Diaphorina citri psyllid: psy706


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MAKAKALPRDHPESYHYYMWHNFFSHIDIQPENVHILDGNAPDLHAECVQYEKDIKEAGGIHLFVGGEVLIGQIRSYNSESRKISRNTDVK
ccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccc
***AKALPRDHPESYHYYMWHNFFSHIDIQPENVHILDGNAPDLHAECVQYEKDIKEAGGIHLFVGGEVLIGQIRSYNSE***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKAKALPRDHPESYHYYMWHNFFSHIDIQPENVHILDGNAPDLHAECVQYEKDIKEAGGIHLFVGGEVLIGQIRSYNSESRKISRNTDVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucosamine-6-phosphate deaminase Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.confidentQ4QP46
Glucosamine-6-phosphate isomerase confidentQ29NT9
Glucosamine-6-phosphate deaminase Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.confidentA4SPM2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901071 [BP]glucosamine-containing compound metabolic processprobableGO:0006040, GO:0071704, GO:1901135, GO:0008150, GO:0008152
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HN6, chain A
Confidence level:very confident
Coverage over the Query: 1-90
View the alignment between query and template
View the model in PyMOL