3797 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.03  E-value=77  Score=26.76  Aligned_cols=88  Identities=19%  Similarity=0.362  Sum_probs=62.2

Q ss_pred             HHHHHHHhhhhhhHHh-hhcCccccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCc--------c
Q psy7060          58 VQLILHEYKIFNAEQK-KAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANR--------V  128 (160)
Q Consensus        58 v~~~l~~yki~n~~~~-~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nr--------v  128 (160)
                      ++.+|.+--.-|...- .+|-+.|-|+|..+++.+++=..+...|+.| .++++|   +++|+...+.+|-        -
T Consensus        24 Lka~~~dlGf~~v~T~iaSGNlvf~s~~~~~el~~klE~afe~~fg~~-~dilVr---s~~~~~~i~a~nPf~~~~~~~~   99 (178)
T COG3797          24 LKAALTDLGFANVRTYIASGNLVFESEAGAAELEAKLEAAFEKRFGRH-VDILVR---SAEDWETIAAANPFPEEAAGEP   99 (178)
T ss_pred             HHHHHHHcCcchhhHhhhcCCEEEEcCCChHHHHHHHHHHHHHHcCCC-ccEEEe---eHHHHHHHHhcCCCchhhccCc
Confidence            3444444444444433 3688999999999999999888888889865 677776   5788888887773        3


Q ss_pred             eeceEEEEecCCCCCHHHHHHHh
Q psy7060         129 YLPCIYAYNKIDQISIEEVDRIA  151 (160)
Q Consensus       129 Y~P~iyv~NKiD~is~eevd~i~  151 (160)
                      +--|+-+|+.-  ++.|++..++
T Consensus       100 ~~~~v~f~~ep--~dvd~v~~l~  120 (178)
T COG3797         100 ARVCVRFYREP--LDVDEVEALA  120 (178)
T ss_pred             ceEEEEEEcCC--CcHHHHHHHH
Confidence            55567777764  4567777773


No 305
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]
Probab=25.99  E-value=81  Score=29.44  Aligned_cols=40  Identities=23%  Similarity=0.422  Sum_probs=34.5

Q ss_pred             CcccCHHHHHHHHHHcCccceEEEeec-----CCChhHHHHHHhc
Q psy7060          86 LTQVNEKLVQLILHEYKIFNAEVLFRE-----DCNADELIDVINA  125 (160)
Q Consensus        86 ~~~~~e~~V~~IL~EYkI~NA~V~ire-----d~t~DdliDvi~~  125 (160)
                      .++.|.+++.++.+.|.+-.+-|.=.+     -+|.||++|+|..
T Consensus       210 ~~~~dqeevA~~~~~ydl~a~PVVd~~~~LiG~itiDDiidvi~e  254 (451)
T COG2239         210 LADDDQEEVARLFEKYDLLAVPVVDEDNRLIGIITIDDIIDVIEE  254 (451)
T ss_pred             cccCCHHHHHHHHHHhCCeecceECCCCceeeeeeHHHHHHHHHH
Confidence            456889999999999999998886555     7999999999975


No 306
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=25.92  E-value=1.1e+02  Score=30.12  Aligned_cols=14  Identities=43%  Similarity=0.724  Sum_probs=12.7

Q ss_pred             eeceEEEEecCCCC
Q psy7060         129 YLPCIYAYNKIDQI  142 (160)
Q Consensus       129 Y~P~iyv~NKiD~i  142 (160)
                      -+|++.|+||+|..
T Consensus       112 giPvIvVlNK~Dl~  125 (772)
T PRK09554        112 GIPCIVALNMLDIA  125 (772)
T ss_pred             CCCEEEEEEchhhh
Confidence            48999999999986


No 307
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=25.83  E-value=68  Score=25.69  Aligned_cols=12  Identities=33%  Similarity=0.354  Sum_probs=10.2

Q ss_pred             eEEEEecCCCCC
Q psy7060         132 CIYAYNKIDQIS  143 (160)
Q Consensus       132 ~iyv~NKiD~is  143 (160)
                      -++++||+|+.+
T Consensus       140 d~~~~~k~d~~~  151 (199)
T TIGR00101       140 DLLVINKIDLAP  151 (199)
T ss_pred             cEEEEEhhhccc
Confidence            389999999975


No 308
>COG0780 Enzyme related to GTP cyclohydrolase I [General function prediction only]
Probab=25.57  E-value=39  Score=27.39  Aligned_cols=42  Identities=31%  Similarity=0.605  Sum_probs=32.5

Q ss_pred             ccccCCCcc-----------------cCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh
Q psy7060          80 FNSTCPLTQ-----------------VNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN  124 (160)
Q Consensus        80 ~~~~~~~~~-----------------~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~  124 (160)
                      |-|-||.|+                 +..|-.++.|..|+=||.   |.|+|+-.=+.|.+.
T Consensus        49 f~S~CpiTgqPD~~ti~I~Y~p~~~~ve~ksLk~yl~SFR~h~~---fHE~c~~~I~~dl~~  107 (149)
T COG0780          49 FKSLCPITGQPDFATIYIEYIPDKACVESKSLKLYLFSFRNHGI---FHEQCANRIFNDLKA  107 (149)
T ss_pred             ceecCCCcCCCCeEEEEEEEcCchhhhhhHHHHHHHHHHhccch---HHHHHHHHHHHHHHH
Confidence            567777775                 677889999999999998   899998654444443


No 309
>TIGR02190 GlrX-dom Glutaredoxin-family domain. This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Probab=25.51  E-value=1.8e+02  Score=19.44  Aligned_cols=50  Identities=16%  Similarity=0.269  Sum_probs=34.2

Q ss_pred             ccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEe
Q psy7060          82 STCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYN  137 (160)
Q Consensus        82 ~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~N  137 (160)
                      +.||.-    ..+++.|.+++|.--++-+.++-...++.. +.|. .=+|.|++=.
T Consensus        16 ~~Cp~C----~~ak~~L~~~gi~y~~idi~~~~~~~~~~~-~~g~-~~vP~i~i~g   65 (79)
T TIGR02190        16 PGCPFC----AKAKATLKEKGYDFEEIPLGNDARGRSLRA-VTGA-TTVPQVFIGG   65 (79)
T ss_pred             CCCHhH----HHHHHHHHHcCCCcEEEECCCChHHHHHHH-HHCC-CCcCeEEECC
Confidence            456543    468899999999988888877766555443 3443 4479997633


No 310
>PF00578 AhpC-TSA:  AhpC/TSA family;  InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells. Prxs can be regulated by changes to phosphorylation, redox and possibly oligomerisation states. Prxs are divided into three classes: typical 2-Cys Prxs; atypical 2-Cys Prxs; and 1-Cys Prxs. All Prxs share the same basic catalytic mechanism, in which an active-site cysteine (the peroxidatic cysteine) is oxidised to a sulphenic acid by the peroxide substrate. The recycling of the sulphenic acid back to a thiol is what distinguishes the three enzyme classes. Using crystal structures, a detailed catalytic cycle has been derived for typical 2-Cys Prxs, including a model for the redox-regulated oligomeric state proposed to control enzyme activity []. Alkyl hydroperoxide reductase (AhpC) is responsible for directly reducing organic hyperoxides in its reduced dithiol form. Thiol specific antioxidant (TSA) is a physiologically important antioxidant which constitutes an enzymatic defence against sulphur-containing radicals. This family contains AhpC and TSA, as well as related proteins.; GO: 0016209 antioxidant activity, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1QMV_A 1PRX_B 3HJP_C 3HA9_A 2V41_G 2V32_C 2V2G_C 3LWA_A 3IA1_B 1ZYE_G ....
Probab=25.46  E-value=59  Score=22.37  Aligned_cols=42  Identities=17%  Similarity=0.278  Sum_probs=22.6

Q ss_pred             cCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh
Q psy7060          83 TCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN  124 (160)
Q Consensus        83 ~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~  124 (160)
                      .||........++....+|+-.|+.+..=..-+.+++...+.
T Consensus        37 ~c~~c~~~l~~l~~~~~~~~~~~~~vi~is~d~~~~~~~~~~   78 (124)
T PF00578_consen   37 WCPFCQAELPELNELYKKYKDKGVQVIGISTDDPEEIKQFLE   78 (124)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHTTTEEEEEEESSSHHHHHHHHH
T ss_pred             CccccccchhHHHHHhhhhccceEEeeecccccccchhhhhh
Confidence            366665555556666666665555554444444444444444


No 311
>PRK00049 elongation factor Tu; Reviewed
Probab=25.42  E-value=63  Score=28.54  Aligned_cols=25  Identities=28%  Similarity=0.208  Sum_probs=16.3

Q ss_pred             HHHHHHhcCcceeceE-EEEecCCCCCH
Q psy7060         118 ELIDVINANRVYLPCI-YAYNKIDQISI  144 (160)
Q Consensus       118 dliDvi~~nrvY~P~i-yv~NKiD~is~  144 (160)
                      +++..+...  -+|.+ +++||+|+.+.
T Consensus       118 ~~~~~~~~~--g~p~iiVvvNK~D~~~~  143 (396)
T PRK00049        118 EHILLARQV--GVPYIVVFLNKCDMVDD  143 (396)
T ss_pred             HHHHHHHHc--CCCEEEEEEeecCCcch
Confidence            344444432  36987 58999999854


No 312
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=25.28  E-value=1.3e+02  Score=26.84  Aligned_cols=35  Identities=23%  Similarity=0.491  Sum_probs=28.6

Q ss_pred             CHHHHHHHHHH--cCccc-eEEEeecCCChhHHHHHHh
Q psy7060          90 NEKLVQLILHE--YKIFN-AEVLFREDCNADELIDVIN  124 (160)
Q Consensus        90 ~e~~V~~IL~E--YkI~N-A~V~ired~t~DdliDvi~  124 (160)
                      .|+...+++||  ++++- ..|.|+.+|+-+.+.++|.
T Consensus       211 ~e~ll~rL~~e~~v~ile~~~v~f~C~CSrEr~~~aL~  248 (286)
T COG1281         211 AEELLYRLFHEEGVQLLEPQPVEFRCSCSRERVAAALL  248 (286)
T ss_pred             HHHHHHHHhccccccccCCccceEEcCCCHHHHHHHHH
Confidence            36678889986  57765 7799999999999988875


No 313
>PF06784 UPF0240:  Uncharacterised protein family (UPF0240);  InterPro: IPR009622 This is a group of proteins of unknown function.
Probab=25.00  E-value=77  Score=26.01  Aligned_cols=20  Identities=35%  Similarity=0.544  Sum_probs=17.6

Q ss_pred             cCHHHHHHHHHHcCccceEE
Q psy7060          89 VNEKLVQLILHEYKIFNAEV  108 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V  108 (160)
                      +++++|+.||+-|+-|+..+
T Consensus       148 L~~~dv~~iL~yF~~F~v~i  167 (179)
T PF06784_consen  148 LDEKDVKNILKYFKPFEVKI  167 (179)
T ss_pred             CCHHHHHHHHHhcCCceeeC
Confidence            89999999999999997644


No 314
>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional
Probab=24.99  E-value=88  Score=28.18  Aligned_cols=69  Identities=23%  Similarity=0.274  Sum_probs=41.8

Q ss_pred             eEEec-ccCCchhhHHHHHHHHHH--hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccceEEEeec
Q psy7060          42 IAFNS-TCPLTQVNEKLVQLILHE--YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEVLFRE  112 (160)
Q Consensus        42 I~i~~-t~~lt~~~~~~v~~~l~~--yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ire  112 (160)
                      +.|.+ .|+.-..|.+.+...|.+  |.+-+.. ..|.=+.+| ||-.++-.++.+...+++++=.+..|.+-|
T Consensus        10 ~~i~t~GC~~N~~dse~~~~~l~~~G~~~~~~~-~~aD~ivin-TC~v~~~a~~k~~~~i~~~~~~~~~ivv~G   81 (440)
T PRK14862         10 IGFVSLGCPKALVDSERILTQLRAEGYEISPSY-DGADLVIVN-TCGFIDSAVQESLEAIGEALAENGKVIVTG   81 (440)
T ss_pred             EEEEEcCCCCcHHHHHHHHHHHHHCcCEECCCc-ccCCEEEEe-cccccchHHHHHHHHHHHHHhcCCCEEEEC
Confidence            34433 778777888888888865  5555432 256667777 888888776655554444432233344433


No 315
>PF01189 Nol1_Nop2_Fmu:  NOL1/NOP2/sun family;  InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins.  In the archaea and bacteria, they are annotated as putative nucleolar protein, Sun (Fmu) family protein or tRNA/rRNA cytosine-C5-methylase. The majority have the S-adenosyl methionine (SAM) binding domain and are related to Escherichia coli Fmu (Sun) protein (16S rRNA m5C 967 methyltransferase) whose structure has been determined [].  In the eukaryota, the majority are annotated as being 'hypothetical protein', nucleolar protein or the Nop2/Sun (Fmu) family. Unlike their bacterial homologues, few of the eukaryotic members in this family have a the SAM binding signature. Despite this, Saccharomyces cerevisiae (Baker's yeast) Nop2p is a probable RNA m5C methyltransferase []. It is essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis []; localized to the nucleolus and is essential for viability []. Reduced Nop2p expression limits yeast growth and decreases levels of mature 60S ribosomal subunits while altering rRNA processing []. There is substantial identity between Nop2p and Homo sapiens (Human) p120 (NOL1), which is also called the proliferation-associated nucleolar antigen [, ].; PDB: 3M4X_A 2FRX_B 2YXL_A 1IXK_A 1SQG_A 1SQF_A 3M6U_B 3M6V_B 3M6W_A 3M6X_A ....
Probab=24.78  E-value=26  Score=29.78  Aligned_cols=29  Identities=38%  Similarity=0.557  Sum_probs=26.2

Q ss_pred             hhcCccccccCCCccc-CHHHHHHHHHHcC
Q psy7060          74 KAGGIAFNSTCPLTQV-NEKLVQLILHEYK  102 (160)
Q Consensus        74 ~~~~~~~~~~~~~~~~-~e~~V~~IL~EYk  102 (160)
                      +.||..+=|||.+..- +|+.|+..|+++.
T Consensus       210 k~gG~lvYsTCS~~~eENE~vV~~fl~~~~  239 (283)
T PF01189_consen  210 KPGGRLVYSTCSLSPEENEEVVEKFLKRHP  239 (283)
T ss_dssp             EEEEEEEEEESHHHGGGTHHHHHHHHHHST
T ss_pred             cCCCeEEEEeccHHHHHHHHHHHHHHHhCC
Confidence            7899999999999876 8999999999874


No 316
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=24.57  E-value=1.5e+02  Score=17.84  Aligned_cols=34  Identities=12%  Similarity=0.113  Sum_probs=15.8

Q ss_pred             CHHHHHHHHHHcCccceEEE-----eecCCChhHHHHHH
Q psy7060          90 NEKLVQLILHEYKIFNAEVL-----FREDCNADELIDVI  123 (160)
Q Consensus        90 ~e~~V~~IL~EYkI~NA~V~-----ired~t~DdliDvi  123 (160)
                      +-..+...+.++++..+-|.     +.|-+|..||+.++
T Consensus        17 ~l~~~~~~~~~~~~~~~~V~d~~~~~~G~is~~dl~~~l   55 (57)
T PF00571_consen   17 SLEEALEIMRKNGISRLPVVDEDGKLVGIISRSDLLKAL   55 (57)
T ss_dssp             BHHHHHHHHHHHTSSEEEEESTTSBEEEEEEHHHHHHHH
T ss_pred             cHHHHHHHHHHcCCcEEEEEecCCEEEEEEEHHHHHhhh
Confidence            34445555555555444443     33334444444443


No 317
>PRK13808 adenylate kinase; Provisional
Probab=24.50  E-value=1.5e+02  Score=26.57  Aligned_cols=24  Identities=21%  Similarity=0.249  Sum_probs=14.8

Q ss_pred             CCCCCCc-hHHHHHHHHHHHhcCce
Q psy7060           1 MLDATKQ-DVQRGLLEKELESVGIR   24 (160)
Q Consensus         1 vLDa~k~-~~q~~~le~ELe~~GIr   24 (160)
                      |||.+-. ..|...|+..|...|+.
T Consensus        82 ILDGFPRt~~QA~~L~~ll~~~gi~  106 (333)
T PRK13808         82 ILDGFPRTVPQAEALDALLKDKQLK  106 (333)
T ss_pred             EEeCCCCCHHHHHHHHHHHHhcCCC
Confidence            3566544 45777777777666643


No 318
>PRK13253 citrate lyase subunit gamma; Provisional
Probab=23.98  E-value=2.3e+02  Score=21.22  Aligned_cols=29  Identities=17%  Similarity=0.170  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHcCccceEEEeecCCChhHH
Q psy7060          91 EKLVQLILHEYKIFNAEVLFREDCNADEL  119 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ired~t~Ddl  119 (160)
                      ++.+...|.+|++.||.|.+..-=-+|-.
T Consensus        46 ~~vv~~~l~~~~v~~~~i~i~D~GAld~v   74 (92)
T PRK13253         46 RAVILETLAKLGVENAQVKVDDKGALDCV   74 (92)
T ss_pred             HHHHHHHHHhcCCCceEEEEEcCCCCHHH
Confidence            67889999999999999999875444433


No 319
>KOG2198|consensus
Probab=23.94  E-value=55  Score=30.33  Aligned_cols=31  Identities=39%  Similarity=0.527  Sum_probs=26.4

Q ss_pred             HHhhhcCccccccCCCccc-CHHHHHHHHHHc
Q psy7060          71 EQKKAGGIAFNSTCPLTQV-NEKLVQLILHEY  101 (160)
Q Consensus        71 ~~~~~~~~~~~~~~~~~~~-~e~~V~~IL~EY  101 (160)
                      +.-+-||..+-|||-|..+ ||..|+.+|++-
T Consensus       284 ~lLk~GG~lVYSTCSLnpieNEaVV~~~L~~~  315 (375)
T KOG2198|consen  284 RLLKVGGRLVYSTCSLNPIENEAVVQEALQKV  315 (375)
T ss_pred             HHhcCCCEEEEeccCCCchhhHHHHHHHHHHh
Confidence            4457899999999999998 788899999763


No 320
>cd00304 RT_like RT_like: Reverse transcriptase (RT, RNA-dependent DNA polymerase)_like family. An RT gene is usually indicative of a mobile element such as a retrotransposon or retrovirus. RTs occur in a variety of mobile elements, including retrotransposons, retroviruses, group II introns, bacterial msDNAs, hepadnaviruses, and caulimoviruses. These elements can be divided into two major groups. One group contains retroviruses and DNA viruses whose propagation involves an RNA intermediate. They are grouped together with transposable elements containing long terminal repeats (LTRs). The other group, also called poly(A)-type retrotransposons, contain fungal mitochondrial introns and transposable elements that lack LTRs.
Probab=23.84  E-value=1.2e+02  Score=20.33  Aligned_cols=24  Identities=25%  Similarity=0.422  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHhcCceeccCCCCeE
Q psy7060          10 QRGLLEKELESVGIRLNKKKPNIY   33 (160)
Q Consensus        10 q~~~le~ELe~~GIrLnkk~p~I~   33 (160)
                      -...+...|+..|+++|..|..+.
T Consensus        62 ~~~~l~~~l~~~gl~ln~~Kt~~~   85 (98)
T cd00304          62 KKRELEEFLARLGLNLSDEKTQFT   85 (98)
T ss_pred             HHHHHHHHHHHcCcEEChheeEEe
Confidence            456788999999999999997663


No 321
>PF00919 UPF0004:  Uncharacterized protein family UPF0004;  InterPro: IPR013848  The methylthiotransferase (MTTase) or miaB-like family is named after the (dimethylallyl)adenosine tRNA MTTase miaB protein, which catalyses a C-H to C-S bond conversion in the methylthiolation of tRNA. A related bacterial enzyme rimO performs a similar methylthiolation, but on a protein substrate. RimO acts on the ribosomal protein S12 and forms a separate MTTase subfamily. The miaB-subfamily includes mammalian CDK5 regulatory subunit-associated proteins and similar proteins in other eukaryotes. Two other subfamilies, yqeV and CDKAL1, are named after a Bacillus subtilis and a human protein, respectively. While yqeV-like proteins are found in bacteria, CDKAL1 subfamily members occur in eukaryotes and in archaebacteria. The likely MTTases from these 4 subfamilies contain an N-terminal MTTase domain, a central radical generating fold and a C-terminal TRAM domain (see PDOC50926 from PROSITEDOC). The core forms a radical SAM fold (or AdoMet radical), containing a cysteine motif CxxxCxxC that binds a [4Fe-4S] cluster [, , ]. A reducing equivalent from the [4Fe-4S]+ cluster is used to cleave S-adenosylmethionine (SAM) to generate methionine and a 5'-deoxyadenosyl radical. The latter is thought to produce a reactive substrate radical that is amenable to sulphur insertion [, ]. The N-terminal MTTase domain contains 3 cysteines that bind a second [4Fe-4S] cluster, in addition to the radical-generating [4Fe-4S] cluster, which could be involved in the thiolation reaction. The C-terminal TRAM domain is not shared with other radical SAM proteins outside the MTTase family. The TRAM domain can bind to RNA substrate and seems to be important for substrate recognition. The tertiary structure of the central radical SAM fold has six beta/alpha motifs resembling a three-quarter TIM barrel core (see PDOC00155 from PROSITEDOC) []. The N-terminal MTTase domain might form an additional [beta/alpha]2 TIM barrel unit []. ; GO: 0003824 catalytic activity, 0051539 4 iron, 4 sulfur cluster binding, 0009451 RNA modification
Probab=23.78  E-value=1.3e+02  Score=22.07  Aligned_cols=66  Identities=14%  Similarity=0.266  Sum_probs=37.7

Q ss_pred             ccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccc---eEEEeec
Q psy7060          47 TCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFN---AEVLFRE  112 (160)
Q Consensus        47 t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~N---A~V~ire  112 (160)
                      .|+.-..|.+.+.+.|...-.--.+.....-+.+=-||-.++-.++.+...+++++=.+   +.|.+-|
T Consensus         8 GC~~N~~Dse~i~~~l~~~G~~~~~~~e~AD~iiiNTC~V~~~Ae~k~~~~i~~l~~~~~~~~~ivv~G   76 (98)
T PF00919_consen    8 GCQMNQYDSERIASILQAAGYEIVDDPEEADVIIINTCTVRESAEQKSRNRIRKLKKLKKPGAKIVVTG   76 (98)
T ss_pred             CCcccHHHHHHHHHHHHhcCCeeecccccCCEEEEEcCCCCcHHHHHHHHHHHHHHHhcCCCCEEEEEe
Confidence            56666667777777777633222333233344455567777766666666666655444   5555554


No 322
>TIGR00550 nadA quinolinate synthetase complex, A subunit. This protein, termed NadA, plays a role in the synthesis of pyridine, a precursor to NAD. The quinolinate synthetase complex consists of A protein (this protein) and B protein. B protein converts L-aspartate to iminoaspartate, an unstable reaction product which in the absence of A protein is spontaneously hydrolyzed to form oxaloacetate. The A protein, NadA, converts iminoaspartate to quinolate.
Probab=23.77  E-value=1.1e+02  Score=26.93  Aligned_cols=35  Identities=17%  Similarity=0.523  Sum_probs=31.3

Q ss_pred             cccCCCcc-cCHHHHHHHHHHcCccceEEEeecCCChh
Q psy7060          81 NSTCPLTQ-VNEKLVQLILHEYKIFNAEVLFREDCNAD  117 (160)
Q Consensus        81 ~~~~~~~~-~~e~~V~~IL~EYkI~NA~V~ired~t~D  117 (160)
                      ++.||.-+ .+.+.|...+++|  -+|.|.+.++|+.+
T Consensus       172 ~g~C~vh~~~t~e~v~~~~~~~--p~a~VvvhpEc~~e  207 (310)
T TIGR00550       172 QGHCSVHEKFTTEDLERLKEKY--PDAEILVHPECEPE  207 (310)
T ss_pred             CCCCcChhhCCHHHHHHHHHHC--CCCeEEECCCCCHH
Confidence            79999977 6999999999999  57999999999865


No 323
>PF10678 DUF2492:  Protein of unknown function (DUF2492);  InterPro: IPR019620  This entry describes a family of small cytosolic proteins, about 80 amino acids in length, in which the eight invariant residues include three His residues and two Cys residues. Two pairs of these invariant residues occur in motifs HxH (where x is A or G) and CxH, both of which suggest metal-binding activity. This protein family was identified by searching with a phylogenetic profile based on an anaerobic sulphatase-maturase enzyme, which contains multiple 4Fe-4S clusters. The linkages by phylogenetic profiling and by iron-sulphur cluster-related motifs together suggest this protein may be an accessory protein to certain maturases in sulphatase/maturase systems. 
Probab=23.64  E-value=2e+02  Score=21.22  Aligned_cols=39  Identities=28%  Similarity=0.568  Sum_probs=31.0

Q ss_pred             HHHHHHHHHHcCccceEEEee----cCCChhHHHHHHhcCcceece
Q psy7060          91 EKLVQLILHEYKIFNAEVLFR----EDCNADELIDVINANRVYLPC  132 (160)
Q Consensus        91 e~~V~~IL~EYkI~NA~V~ir----ed~t~DdliDvi~~nrvY~P~  132 (160)
                      +++++.|-..||-   ++.|.    ++.|+|+|++.+...-.++|.
T Consensus        23 ~~L~~ai~~~FG~---~arFhTCSae~m~a~eLv~FL~~rgKfi~~   65 (78)
T PF10678_consen   23 EELKAAIIEKFGE---DARFHTCSAEGMTADELVDFLEERGKFIPS   65 (78)
T ss_pred             HHHHHHHHHHhCC---CceEEecCCCCCCHHHHHHHHHHcCCEeec
Confidence            6788888888874   44443    689999999999998888874


No 324
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA. This bacterial (and Arabidopsis) protein, termed TypA or BipA, a GTP-binding protein, is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.
Probab=23.57  E-value=51  Score=31.30  Aligned_cols=14  Identities=50%  Similarity=0.463  Sum_probs=12.4

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      +|.|+|+||+|+..
T Consensus       117 ip~IVviNKiD~~~  130 (594)
T TIGR01394       117 LKPIVVINKIDRPS  130 (594)
T ss_pred             CCEEEEEECCCCCC
Confidence            69999999999863


No 325
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=23.52  E-value=1.1e+02  Score=24.60  Aligned_cols=24  Identities=13%  Similarity=0.501  Sum_probs=15.6

Q ss_pred             HHHHHHhcCcceeceEE-EEecCCCCC
Q psy7060         118 ELIDVINANRVYLPCIY-AYNKIDQIS  143 (160)
Q Consensus       118 dliDvi~~nrvY~P~iy-v~NKiD~is  143 (160)
                      ++...+....  +|+++ |+||+|++.
T Consensus       123 ~i~~~l~~~g--~p~vi~VvnK~D~~~  147 (225)
T cd01882         123 EFLNILQVHG--FPRVMGVLTHLDLFK  147 (225)
T ss_pred             HHHHHHHHcC--CCeEEEEEeccccCC
Confidence            4455554332  58655 999999973


No 326
>PHA02992 hypothetical protein; Provisional
Probab=23.40  E-value=1.8e+02  Score=29.41  Aligned_cols=63  Identities=8%  Similarity=0.273  Sum_probs=51.0

Q ss_pred             hHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcc
Q psy7060          54 NEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRV  128 (160)
Q Consensus        54 ~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrv  128 (160)
                      |+.+.+-|.+.|+++++=-+..-            .+-+-.+..|..|||-=+.--+.+.++.|+.+|++...|.
T Consensus       153 d~~~E~i~~~d~~m~~~lY~hQ~------------~s~~FL~~Mlyk~GI~P~N~Gi~~~~s~~~iieiL~~~~~  215 (728)
T PHA02992        153 ESLTEKIFIQDYSMYDPLYEHQS------------FTSDFLTDMLYKYGIVPNNDGILDEISIELIIEILQSIKR  215 (728)
T ss_pred             HHHHHHHHHhchhhhhHhhhcCc------------CCHHHHHHHHHHcCCCCCCccccccCCHHHHHHHHHhcCC
Confidence            34556778888888887544321            6788999999999999999999999999999999987654


No 327
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=23.22  E-value=1.1e+02  Score=18.66  Aligned_cols=34  Identities=18%  Similarity=0.132  Sum_probs=24.8

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcC
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINAN  126 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~n  126 (160)
                      -+++..+.-|.+|+|.-..-.    .|-|+|++.+..|
T Consensus         4 Ws~~~L~~wL~~~gi~~~~~~----~~rd~Ll~~~k~~   37 (38)
T PF10281_consen    4 WSDSDLKSWLKSHGIPVPKSA----KTRDELLKLAKKN   37 (38)
T ss_pred             CCHHHHHHHHHHcCCCCCCCC----CCHHHHHHHHHHh
Confidence            467889999999988643222    4889998877654


No 328
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues. Cysteine aspartases that mediate programmed cell death (apoptosis). Caspases are synthesised as zymogens and activated by proteolysis of the peptide backbone adjacent to an aspartate. The resulting two subunits associate to form an (alpha)2(beta)2-tetramer which is the active enzyme. Activation of caspases can be mediated by other caspase homologues.
Probab=23.11  E-value=1.2e+02  Score=25.03  Aligned_cols=33  Identities=15%  Similarity=0.364  Sum_probs=26.8

Q ss_pred             cCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHh
Q psy7060          89 VNEKLVQLILHEYKIFNAEVLFREDCNADELIDVIN  124 (160)
Q Consensus        89 ~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~  124 (160)
                      .|.+.+..+|++.+.   +|.+..|+|.+|+.+++.
T Consensus        30 ~D~~~l~~~f~~lgF---~V~~~~dlt~~em~~~l~   62 (241)
T smart00115       30 VDAENLTELFQSLGY---EVHVKNNLTAEEMLEELK   62 (241)
T ss_pred             HHHHHHHHHHHHCCC---EEEEecCCCHHHHHHHHH
Confidence            466677777777665   999999999999999884


No 329
>PRK13505 formate--tetrahydrofolate ligase; Provisional
Probab=22.81  E-value=67  Score=31.14  Aligned_cols=35  Identities=23%  Similarity=0.312  Sum_probs=27.0

Q ss_pred             CChhHHHHHHhcCcceeceEEEEecCCCCCHHHHHHH
Q psy7060         114 CNADELIDVINANRVYLPCIYAYNKIDQISIEEVDRI  150 (160)
Q Consensus       114 ~t~DdliDvi~~nrvY~P~iyv~NKiD~is~eevd~i  150 (160)
                      .++...++.+.  +.=+|+++++||-|.-+.+|++.+
T Consensus       359 ~NL~RHIenvr--~FGvPvVVAINKFd~DTe~Ei~~I  393 (557)
T PRK13505        359 ANLERHIENIR--KFGVPVVVAINKFVTDTDAEIAAL  393 (557)
T ss_pred             HHHHHHHHHHH--HcCCCEEEEEeCCCCCCHHHHHHH
Confidence            45666666665  355799999999999888787766


No 330
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=22.63  E-value=67  Score=31.59  Aligned_cols=49  Identities=14%  Similarity=0.173  Sum_probs=28.8

Q ss_pred             HHHHHHHHHcCcc-ceEEEeecC--CC--hhHHHHHHhcCcceeceEEEEecCCCC
Q psy7060          92 KLVQLILHEYKIF-NAEVLFRED--CN--ADELIDVINANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus        92 ~~V~~IL~EYkI~-NA~V~ired--~t--~DdliDvi~~nrvY~P~iyv~NKiD~i  142 (160)
                      +-+......-+.- .|.+.+...  +.  ...++..+...+  +|+|+++||+|..
T Consensus       110 dF~~e~~~al~~~D~ailVvda~~Gv~~~t~~~~~~~~~~~--~p~i~~iNK~D~~  163 (843)
T PLN00116        110 DFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGER--IRPVLTVNKMDRC  163 (843)
T ss_pred             HHHHHHHHHHhhcCEEEEEEECCCCCcccHHHHHHHHHHCC--CCEEEEEECCccc
Confidence            3445555544444 455555532  22  234555554444  5999999999998


No 331
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=22.48  E-value=69  Score=30.05  Aligned_cols=14  Identities=29%  Similarity=0.413  Sum_probs=11.8

Q ss_pred             eceEEEEecCCCCC
Q psy7060         130 LPCIYAYNKIDQIS  143 (160)
Q Consensus       130 ~P~iyv~NKiD~is  143 (160)
                      .|.|+|+||+|+.+
T Consensus       158 ~~iivvvNK~D~~~  171 (632)
T PRK05506        158 RHVVLAVNKMDLVD  171 (632)
T ss_pred             CeEEEEEEeccccc
Confidence            46788999999984


No 332
>cd06536 CIDE_N_ICAD CIDE_N domain of ICAD. The CIDE_N  (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD (DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40 and ICAD/DFF45 during apoptosis. In normal cells, DFF exists in the nucleus as a heterodimer composed of CAD/DFF40 as a latent nuclease and its chaperone and inhibitor subunit ICAD/DFF45. Apoptotic activation of caspase-3 results in the cleavage of DFF45/ICAD and release of active DFF40/CAD nuclease.
Probab=22.41  E-value=79  Score=23.39  Aligned_cols=58  Identities=17%  Similarity=0.245  Sum_probs=44.1

Q ss_pred             hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCcc--c--eEEEeecC---CChhHHHHHHhcCcce
Q psy7060          65 YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIF--N--AEVLFRED---CNADELIDVINANRVY  129 (160)
Q Consensus        65 yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~--N--A~V~ired---~t~DdliDvi~~nrvY  129 (160)
                      |||.|.+....=||+-+|-       +++......-+.+.  +  ..+.+.||   +.-+|.-..+..|-++
T Consensus         5 fkV~~~~r~~k~GV~A~sL-------~eL~~K~~~~l~l~~~~~~~~lvL~eDGT~VddEeyF~tLp~nT~l   69 (80)
T cd06536           5 CVVCNVSRQKQHGVAASSL-------EELRIKACESLGFDSSSAPITLVLAEDGTIVEDEDYFLCLPPNTKF   69 (80)
T ss_pred             eEEecCCCCeeEeEEcCCH-------HHHHHHHHHHhCCCCCCCceEEEEecCCcEEccHHHHhhCCCCcEE
Confidence            6777888888888888774       77888889999997  3  67778888   4456777777777655


No 333
>PF02017 CIDE-N:  CIDE-N domain;  InterPro: IPR003508 This domain consists of caspase-activated (CAD) nucleases, which induce DNA fragmentation and chromatin condensation during apoptosis, and the cell death activator proteins CIDE-A and CIDE-B, which are inhibitors of CAD nuclease. The two proteins interact through the region defined by the method signatures.; GO: 0006915 apoptosis, 0005622 intracellular; PDB: 1IBX_A 2EEL_A 1F2R_I 1C9F_A 1D4B_A.
Probab=22.17  E-value=26  Score=25.61  Aligned_cols=58  Identities=21%  Similarity=0.362  Sum_probs=41.9

Q ss_pred             hhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCcc--ceEEEeecCCC---hhHHHHHHhcCcce
Q psy7060          65 YKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIF--NAEVLFREDCN---ADELIDVINANRVY  129 (160)
Q Consensus        65 yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~--NA~V~ired~t---~DdliDvi~~nrvY  129 (160)
                      |||.|.+....=||+-.|-       +++..+...-+.+.  .+.+.+.||=|   -||+-..+..|-+.
T Consensus         5 ~kv~~~~r~~k~Gv~A~sL-------~eL~~K~~~~l~~~~~~~~lvL~eDGT~VddEeyF~tLp~nT~l   67 (78)
T PF02017_consen    5 FKVRNHDRSVKKGVAASSL-------EELLEKACDKLQLPEEPVRLVLEEDGTEVDDEEYFQTLPDNTVL   67 (78)
T ss_dssp             EEEEETTSSCEEEEEESSH-------HHHHHHHHHHHT-SSSTCEEEETTTTCBESSCHHHCCSSSSEEE
T ss_pred             EEEecCCCCceEeEEcCCH-------HHHHHHHHHHhCCCCcCcEEEEeCCCcEEccHHHHhhCCCCCEE
Confidence            6777777777778877653       78888999999998  67778888844   45666666666554


No 334
>PF13529 Peptidase_C39_2:  Peptidase_C39 like family; PDB: 3ERV_A.
Probab=22.04  E-value=2.6e+02  Score=19.10  Aligned_cols=44  Identities=23%  Similarity=0.309  Sum_probs=28.8

Q ss_pred             ccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhcCcceeceEEEEe
Q psy7060          88 QVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINANRVYLPCIYAYN  137 (160)
Q Consensus        88 ~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~N  137 (160)
                      .+....+...++.|+.   ........+.+++.+.|..++   |.|+-++
T Consensus        64 ~~~~~~~~~~~~~~~~---~~~~~~~~~~~~i~~~i~~G~---Pvi~~~~  107 (144)
T PF13529_consen   64 GTSPDDLARYLEKYGY---KATDTSDASFDDIKQEIDAGR---PVIVSVN  107 (144)
T ss_dssp             ---HHHHHHHHHHH-T---TEEE-TTS-HHHHHHHHHTT-----EEEEEE
T ss_pred             ccccHHHHHHHHHcCc---ceeeccCCcHHHHHHHHHCCC---cEEEEEE
Confidence            4678889999999999   333456788999999999876   6666664


No 335
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=21.87  E-value=2.3e+02  Score=20.92  Aligned_cols=61  Identities=20%  Similarity=0.236  Sum_probs=36.8

Q ss_pred             HHHHHHHHHHHhcCceeccCCCCeEEEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcC-ccccccCCCc
Q psy7060           9 VQRGLLEKELESVGIRLNKKKPNIYFKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGG-IAFNSTCPLT   87 (160)
Q Consensus         9 ~q~~~le~ELe~~GIrLnkk~p~I~ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~-~~~~~~~~~~   87 (160)
                      .=++.|++|+++.|+       +|.+++..--|+  -...|+..+              .     ..+| +      -..
T Consensus        18 ~V~~al~~ei~~~gl-------~v~v~~tGC~G~--C~~ePlV~V--------------~-----~p~g~v------~Y~   63 (92)
T cd03063          18 EVAEAIEAEAAARGL-------AATIVRNGSRGM--YWLEPLVEV--------------E-----TPGGRV------AYG   63 (92)
T ss_pred             HHHHHHHHHHHHcCC-------eEEEEEecCcee--cCCCCEEEE--------------E-----eCCCcE------EEE
Confidence            357899999999998       355544433344  445566541              0     0112 2      234


Q ss_pred             ccCHHHHHHHHHHcCc
Q psy7060          88 QVNEKLVQLILHEYKI  103 (160)
Q Consensus        88 ~~~e~~V~~IL~EYkI  103 (160)
                      +++.+++.+|+.++-.
T Consensus        64 ~V~~edv~~Iv~~~~~   79 (92)
T cd03063          64 PVTPADVASLLDAGAL   79 (92)
T ss_pred             eCCHHHHHHHHHHHhh
Confidence            5788888888877644


No 336
>TIGR00487 IF-2 translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU.
Probab=21.63  E-value=83  Score=29.92  Aligned_cols=21  Identities=38%  Similarity=0.501  Sum_probs=15.5

Q ss_pred             ceeceEEEEecCCCC--CHHHHH
Q psy7060         128 VYLPCIYAYNKIDQI--SIEEVD  148 (160)
Q Consensus       128 vY~P~iyv~NKiD~i--s~eevd  148 (160)
                      .-+|.|+|+||+|+.  +.+++.
T Consensus       186 ~~vPiIVviNKiDl~~~~~e~v~  208 (587)
T TIGR00487       186 ANVPIIVAINKIDKPEANPDRVK  208 (587)
T ss_pred             cCCCEEEEEECcccccCCHHHHH
Confidence            347999999999986  344443


No 337
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1. This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.
Probab=21.56  E-value=1.6e+02  Score=18.81  Aligned_cols=53  Identities=17%  Similarity=0.159  Sum_probs=31.6

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCc--cceEEEeecCCChhHHHHHHhcCcceeceEEEEec
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKI--FNAEVLFREDCNADELIDVINANRVYLPCIYAYNK  138 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI--~NA~V~ired~t~DdliDvi~~nrvY~P~iyv~NK  138 (160)
                      ..+.||.-+.-...+.++..+|+.  .-..|-+.+   -.++...  ....-+|++++ |.
T Consensus         7 ~~~~C~~C~~~~~~l~~l~~~~~~~~~~~~vd~~~---~~~~~~~--~~v~~vPt~~~-~g   61 (82)
T TIGR00411         7 TSPTCPYCPAAKRVVEEVAKEMGDAVEVEYINVME---NPQKAME--YGIMAVPAIVI-NG   61 (82)
T ss_pred             ECCCCcchHHHHHHHHHHHHHhcCceEEEEEeCcc---CHHHHHH--cCCccCCEEEE-CC
Confidence            357899888888899999999973  222222221   1122222  23445799987 54


No 338
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=21.39  E-value=3e+02  Score=19.25  Aligned_cols=67  Identities=13%  Similarity=0.128  Sum_probs=48.5

Q ss_pred             hHHHHHHHHHHhhhhhhHHhhhcCccccccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHHHHhc
Q psy7060          54 NEKLVQLILHEYKIFNAEQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELIDVINA  125 (160)
Q Consensus        54 ~~~~v~~~l~~yki~n~~~~~~~~~~~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliDvi~~  125 (160)
                      +.+.+...|..+.+.    .-...+...+.++...-+.+..+.+++++++.-.++++-+|-- .|+.-+...
T Consensus       103 ~~~~~~~~l~~~~~~----~~f~~i~~~~~~~~~Kp~~~~~~~~~~~~~~~p~~~~~vgD~~-~d~~~A~~~  169 (176)
T PF13419_consen  103 SRERIERVLERLGLD----DYFDEIISSDDVGSRKPDPDAYRRALEKLGIPPEEILFVGDSP-SDVEAAKEA  169 (176)
T ss_dssp             EHHHHHHHHHHTTHG----GGCSEEEEGGGSSSSTTSHHHHHHHHHHHTSSGGGEEEEESSH-HHHHHHHHT
T ss_pred             Ccccccccccccccc----cccccccccchhhhhhhHHHHHHHHHHHcCCCcceEEEEeCCH-HHHHHHHHc
Confidence            456677777777665    2233555566667677789999999999999989999988755 666655543


No 339
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functio
Probab=21.36  E-value=2.1e+02  Score=17.56  Aligned_cols=54  Identities=13%  Similarity=0.213  Sum_probs=30.4

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCCh-hHHHHHHhcCcceeceEEEEecC
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNA-DELIDVINANRVYLPCIYAYNKI  139 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~-DdliDvi~~nrvY~P~iyv~NKi  139 (160)
                      ++.||.-+.-.+.++.+.+++   .....+.-|++- .++.....  -...|+++++++-
T Consensus        19 ~~~C~~C~~~~~~~~~~~~~~---~~~~~~~i~~~~~~~~~~~~~--v~~~P~~~~~~~g   73 (93)
T cd02947          19 APWCGPCKAIAPVLEELAEEY---PKVKFVKVDVDENPELAEEYG--VRSIPTFLFFKNG   73 (93)
T ss_pred             CCCChhHHHhhHHHHHHHHHC---CCceEEEEECCCChhHHHhcC--cccccEEEEEECC
Confidence            455777777777777777772   222222333442 33444332  3356999998764


No 340
>TIGR00503 prfC peptide chain release factor 3. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus.
Probab=20.90  E-value=56  Score=30.52  Aligned_cols=23  Identities=26%  Similarity=0.382  Sum_probs=16.2

Q ss_pred             HHHHHHhcCcceeceEEEEecCCCC
Q psy7060         118 ELIDVINANRVYLPCIYAYNKIDQI  142 (160)
Q Consensus       118 dliDvi~~nrvY~P~iyv~NKiD~i  142 (160)
                      .++.......  +|.|+++||+|+.
T Consensus       123 ~l~~~~~~~~--~PiivviNKiD~~  145 (527)
T TIGR00503       123 KLMEVTRLRD--TPIFTFMNKLDRD  145 (527)
T ss_pred             HHHHHHHhcC--CCEEEEEECcccc
Confidence            4444443322  6999999999996


No 341
>COG1159 Era GTPase [General function prediction only]
Probab=20.88  E-value=6.3e+02  Score=22.83  Aligned_cols=106  Identities=20%  Similarity=0.262  Sum_probs=63.8

Q ss_pred             chHHHHHHHHHHHhcCceeccCCCCeE------EEEecCcceEEecccCCchhhHHHHHHHHHHhhhhhhHHhhhcCccc
Q psy7060           7 QDVQRGLLEKELESVGIRLNKKKPNIY------FKQKKAGGIAFNSTCPLTQVNEKLVQLILHEYKIFNAEQKKAGGIAF   80 (160)
Q Consensus         7 ~~~q~~~le~ELe~~GIrLnkk~p~I~------ikkk~~GGI~i~~t~~lt~~~~~~v~~~l~~yki~n~~~~~~~~~~~   80 (160)
                      +.+-+..|.+.|-..-|.+-.++|+-+      |.-.+..-|-|.-|+-+.                             
T Consensus        15 PNvGKSTLlN~l~G~KisIvS~k~QTTR~~I~GI~t~~~~QiIfvDTPGih-----------------------------   65 (298)
T COG1159          15 PNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIVTTDNAQIIFVDTPGIH-----------------------------   65 (298)
T ss_pred             CCCcHHHHHHHHhcCceEeecCCcchhhhheeEEEEcCCceEEEEeCCCCC-----------------------------
Confidence            334567788888888888888888743      111122234444443332                             


Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeec-C--CCh-hHH-HHHHhcCcceeceEEEEecCCCCCHHH
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFRE-D--CNA-DEL-IDVINANRVYLPCIYAYNKIDQISIEE  146 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ire-d--~t~-Ddl-iDvi~~nrvY~P~iyv~NKiD~is~ee  146 (160)
                         -|-+.+++-+++.+-..++--.+.+.+-+ +  .+. |++ ++-+..  .-.|-|.++||||+++.+.
T Consensus        66 ---~pk~~l~~~m~~~a~~sl~dvDlilfvvd~~~~~~~~d~~il~~lk~--~~~pvil~iNKID~~~~~~  131 (298)
T COG1159          66 ---KPKHALGELMNKAARSALKDVDLILFVVDADEGWGPGDEFILEQLKK--TKTPVILVVNKIDKVKPKT  131 (298)
T ss_pred             ---CcchHHHHHHHHHHHHHhccCcEEEEEEeccccCCccHHHHHHHHhh--cCCCeEEEEEccccCCcHH
Confidence               14444778888888888877666555432 2  222 222 222222  4569999999999997766


No 342
>COG1258 Predicted pseudouridylate synthase [Translation, ribosomal structure and biogenesis]
Probab=20.70  E-value=1.2e+02  Score=28.58  Aligned_cols=41  Identities=22%  Similarity=0.279  Sum_probs=34.9

Q ss_pred             CCcccCHHHHHHHH---HHcCccceEEEeecCCChhHHHHHHhc
Q psy7060          85 PLTQVNEKLVQLIL---HEYKIFNAEVLFREDCNADELIDVINA  125 (160)
Q Consensus        85 ~~~~~~e~~V~~IL---~EYkI~NA~V~ired~t~DdliDvi~~  125 (160)
                      +|.-++-+.++.|.   +..|+|-|-|.++++++.+++.+++..
T Consensus       262 ~l~f~~~e~v~~ik~~~~~rK~YrAlV~~~~~v~~e~l~~~~~~  305 (398)
T COG1258         262 DLEFVGREEVEEIKETERHRKVYRALVYSDRPVSDEKLEEVLGS  305 (398)
T ss_pred             EEEecCHHHHHHHHhccccceeEEEEEEECCCcCHHHHHHHHhh
Confidence            56667888888888   578999999999999999999887754


No 343
>PF11263 Attachment_P66:  Borrelia burgdorferi attachment protein P66 ;  InterPro: IPR020967  Borrelia burgdorferi, the agent of Lyme disease, expresses several adhesion molecules that are probably required for initial establishment of infection in mammalian hosts, and for colonization of various tissues within the host.   P66 is an outer membrane protein in B. burgdorferi, the agent of Lyme disease. P66 has a role in the attachment of Borrelia burgdorferi to human cell-surface receptors. Specifically p66 has been identified as a ligand for beta3-chain integrins as mutants in p66 show dramatically reduced attachment to the integrin alpha-v beta-3 []. 
Probab=20.56  E-value=88  Score=27.36  Aligned_cols=48  Identities=33%  Similarity=0.550  Sum_probs=34.6

Q ss_pred             hhhhhHHhhhc---CccccccCCCcccCHHHHHHHHH-HcCccceEEEeecC
Q psy7060          66 KIFNAEQKKAG---GIAFNSTCPLTQVNEKLVQLILH-EYKIFNAEVLFRED  113 (160)
Q Consensus        66 ki~n~~~~~~~---~~~~~~~~~~~~~~e~~V~~IL~-EYkI~NA~V~ired  113 (160)
                      +||-+..||+|   ||+..-..--..-+.++++.|-. .|+-.|||+.-.||
T Consensus        71 rifg~qdkksgig~GI~YGqnLY~~tssn~~iq~Ia~ksFqtlNaEiStYED  122 (233)
T PF11263_consen   71 RIFGEQDKKSGIGLGISYGQNLYKPTSSNKLIQKIAAKSFQTLNAEISTYED  122 (233)
T ss_pred             hhhcccccccceeEeeecccccccCcchhHHHHHHHHHHHhhhceeeeeecc
Confidence            68888888887   44443222222456788999865 89999999988876


No 344
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]
Probab=20.44  E-value=77  Score=29.56  Aligned_cols=80  Identities=28%  Similarity=0.359  Sum_probs=50.8

Q ss_pred             hhhhHHhhhcCcccccc---------------CCCcccCHHHHHHHHHH-cCccceEEEeec-C-CChhHHHHHHhcCcc
Q psy7060          67 IFNAEQKKAGGIAFNST---------------CPLTQVNEKLVQLILHE-YKIFNAEVLFRE-D-CNADELIDVINANRV  128 (160)
Q Consensus        67 i~n~~~~~~~~~~~~~~---------------~~~~~~~e~~V~~IL~E-YkI~NA~V~ire-d-~t~DdliDvi~~nrv  128 (160)
                      |-||-..|+-||++|..               ||   .-.+-|+..+.. ....-|-..+.- | .--.--.-++-+..+
T Consensus        50 id~aPeEk~rGITIntahveyet~~rhyahVDcP---GHaDYvKNMItgAaqmDgAILVVsA~dGpmPqTrEHiLlarqv  126 (394)
T COG0050          50 IDNAPEEKARGITINTAHVEYETANRHYAHVDCP---GHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQV  126 (394)
T ss_pred             hccCchHhhcCceeccceeEEecCCceEEeccCC---ChHHHHHHHhhhHHhcCccEEEEEcCCCCCCcchhhhhhhhhc
Confidence            77788899999999974               55   346778877653 344445444432 1 112223445666777


Q ss_pred             eeceEE-EEecCCCCCHHHHHH
Q psy7060         129 YLPCIY-AYNKIDQISIEEVDR  149 (160)
Q Consensus       129 Y~P~iy-v~NKiD~is~eevd~  149 (160)
                      =.|.|+ .+||+|+.+.+|+-.
T Consensus       127 Gvp~ivvflnK~Dmvdd~elle  148 (394)
T COG0050         127 GVPYIVVFLNKVDMVDDEELLE  148 (394)
T ss_pred             CCcEEEEEEecccccCcHHHHH
Confidence            777665 579999998655433


No 345
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies 
Probab=20.37  E-value=2.4e+02  Score=17.83  Aligned_cols=58  Identities=17%  Similarity=0.175  Sum_probs=33.4

Q ss_pred             ccccCCCcccCHHHHHHHHHHcCccceEEEeecCCCh-hHHHHHHhcCcceeceEEEEecC
Q psy7060          80 FNSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNA-DELIDVINANRVYLPCIYAYNKI  139 (160)
Q Consensus        80 ~~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~-DdliDvi~~nrvY~P~iyv~NKi  139 (160)
                      +++.||.-+.-......+.+.++-.+.-..++-|+.- .++.+-.  +-...|+++++.+-
T Consensus        23 ~~~~C~~C~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~--~i~~~Pt~~~~~~~   81 (101)
T cd02961          23 YAPWCGHCKALAPEYEKLAKELKGDGKVVVAKVDCTANNDLCSEY--GVRGYPTIKLFPNG   81 (101)
T ss_pred             ECCCCHHHHhhhHHHHHHHHHhccCCceEEEEeeccchHHHHHhC--CCCCCCEEEEEcCC
Confidence            3556887777677777887777411222223333432 3444433  33567999999765


No 346
>COG4009 Uncharacterized protein conserved in archaea [Function unknown]
Probab=20.27  E-value=66  Score=24.49  Aligned_cols=19  Identities=32%  Similarity=0.602  Sum_probs=16.1

Q ss_pred             HHHHHHHHHhcCceeccCC
Q psy7060          11 RGLLEKELESVGIRLNKKK   29 (160)
Q Consensus        11 ~~~le~ELe~~GIrLnkk~   29 (160)
                      -+-+++|||++|.++|...
T Consensus        62 ~eev~~ele~mga~in~ds   80 (88)
T COG4009          62 EEEVERELEDMGAEINRDS   80 (88)
T ss_pred             HHHHHHHHHHhCchhcccH
Confidence            4678999999999999753


No 347
>COG1162 Predicted GTPases [General function prediction only]
Probab=20.16  E-value=76  Score=28.37  Aligned_cols=37  Identities=27%  Similarity=0.221  Sum_probs=22.1

Q ss_pred             cCCChhHHHHHHh-cCcceeceEEEEecCCCCCHHHHH
Q psy7060         112 EDCNADELIDVIN-ANRVYLPCIYAYNKIDQISIEEVD  148 (160)
Q Consensus       112 ed~t~DdliDvi~-~nrvY~P~iyv~NKiD~is~eevd  148 (160)
                      .+.+...|-..+- ..--=+.-++++||+|+.+.|+..
T Consensus        92 P~~~~~~ldR~Lv~ae~~gi~pvIvlnK~DL~~~~~~~  129 (301)
T COG1162          92 PDFNTNLLDRYLVLAEAGGIEPVIVLNKIDLLDDEEAA  129 (301)
T ss_pred             CCCCHHHHHHHHHHHHHcCCcEEEEEEccccCcchHHH
Confidence            3455444443332 233334567779999999876665


No 348
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=20.09  E-value=64  Score=30.14  Aligned_cols=15  Identities=27%  Similarity=0.248  Sum_probs=13.2

Q ss_pred             eeceEEEEecCCCCC
Q psy7060         129 YLPCIYAYNKIDQIS  143 (160)
Q Consensus       129 Y~P~iyv~NKiD~is  143 (160)
                      =+|.|+++||+|...
T Consensus       131 ~iPiiv~iNK~D~~~  145 (526)
T PRK00741        131 DTPIFTFINKLDRDG  145 (526)
T ss_pred             CCCEEEEEECCcccc
Confidence            479999999999874


No 349
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others.
Probab=20.05  E-value=1.7e+02  Score=15.82  Aligned_cols=56  Identities=9%  Similarity=0.059  Sum_probs=29.1

Q ss_pred             cccCCCcccCHHHHHHHHHHcCccceEEEeecCCChhHHHH-HHhcCcceeceEEEEec
Q psy7060          81 NSTCPLTQVNEKLVQLILHEYKIFNAEVLFREDCNADELID-VINANRVYLPCIYAYNK  138 (160)
Q Consensus        81 ~~~~~~~~~~e~~V~~IL~EYkI~NA~V~ired~t~DdliD-vi~~nrvY~P~iyv~NK  138 (160)
                      .+.||.-+.-...+.++  ++.-.+..+....--...+..+ ....+..+.|.+++++.
T Consensus         6 ~~~c~~c~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~   62 (69)
T cd01659           6 APWCPFCQALRPVLAEL--ALLNKGVKFEAVDVDEDPALEKELKRYGVGGVPTLVVFGP   62 (69)
T ss_pred             CCCChhHHhhhhHHHHH--HhhCCCcEEEEEEcCCChHHhhHHHhCCCccccEEEEEeC
Confidence            45666665555555555  3333344443333222222222 23456778899988874


Done!