RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy7073
         (127 letters)



>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin.  A
          single instance of the C2 domain is located C
          terminally in the intersectin protein.  Intersectin
          functions as a scaffolding protein, providing a link
          between the actin cytoskeleton and the components of
          endocytosis and plays a role in signal transduction. 
          In addition to C2, intersectin contains several
          additional domains including: Eps15 homology domains,
          SH3 domains, a RhoGEF domain, and a PH domain.  C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. The members here have topology I.
          Length = 136

 Score =  117 bits (296), Expect = 3e-35
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)

Query: 4  GYKLKA--PTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITV 61
          G  LK      K   +C+V+MGSQEH T ++S +TL PKWNSSMQF +KD+++DVLCITV
Sbjct: 24 GRDLKPCNSNGKSDPYCEVSMGSQEHKTKVVS-DTLNPKWNSSMQFFVKDLEQDVLCITV 82

Query: 62 FDKGHYSPDEFLGKT 76
          FD+  +SPD+FLG+T
Sbjct: 83 FDRDFFSPDDFLGRT 97


>gnl|CDD|175973 cd00030, C2, C2 domain.  The C2 domain was first identified in
          PKC. C2 domains fold into an 8-standed beta-sandwich
          that can adopt 2 structural arrangements: Type I and
          Type II, distinguished by a circular permutation
          involving their N- and C-terminal beta strands. Many C2
          domains are Ca2+-dependent membrane-targeting modules
          that bind a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 102

 Score = 56.7 bits (137), Expect = 1e-11
 Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 2/62 (3%)

Query: 17 FCQVTMG-SQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
          + +V++G  Q+  T ++  NTL P WN + +F + D + D L + V+DK  +S D+FLG+
Sbjct: 23 YVKVSLGGKQKFKTKVVK-NTLNPVWNETFEFPVLDPESDTLTVEVWDKDRFSKDDFLGE 81

Query: 76 TK 77
           +
Sbjct: 82 VE 83


>gnl|CDD|215765 pfam00168, C2, C2 domain. 
          Length = 85

 Score = 55.7 bits (135), Expect = 2e-11
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 4/75 (5%)

Query: 6  KLKAPTHKRQVFCQVTMGSQE---HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVF 62
            K    K   + +V++G Q+     T ++  NTL P WN +  F +   +   L I V+
Sbjct: 12 PPKDLNGKSDPYVKVSLGGQKKDTKKTKVVK-NTLNPVWNETFTFEVTLPELAELRIEVY 70

Query: 63 DKGHYSPDEFLGKTK 77
          D   +  D+F+G+  
Sbjct: 71 DYDRFGKDDFIGEVT 85


>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
          Ca2+-binding motif present in phospholipases, protein
          kinases C, and synaptotagmins (among others). Some do
          not appear to contain Ca2+-binding sites. Particular
          C2s appear to bind phospholipids, inositol
          polyphosphates, and intracellular proteins. Unusual
          occurrence in perforin. Synaptotagmin and PLC C2s are
          permuted in sequence with respect to N- and C-terminal
          beta strands. SMART detects C2 domains using one or
          both of two profiles.
          Length = 101

 Score = 53.6 bits (129), Expect = 2e-10
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 6  KLKAPTHKRQVFCQVTMGSQEHT---TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVF 62
            K    K   + +V++         T ++  NTL P WN + +F +   +   L I V+
Sbjct: 13 PPKDKGGKSDPYVKVSLDGDPKEKKKTKVVK-NTLNPVWNETFEFEVPPPELAELEIEVY 71

Query: 63 DKGHYSPDEFLGKT 76
          DK  +  D+F+G+ 
Sbjct: 72 DKDRFGRDDFIGQV 85


>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present
          in Synaptotagmin-like proteins.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-I topology.
          Length = 128

 Score = 47.4 bits (113), Expect = 7e-08
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 20 VTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
          +++G+Q   T  I  NTL PKWN   +F I   Q  +L + ++DK  ++  ++LG
Sbjct: 30 LSVGAQRFKTQTIP-NTLNPKWNYWCEFPIFSAQNQLLKLILWDKDRFAGKDYLG 83


>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          The cds in this family contain multiple C2 domains as
          well as a C-terminal PRT domain.  It is one of four
          protein classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the third C2 repeat, C2C, and has a
          type-II topology.
          Length = 119

 Score = 45.4 bits (108), Expect = 3e-07
 Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 13 KRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEF 72
          K   FC + + +    T  I   TL P+WN    F IKD+  DVL +TV+D+      EF
Sbjct: 21 KSDPFCVLELVNARLQTHTIY-KTLNPEWNKIFTFPIKDIH-DVLEVTVYDEDKDKKPEF 78

Query: 73 LGK 75
          LGK
Sbjct: 79 LGK 81


>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
          Proteins (GAP).  ArfGAP is a GTPase activating protein
          which regulates the ADP ribosylation factor Arf, a
          member of the Ras superfamily of GTP-binding proteins. 
          The GTP-bound form of Arf is involved in Golgi
          morphology and is involved in recruiting coat proteins.
           ArfGAP is responsible for the GDP-bound form of Arf
          which is necessary for uncoating the membrane and
          allowing the Golgi to fuse with an acceptor
          compartment.  These proteins contain an N-terminal
          ArfGAP domain containing the characteristic zinc finger
          motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2
          domain. C2 domains were first identified in Protein
          Kinase C (PKC). C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 145

 Score = 45.4 bits (108), Expect = 5e-07
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%)

Query: 20 VTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
          +T+G+Q+  T +I    L P WN  +   + +     L + VFDK  +S D+ +G
Sbjct: 28 LTLGNQKVKTRVIK-KNLNPVWNEELTLSVPNP-MAPLKLEVFDKDTFSKDDSMG 80


>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present
          in Synaptotagmin-like proteins.  Synaptotagmin is a
          membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 105

 Score = 41.4 bits (98), Expect = 8e-06
 Identities = 11/51 (21%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 16 VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGH 66
           + ++T+G     + +    T  P W     FL+++ +   L I V D   
Sbjct: 23 PYVELTVGKTTQKSKVKE-RTNNPVWEEGFTFLVRNPENQELEIEVKDDKT 72


>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad
          ubiquitination-related factor (Smurf)-like proteins.  A
          single C2 domain is found in Smurf proteins,
          C2-WW-HECT-domain E3s, which play an important role in
          the downregulation of the TGF-beta signaling pathway.
          Smurf proteins also regulate cell shape, motility, and
          polarity by degrading small guanosine triphosphatases
          (GTPases). C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have type-II topology.
          Length = 123

 Score = 40.8 bits (96), Expect = 2e-05
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 17 FCQVTM-GSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSP--DEFL 73
          F  +T+ G Q H+T +    TL+PKWN      +      ++ I VFD+  +      FL
Sbjct: 24 FAVITVDGGQTHSTDVAK-KTLDPKWNEHFDLTVG--PSSIITIQVFDQKKFKKKDQGFL 80

Query: 74 G 74
          G
Sbjct: 81 G 81


>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13
           (mammalian uncoordinated)-like proteins.  C2-like
           domains are thought to be involved in phospholipid
           binding in a Ca2+ independent manner in both Unc13 and
           Munc13. Caenorabditis elegans Unc13 has a central domain
           with sequence similarity to PKC, which includes C1 and
           C2-related domains. Unc13 binds phorbol esters and DAG
           with high affinity in a phospholipid manner.  Mutations
           in Unc13 results in abnormal neuronal connections and
           impairment in cholinergic neurotransmission in the
           nematode.  Munc13 is the mammalian homolog which are
           expressed in the brain.  There are 3 isoforms (Munc13-1,
           -2, -3) and are thought to play a role in
           neurotransmitter release and are hypothesized to be
           high-affinity receptors for phorbol esters.  Unc13 and
           Munc13 contain both C1 and C2 domains.  There are two C2
           related domains present, one central and one at the
           carboxyl end.  Munc13-1 contains a third C2-like domain.
            Munc13 interacts with syntaxin, synaptobrevin, and
           synaptotagmin suggesting a role for these as scaffolding
           proteins. C2 domains fold into an 8-standed
           beta-sandwich that can adopt 2 structural arrangements:
           Type I and Type II, distinguished by a circular
           permutation involving their N- and C-terminal beta
           strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-II topology.
          Length = 153

 Score = 41.2 bits (97), Expect = 2e-05
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 27  HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
             T +    TL P WN + +F ++DV  D L + ++D      D+FLG
Sbjct: 91  KVTEVKP-QTLNPVWNETFRFEVEDVSNDQLHLDIWDHD----DDFLG 133


>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
          repeat in Synaptotagmin-like proteins.  Synaptotagmin
          is a membrane-trafficking protein characterized by a
          N-terminal transmembrane region, a linker, and 2
          C-terminal C2 domains. Previously all synaptotagmins
          were thought to be calcium sensors in the regulation of
          neurotransmitter release and hormone secretion, but it
          has been shown that not all of them bind calcium.  Of
          the 17 identified synaptotagmins only 8 bind calcium
          (1-3, 5-7, 9, 10).  The function of the two C2 domains
          that bind calcium are: regulating the fusion step of
          synaptic vesicle exocytosis (C2A) and  binding to
          phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
          absence of calcium ions and to phosphatidylinositol
          bisphosphate (PIP2) in their presence (C2B).  C2B also
          regulates also the recycling step of synaptic vesicles.
          C2 domains fold into an 8-standed beta-sandwich that
          can adopt 2 structural arrangements: Type I and Type
          II, distinguished by a circular permutation involving
          their N- and C-terminal beta strands. Many C2 domains
          are Ca2+-dependent membrane-targeting modules that bind
          a wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains either the first or
          third repeat in Synaptotagmin-like proteins with a
          type-I topology.
          Length = 121

 Score = 40.7 bits (96), Expect = 2e-05
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDK--GHYSPDEFLG 74
          +  V +G+Q   + +I    L PKWN   + ++ +V    L I +FD+       D+FLG
Sbjct: 31 YVIVRVGAQTFKSKVIK-ENLNPKWNEVYEAVVDEVPGQELEIELFDEDPDK---DDFLG 86

Query: 75 KTK 77
          +  
Sbjct: 87 RLS 89


>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 111

 Score = 39.5 bits (93), Expect = 4e-05
 Identities = 15/62 (24%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 17 FCQVTMGSQE-HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
          + ++ +  +  +TT +    T  P WN+S +FL+ D ++  + + V D      D  LG 
Sbjct: 16 YAELYLNGKLVYTTRVKK-KTNNPSWNASTEFLVTDRRKSRVTVVVKDD-RDRHDPVLGS 73

Query: 76 TK 77
            
Sbjct: 74 VS 75


>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528
          cDNA clone.  The members of this CD are named after the
          Human KIAA0528 cDNA clone.  All members here contain a
          single C2 repeat.  No other information on this protein
          is currently known. The C2 domain was first identified
          in PKC.  C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 110

 Score = 39.2 bits (92), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSS-MQFLIKD--VQEDVLCITVFDKGHYSPDEFL 73
          F +V  GS  + T ++   +L P WNS   +F + D  +Q++ L I V D   YS ++ +
Sbjct: 24 FVEVKFGSTTYKTDVVK-KSLNPVWNSEWFRFEVDDEELQDEPLQIRVMDHDTYSANDAI 82

Query: 74 GKT 76
          GK 
Sbjct: 83 GKV 85


>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in
          Phosphoinositide-specific phospholipases C (PLC).  PLCs
          are involved in the hydrolysis of
          phosphatidylinositol-4,5-bisphosphate (PIP2) to
          d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and
          sn-1,2-diacylglycerol (DAG).   1,4,5-IP3 and DAG are
          second messengers in eukaryotic signal transduction
          cascades. PLC is composed of a N-terminal PH domain
          followed by a series of EF hands, a catalytic TIM
          barrel and a C-terminal C2 domain. C2 domains fold into
          an 8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members here have a type-II topology.
          Length = 128

 Score = 39.4 bits (93), Expect = 6e-05
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 24 SQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
          S +  T ++  N   P WN + +F +   +   L   V+D+     D+FLG
Sbjct: 41 SAKFKTKVVKNNGFNPVWNETFEFDVTVPELAFLRFVVYDED-SGDDDFLG 90


>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in
          RasA1 and RasA4.  RasA1 and RasA4 are GAP1s (GTPase
          activating protein 1s ), Ras-specific GAP members,
          which suppresses Ras function by enhancing the GTPase
          activity of Ras proteins resulting in the inactive
          GDP-bound form of Ras.  In this way it can control
          cellular proliferation and differentiation.  Both
          proteins contain two C2 domains,  a Ras-GAP domain, a
          plextrin homology (PH)-like domain, and a Bruton's
          Tyrosine Kinase (BTK) zinc binding domain. C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the second C2
          repeat, C2B, and has a type-I topology.
          Length = 123

 Score = 38.6 bits (90), Expect = 1e-04
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
          F +V    Q   TS++   +  P+WN   +F + +  +  L + V+D    S ++FLGK
Sbjct: 24 FVRVFYNGQTLETSVVK-KSCYPRWNEVFEFELMEGADSPLSVEVWDWDLVSKNDFLGK 81


>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in
           Multiple C2 domain and Transmembrane region Proteins
           (MCTP); plant subset.  MCTPs are involved in Ca2+
           signaling at the membrane.  Plant-MCTPs are composed of
           a variable N-terminal sequence, four C2 domains, two
           transmembrane regions (TMRs), and a short C-terminal
           sequence.  It is one of four protein classes that are
           anchored to membranes via a transmembrane region; the
           others being synaptotagmins, extended synaptotagmins,
           and ferlins. MCTPs are the only membrane-bound C2 domain
           proteins that contain two functional TMRs. MCTPs are
           unique in that they bind Ca2+ but not phospholipids. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the third C2
           repeat, C2C, and has a type-II topology.
          Length = 150

 Score = 36.9 bits (86), Expect = 7e-04
 Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 8/80 (10%)

Query: 16  VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
           VF +  +G+Q   T         P WN  + F+  +  ED L ++V D+   + DE LG+
Sbjct: 23  VFVKAQLGNQVLRTRPSQTRNGNPSWNEELMFVAAEPFEDHLILSVEDRVGPNKDEPLGR 82

Query: 76  T--------KRVKGEAINPR 87
                    +RV    +  R
Sbjct: 83  AVIPLNDIERRVDDRPVPSR 102


>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in
           the putative elicitor-responsive gene.  In plants
           elicitor-responsive proteins are triggered in response
           to specific elicitor molecules such as glycolproteins,
           peptides, carbohydrates and lipids. A host of defensive
           responses are also triggered resulting in localized cell
           death.  Antimicrobial secondary metabolites, such as
           phytoalexins, or defense-related proteins, including
           pathogenesis-related (PR) proteins  are also produced.
           There is a single C2 domain present here.  C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members have a type-II
           topology.
          Length = 124

 Score = 35.0 bits (81), Expect = 0.002
 Identities = 16/83 (19%), Positives = 33/83 (39%), Gaps = 10/83 (12%)

Query: 17  FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDV---LCITVFDKGHYSPDEFL 73
           +  +   +QE  + +   +   P+WN   +F ++         L + + DK ++S D+F+
Sbjct: 25  YVIIQCRTQERKSKVAKGDGRNPEWNEKFKFTVEYPGWGGDTKLILRIMDKDNFSDDDFI 84

Query: 74  GKTKRVKGEAINPREPNLLMGSL 96
                  GEA    +     G  
Sbjct: 85  -------GEATIHLKGLFEEGVE 100


>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase
          A2 (cPLA2).  A single copy of the C2 domain is present
          in cPLA2 which releases arachidonic acid from membranes
          initiating the biosynthesis of potent inflammatory
          mediators such as prostaglandins, leukotrienes, and
          platelet-activating factor.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Members of this cd have a type-II topology.
          Length = 119

 Score = 34.9 bits (81), Expect = 0.003
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 35 NTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
          N++ P WN + +F I+   ++VL +TV D+  Y  D+ LG  
Sbjct: 44 NSINPVWNETFEFRIQSQVKNVLELTVMDE-DYVMDDHLGTV 84


>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in
          Multiple C2 domain and Transmembrane region Proteins
          (MCTP); plant subset.  MCTPs are involved in Ca2+
          signaling at the membrane.  Plant-MCTPs are composed of
          a variable N-terminal sequence, four C2 domains, two
          transmembrane regions (TMRs), and a short C-terminal
          sequence.  It is one of four protein classes that are
          anchored to membranes via a transmembrane region; the
          others being synaptotagmins, extended synaptotagmins,
          and ferlins. MCTPs are the only membrane-bound C2
          domain proteins that contain two functional TMRs. MCTPs
          are unique in that they bind Ca2+ but not
          phospholipids. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 121

 Score = 34.6 bits (80), Expect = 0.003
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 8  KAPTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHY 67
            P +      +V +G+ + +T  I   T  P+WN    F    +Q   L ++V+DK   
Sbjct: 11 GLPANSNDPVVEVKLGNYKGSTKAIE-RTSNPEWNQVFAFSKDRLQGSTLEVSVWDKD-K 68

Query: 68 SPDEFLGK 75
          + D+FLG 
Sbjct: 69 AKDDFLGG 76


>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal
          Ingression 1 (Inn1) proteins.  Saccharomyces cerevisiae
          Inn1 associates with the contractile actomyosin ring at
          the end of mitosis and is needed for cytokinesis. The
          C2 domain of Inn1, located at the N-terminus, is
          required for ingression of the plasma membrane. The
          C-terminus is relatively unstructured and contains
          eight PXXP motifs that are thought to mediate
          interaction of Inn1 with other proteins with SH3
          domains in the cytokinesis proteins Hof1 (an F-BAR
          protein) and Cyk3 (whose overexpression can restore
          primary septum formation in Inn1Delta cells) as well as
          recruiting Inn1 to the bud-neck by binding to Cyk3.
          Inn1 and Cyk3 appear to cooperate in activating chitin
          synthase Chs2 for primary septum formation, which
          allows coordination of actomyosin ring contraction with
          ingression of the cleavage furrow. It is thought that
          the C2 domain of Inn1 helps to preserve the link
          between the actomyosin ring and the plasma membrane,
          contributing both to membrane ingression, as well as to
          stability of the contracting ring. Additionally, Inn1
          might induce curvature of the plasma membrane adjacent
          to the contracting ring, thereby promoting ingression
          of the membrane. It has been shown that the C2 domain
          of human synaptotagmin induces curvature in target
          membranes and thereby contributes to fusion of these
          membranes with synaptic vesicles. The C2 domain was
          first identified in PKC. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins. Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin1.  However,
          there are a few exceptions to this including RIM
          isoforms and some splice variants of piccolo/aczonin
          and intersectin which only have a single C2 domain. C2
          domains with a calcium binding region have negatively
          charged residues, primarily aspartates, that serve as
          ligands for calcium ions.
          Length = 118

 Score = 34.1 bits (79), Expect = 0.005
 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 13 KRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEF 72
          K+  +C + +G     T         P+W+  ++F I + ++ +L + VFD     PD  
Sbjct: 21 KQDPYCVLRIGGVTKKTKTDFRGGQHPEWDEELRFEITEDKKPILKVAVFDDDKRKPD-L 79

Query: 73 LGKT 76
          +G T
Sbjct: 80 IGDT 83


>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 124

 Score = 33.7 bits (78), Expect = 0.008
 Identities = 12/48 (25%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 29 TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
          T +   +T  P WN +   L+  +  + L +TV+D      D+ +G  
Sbjct: 41 TKVKK-DTSNPVWNETKYILVNSLT-EPLNLTVYDFNDKRKDKLIGTA 86


>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the fourth C2
          repeat, C2D, and has a type-II topology.
          Length = 135

 Score = 33.7 bits (78), Expect = 0.008
 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 10/69 (14%)

Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQF-------LIKDVQED--VLCITVFDKGHY 67
          F +V+  +Q   T +I   TL P W+ ++ F         +++ ++  ++ + +FD+   
Sbjct: 25 FARVSFLNQSQETEVIK-ETLSPTWDQTLIFDEVELYGSPEEIAQNPPLVVVELFDQDSV 83

Query: 68 SPDEFLGKT 76
            DEFLG++
Sbjct: 84 GKDEFLGRS 92


>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in
           Synaptotagmin-like proteins 1-4.  All Slp members
           basically share an N-terminal Slp homology domain (SHD)
           and C-terminal tandem C2 domains (named the C2A domain
           and the C2B domain) with the SHD and C2 domains being
           separated by a linker sequence of various length.
           Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
           to the plasma membrane.  Additionally, their C2A domains
           are both Ca2+ independent, unlike the case in Slp3 and
           Slp4/granuphilin in which their C2A domains are Ca2+
           dependent.  It is thought that SHD (except for the
           Slp4-SHD) functions as a specific Rab27A/B-binding
           domain. In addition to Slps, rabphilin, Noc2, and
           Munc13-4 also function as Rab27-binding proteins. It has
           been demonstrated that Slp3 and Slp4/granuphilin promote
           dense-core vesicle exocytosis. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions.   This cd contains the second
           C2 repeat, C2B, and has a type-I topology.
          Length = 162

 Score = 32.7 bits (75), Expect = 0.023
 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 36  TLEPKWNSSM---QFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
           ++ P WN +        +D+ +  L +TV+D    S ++FLG
Sbjct: 74  SVNPVWNHTFVYDGVSPEDLSQACLELTVWDHDKLSSNDFLG 115


>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
           Rab3-interacting molecule (RIM) proteins.  RIMs are
           believed to organize specialized sites of the plasma
           membrane called active zones.  They also play a role in
           controlling neurotransmitter release, plasticity
           processes, as well as memory and learning.  RIM contains
           an N-terminal zinc finger domain, a PDZ domain, and two
           C-terminal C2 domains (C2A, C2B).  C2 domains fold into
           an 8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology and do not bind Ca2+.
          Length = 125

 Score = 32.2 bits (74), Expect = 0.026
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 35  NTLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKT 76
            TL P+WN + ++     + ++E  L +TV+D      ++FLG+ 
Sbjct: 62  KTLNPEWNQTFEYSNVRRETLKERTLEVTVWDYDRDGENDFLGEV 106


>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in
           Multiple C2 domain and Transmembrane region Proteins
           (MCTP); plant subset.  MCTPs are involved in Ca2+
           signaling at the membrane.  Plant-MCTPs are composed of
           a variable N-terminal sequence, four C2 domains, two
           transmembrane regions (TMRs), and a short C-terminal
           sequence.  It is one of four protein classes that are
           anchored to membranes via a transmembrane region; the
           others being synaptotagmins, extended synaptotagmins,
           and ferlins. MCTPs are the only membrane-bound C2 domain
           proteins that contain two functional TMRs. MCTPs are
           unique in that they bind Ca2+ but not phospholipids. C2
           domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-II topology.
          Length = 127

 Score = 31.9 bits (73), Expect = 0.032
 Identities = 18/80 (22%), Positives = 32/80 (40%), Gaps = 6/80 (7%)

Query: 17  FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDV---QEDVLCITVF-DKGHYSPDEF 72
           + ++    Q+  T       L P WN  + F + D       VL + V+ D+       F
Sbjct: 24  YVELDFDGQKKRTRTK-PKDLNPVWNEKLVFNVSDPSRLSNLVLEVYVYNDRRSGRRRSF 82

Query: 73  LGKTKRVKGEAINPREPNLL 92
           LG+  R+ G +  P    ++
Sbjct: 83  LGRV-RISGTSFVPPSEAVV 101


>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural
          precursor cell-expressed, developmentally
          down-regulated 4 (NEDD4) and NEDD4-like
          (NEDD4L/NEDD42).  Nedd4 and Nedd4-2 are two of the nine
          members of the Human Nedd4 family.  All vertebrates
          appear to have both Nedd4 and Nedd4-2 genes. They are
          thought to participate in the regulation of epithelial
          Na+ channel (ENaC) activity. They also have identical
          specificity for ubiquitin conjugating enzymes (E2).
          Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW
          domains, and a ubiquitin ligase Hect domain. Their WW
          domains can bind PPxY (PY) or LPSY motifs, and in vitro
          studies suggest that WW3 and WW4 of both proteins bind
          PY motifs in the key substrates, with WW3 generally
          exhibiting higher affinity. Most Nedd4 family members,
          especially Nedd4-2, also have multiple splice variants,
          which might play different roles in regulating their
          substrates. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          Length = 133

 Score = 31.6 bits (72), Expect = 0.053
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
          TL PKWN    F + + +E  L   VFD+   + D+FLG
Sbjct: 49 TLNPKWNEEFFFRV-NPREHRLLFEVFDENRLTRDDFLG 86


>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          MCTP is composed of a variable N-terminal sequence,
          three C2 domains, two transmembrane regions (TMRs), and
          a short C-terminal sequence.  It is one of four protein
          classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 116

 Score = 31.1 bits (71), Expect = 0.063
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 15 QVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
            + +  +G++++  S +   TL P+W       + D Q  +L I V+DK     DEF+G
Sbjct: 22 DPYVKFRLGNEKYK-SKVCSKTLNPQWLEQFDLHLFDDQSQILEIEVWDKDTGKKDEFIG 80

Query: 75 KTK 77
          + +
Sbjct: 81 RCE 83


>gnl|CDD|200510 cd11249, Sema_3A, The Sema domain, a protein interacting module, of
           semaphorin 3A (Sema3A).  Sema3A has been reported to
           inhibit the growth of certain experimental tumors and to
           regulate endothelial cell migration and apoptosis in
           vitro, as well as arteriogenesis in the muscle, skin
           vessel permeability, and tumor angiogenesis in vivo. The
           function of Sema3A is mediated through receptors
           neuropilin-1 (NP1) and plexins, although little is known
           about the requirement of specific plexins in its
           receptor complex. It is known however that Plexin-A4 is
           the receptor for Sema3A in the Toll-like receptor- and
           sepsis-induced cytokine storm during immune response.
           Sema3A is a member of the Class 3 semaphorin family of
           secreted proteins. Semaphorins are regulatory molecules
           in the development of the nervous system and in axonal
           guidance. They also play important roles in other
           biological processes, such as angiogenesis, immune
           regulation, respiration systems and cancer. The Sema
           domain is located at the N-terminus and contains four
           disulfide bonds formed by eight conserved cysteine
           residues. It serves as a receptor-recognition and
           -binding module.
          Length = 493

 Score = 31.1 bits (70), Expect = 0.13
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 60  TVFDKGHYSPDEF--LGKTKRVKGEAINPREPNLLMGSLCSKYVLYKFTVAEIIQRKFKL 117
           T  + GH+  D    L  +    G   +P +P LL  SL     LY  T A+ + R F +
Sbjct: 117 TYIEVGHHPEDNIFRLEDSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAI 176

Query: 118 LR 119
            R
Sbjct: 177 FR 178


>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
           alpha and gamma.  A single C2 domain is found in PKC
           alpha and gamma. The PKC family of serine/threonine
           kinases regulates apoptosis, proliferation, migration,
           motility, chemo-resistance, and differentiation.  There
           are 3 groups: group 1(alpha, betaI, beta II, gamma)
           which require phospholipids and calcium, group 2 (delta,
           epsilon, theta, eta) which do not require calcium for
           activation, and group 3 (xi, iota/lambda) which are
           atypical and can be activated in the absence of
           diacylglycerol and calcium. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. Members here have a type-I
           topology.
          Length = 131

 Score = 29.9 bits (68), Expect = 0.17
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 36  TLEPKWNSSMQFLIKDVQEDV-LCITVFDKGHYSPDEFLGK 75
           TL P WN +  F +K   +D  L I V+D    + ++F+G 
Sbjct: 60  TLNPVWNETFTFDLKPADKDRRLSIEVWDWDRTTRNDFMGS 100


>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 133

 Score = 30.0 bits (68), Expect = 0.19
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 27  HTTSIISINTLEPKWNSSMQFLIK--DVQEDVLCITVFDKGHYSPDEFLG 74
           H T +    TL P++N    + IK  D+ +  L ITV+DK     ++++G
Sbjct: 52  HKTQV-KKKTLNPEFNEEFFYDIKHSDLAKKTLEITVWDKDIGKSNDYIG 100


>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in
           Rabphilin and Double C2 domain.  Rabphilin is found
           neurons and in neuroendrocrine cells, while Doc2 is
           found not only in the brain but in tissues, including
           mast cells, chromaffin cells, and osteoblasts.
           Rabphilin and Doc2s share highly homologous tandem C2
           domains, although their N-terminal structures are
           completely different: rabphilin contains an N-terminal
           Rab-binding domain (RBD),7 whereas Doc2 contains an
           N-terminal Munc13-1-interacting domain (MID). C2 domains
           fold into an 8-standed beta-sandwich that can adopt 2
           structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 123

 Score = 29.9 bits (68), Expect = 0.20
 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 4/46 (8%)

Query: 35  NTLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
            T  P++N ++ +     +D+Q   L + V D+  +  ++FLG+T+
Sbjct: 61  KTRNPEFNETLTYYGITEEDIQRKTLRLLVLDEDRFG-NDFLGETR 105


>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the fifth C2 repeat,
          C2E, and has a type-II topology.
          Length = 124

 Score = 29.4 bits (67), Expect = 0.25
 Identities = 11/44 (25%), Positives = 18/44 (40%)

Query: 34 INTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
           NTL P +    +         +L I+V D      D+ +G+T 
Sbjct: 42 PNTLNPVFGKMFELEATLPGNSILKISVMDYDLLGSDDLIGETV 85


>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in
           Synaptotagmin.  Synaptotagmin is a membrane-trafficking
           protein characterized by a N-terminal transmembrane
           region, a linker, and 2 C-terminal C2 domains. There are
           several classes of Synaptotagmins. Previously all
           synaptotagmins were thought to be calcium sensors in the
           regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 134

 Score = 29.5 bits (67), Expect = 0.28
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 29  TSIISINTLEPKWNSSMQFLIKD--VQEDVLCITVFDKGHYSPDEFLGKT 76
           TS+    TL P +N +  F +    ++E  L ITV DK     +E +G+ 
Sbjct: 55  TSVK-KGTLNPVFNEAFSFDVPAEQLEEVSLVITVVDKDSVGRNEVIGQV 103


>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
          Tricalbin-like proteins.  5 to 6 copies of the C2
          domain are present in Tricalbin, a yeast homolog of
          Synaptotagmin, which is involved in membrane
          trafficking and sorting.  C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the fifth C2 repeat, C2E, and has a
          type-II topology.
          Length = 115

 Score = 29.1 bits (66), Expect = 0.31
 Identities = 13/42 (30%), Positives = 18/42 (42%)

Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
          TL P WN S +  +      VL + V+D      D+ LG   
Sbjct: 42 TLNPVWNESFEVPVPSRVRAVLKVEVYDWDRGGKDDLLGSAY 83


>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family
          interacting proteins (FIP) class I.  Rab GTPases
          recruit various effector proteins to organelles and
          vesicles.  Rab11-family interacting proteins (FIPs) are
          involved in mediating the role of Rab11. FIPs can be
          divided into three classes: class I FIPs (Rip11a,
          Rip11b, RCP, and FIP2) which contain a C2 domain after
          N-terminus of the protein, class II FIPs (FIP3 and
          FIP4) which contain two EF-hands and a proline rich
          region, and class III FIPs (FIP1) which exhibits no
          homology to known protein domains. All FIP proteins
          contain a highly conserved, 20-amino acid motif at the
          C-terminus of the protein, known as Rab11/25 binding
          domain (RBD).  Class I FIPs are thought to bind to
          endocytic membranes via their C2 domain, which
          interacts directly with phospholipids. Class II FIPs do
          not have any membrane binding domains leaving much to
          speculate about the mechanism involving FIP3 and FIP4
          interactions with endocytic membranes. The members in
          this CD are class I FIPs.  The exact function of the
          Rab11 and FIP interaction is unknown, but there is
          speculation that it involves the role of forming a
          targeting complex that recruits a group of proteins
          involved in membrane transport to organelles. The C2
          domain was first identified in PKC. C2 domains fold
          into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins. Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain. C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 126

 Score = 28.6 bits (64), Expect = 0.63
 Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 6/79 (7%)

Query: 4  GYKLKAPTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQF-----LIKDVQEDVLC 58
          G   K  +     +  + +G ++++TS+    T  P W     F     L  +     L 
Sbjct: 10 GLLCKGKSGTNDAYVIIQLGKEKYSTSVKE-KTTSPVWKEECSFELPGLLSGNGNRATLQ 68

Query: 59 ITVFDKGHYSPDEFLGKTK 77
          +TV  +     D+FLG+  
Sbjct: 69 LTVMHRNLLGLDKFLGQVS 87


>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in
           Synaptotagmin 1.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains.  Synaptotagmin 1, a member of the
           class 1 synaptotagmins, is located in the brain and
           endocranium and localized to the synaptic vesicles and
           secretory granules.  It functions as a Ca2+ sensor for
           fast exocytosis. It, like synaptotagmin-2, has an
           N-glycosylated N-terminus. Synaptotagmin 4, a member of
           class 4 synaptotagmins, is located in the brain.  It
           functions are unknown. It, like synaptotagmin-11, has an
           Asp to Ser substitution in its C2A domain. Previously
           all synaptotagmins were thought to be calcium sensors in
           the regulation of neurotransmitter release and hormone
           secretion, but it has been shown that not all of them
           bind calcium.  Of the 17 identified synaptotagmins only
           8 bind calcium (1-3, 5-7, 9, 10).  The function of the
           two C2 domains that bind calcium are: regulating the
           fusion step of synaptic vesicle exocytosis (C2A) and
           binding to phosphatidyl-inositol-3,4,5-triphosphate
           (PIP3) in the absence of calcium ions and to
           phosphatidylinositol bisphosphate (PIP2) in their
           presence (C2B).  C2B also regulates also the recycling
           step of synaptic vesicles. C2 domains fold into an
           8-standed beta-sandwich that can adopt 2 structural
           arrangements: Type I and Type II, distinguished by a
           circular permutation involving their N- and C-terminal
           beta strands. Many C2 domains are Ca2+-dependent
           membrane-targeting modules that bind a wide variety of
           substances including bind phospholipids, inositol
           polyphosphates, and intracellular proteins.  Most C2
           domain proteins are either signal transduction enzymes
           that contain a single C2 domain, such as protein kinase
           C, or membrane trafficking proteins which contain at
           least two C2 domains, such as synaptotagmin 1.  However,
           there are a few exceptions to this including RIM
           isoforms and some splice variants of piccolo/aczonin and
           intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the second C2
           repeat, C2B, and has a type-I topology.
          Length = 136

 Score = 28.1 bits (63), Expect = 0.72
 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 30  SIISINTLEPKWNSSMQFLI--KDVQEDVLCITVFDKGHYSPDEFLGK 75
           + I   TL P +N S  F +  + +Q+  L +TV D      ++ +GK
Sbjct: 56  TTIKKRTLNPYYNESFSFEVPFEQIQKVHLIVTVLDYDRIGKNDPIGK 103


>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2
           domain [General function prediction only].
          Length = 1227

 Score = 29.0 bits (65), Expect = 0.81
 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 29  TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
           T +   NTL P WN +   L+     D L ++++D   +  D+ +G T+
Sbjct: 475 TRVKK-NTLNPVWNETFYILLNSF-TDPLNLSLYDFNSFKSDKVVGSTQ 521



 Score = 27.0 bits (60), Expect = 3.6
 Identities = 20/110 (18%), Positives = 37/110 (33%), Gaps = 4/110 (3%)

Query: 17   FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
            F ++ +  +    + +   TL P WN      + +  +DVL I V D      ++ LG  
Sbjct: 1064 FVKLFLNEKSVYKTKVVKKTLNPVWNEEFTIEVLNRVKDVLTINVNDWDSGEKNDLLGTA 1123

Query: 77   KRVKGEAINPREPNLLMGSLCSKYVLYK---FTVAEIIQRKFKLLRFDRE 123
            +      + P         L  K  +            + K+ L    +E
Sbjct: 1124 EI-DLSKLEPGGTTNSNIPLDGKTFIVLDGTLHPGFNFRSKYALNVSRKE 1172


>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple
          C2 domain and Transmembrane region Proteins (MCTP).
          MCTPs are involved in Ca2+ signaling at the membrane.
          MCTP is composed of a variable N-terminal sequence,
          three C2 domains, two transmembrane regions (TMRs), and
          a short C-terminal sequence.  It is one of four protein
          classes that are anchored to membranes via a
          transmembrane region; the others being synaptotagmins,
          extended synaptotagmins, and ferlins. MCTPs are the
          only membrane-bound C2 domain proteins that contain two
          functional TMRs. MCTPs are unique in that they bind
          Ca2+ but not phospholipids. C2 domains fold into an
          8-standed beta-sandwich that can adopt 2 structural
          arrangements: Type I and Type II, distinguished by a
          circular permutation involving their N- and C-terminal
          beta strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the first C2 repeat, C2A, and has a
          type-II topology.
          Length = 121

 Score = 27.6 bits (62), Expect = 1.2
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
           L P W+      I+DV + +  I VFD      D+F+G
Sbjct: 43 NLNPVWDEKFTLPIEDVTQPLY-IKVFDYDRGLTDDFMG 80


>gnl|CDD|132259 TIGR03215, ac_ald_DH_ac, acetaldehyde dehydrogenase (acetylating). 
           Members of this protein family are acetaldehyde
           dehydrogenase (acetylating), EC 1.2.1.10. This enzyme
           oxidizes acetaldehyde, using NAD(+), and attaches
           coenzyme A (CoA), yielding acetyl-CoA. It occurs as a
           late step in the meta-cleavage pathways of a variety of
           compounds, including catechol, biphenyl, toluene,
           salicylate, etc.
          Length = 285

 Score = 27.7 bits (62), Expect = 1.4
 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 11/35 (31%)

Query: 70  DEFLGKTKRV--------KGEAI---NPREPNLLM 93
           DEF   T R         KG+AI   NP EP L+M
Sbjct: 164 DEFTETTSRALEQVGGAKKGKAIIILNPAEPPLMM 198


>gnl|CDD|237677 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA
           methylthiotransferase; Provisional.
          Length = 448

 Score = 27.7 bits (62), Expect = 1.7
 Identities = 10/23 (43%), Positives = 17/23 (73%)

Query: 72  FLGKTKRVKGEAINPREPNLLMG 94
           +LG+ + V  E INP++P+ +MG
Sbjct: 386 YLGRIEEVLVEGINPKDPSQVMG 408


>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3
          ubiquitin ligase.  E3 ubiquitin ligase is part of the
          ubiquitylation mechanism responsible for controlling
          surface expression of membrane proteins.  The
          sequential action of several enzymes are involved:
          ubiquitin-activating enzyme E1, ubiquitin-conjugating
          enzyme E2, and ubiquitin-protein ligase E3 which is
          responsible for substrate recognition and promoting the
          transfer of ubiquitin to the target protein.  E3
          ubiquitin ligase is composed of an N-terminal C2
          domain, 4 WW domains, and a HECTc domain.  C2 domains
          fold into an 8-standed beta-sandwich that can adopt 2
          structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions.
          Length = 125

 Score = 26.5 bits (59), Expect = 2.6
 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 2/62 (3%)

Query: 16 VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
           + +VT+  Q    + +S  T  PKWN     L+    +  L   V+       D  LG+
Sbjct: 24 PYVEVTVDGQPPKKTEVSKKTSNPKWNEHFTVLVT--PQSTLEFKVWSHHTLKADVLLGE 81

Query: 76 TK 77
            
Sbjct: 82 AS 83


>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin.  Ferlins
          are involved in vesicle fusion events.  Ferlins and
          other proteins, such as Synaptotagmins, are implicated
          in facilitating the fusion process when cell membranes
          fuse together.  There are six known human Ferlins:
          Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
          (Fer1L3), Fer1L4, Fer1L5, and Fer1L6.  Defects in these
          genes can lead to a wide range of diseases including
          muscular dystrophy (dysferlin), deafness (otoferlin),
          and infertility (fer-1, fertilization factor-1).
          Structurally they have 6 tandem C2 domains, designated
          as (C2A-C2F) and a single C-terminal transmembrane
          domain, though there is a new study that disputes this
          and claims that there are actually 7 tandem C2 domains
          with another C2 domain inserted between C2D and C2E. 
          In a subset of them (Dysferlin, Myoferlin, and Fer1)
          there is an additional conserved domain called DysF. C2
          domains fold into an 8-standed beta-sandwich that can
          adopt 2 structural arrangements: Type I and Type II,
          distinguished by a circular permutation involving their
          N- and C-terminal beta strands. Many C2 domains are
          Ca2+-dependent membrane-targeting modules that bind a
          wide variety of substances including bind
          phospholipids, inositol polyphosphates, and
          intracellular proteins.  Most C2 domain proteins are
          either signal transduction enzymes that contain a
          single C2 domain, such as protein kinase C, or membrane
          trafficking proteins which contain at least two C2
          domains, such as synaptotagmin 1.  However, there are a
          few exceptions to this including RIM isoforms and some
          splice variants of piccolo/aczonin and intersectin
          which only have a single C2 domain.  C2 domains with a
          calcium binding region have negatively charged
          residues, primarily aspartates, that serve as ligands
          for calcium ions. This cd contains the first C2 repeat,
          C2A, and has a type-II topology.
          Length = 127

 Score = 26.4 bits (59), Expect = 3.1
 Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 27 HTTSIISINTLEPKWNSSMQFLIKDVQE--DVLCITVFDKGHYSPDEFLGKTK 77
            T ++  N L P WN + ++ +    +  + L I V D      +  +G   
Sbjct: 28 KKTRVLE-NELNPVWNETFEWPLAGSPDPDESLEIVVKDYEKVGRNRLIGSAT 79


>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
           Synaptotagmin 7.  Synaptotagmin is a
           membrane-trafficking protein characterized by a
           N-terminal transmembrane region, a linker, and 2
           C-terminal C2 domains. Synaptotagmin 7, a member of
           class 2 synaptotagmins, is located in presynaptic plasma
           membranes in neurons, dense-core vesicles in endocrine
           cells, and lysosomes in fibroblasts.  It has been shown
           to play a role in regulation of Ca2+-dependent lysosomal
           exocytosis in fibroblasts and may also function as a
           vesicular Ca2+-sensor.  It is distinguished from the
           other synaptotagmins by having over 12 splice forms.
           Previously all synaptotagmins were thought to be calcium
           sensors in the regulation of neurotransmitter release
           and hormone secretion, but it has been shown that not
           all of them bind calcium.  Of the 17 identified
           synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
           The function of the two C2 domains that bind calcium
           are: regulating the fusion step of synaptic vesicle
           exocytosis (C2A) and  binding to
           phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
           absence of calcium ions and to phosphatidylinositol
           bisphosphate (PIP2) in their presence (C2B).  C2B also
           regulates also the recycling step of synaptic vesicles.
           C2 domains fold into an 8-standed beta-sandwich that can
           adopt 2 structural arrangements: Type I and Type II,
           distinguished by a circular permutation involving their
           N- and C-terminal beta strands. Many C2 domains are
           Ca2+-dependent membrane-targeting modules that bind a
           wide variety of substances including bind phospholipids,
           inositol polyphosphates, and intracellular proteins.
           Most C2 domain proteins are either signal transduction
           enzymes that contain a single C2 domain, such as protein
           kinase C, or membrane trafficking proteins which contain
           at least two C2 domains, such as synaptotagmin 1.
           However, there are a few exceptions to this including
           RIM isoforms and some splice variants of piccolo/aczonin
           and intersectin which only have a single C2 domain.  C2
           domains with a calcium binding region have negatively
           charged residues, primarily aspartates, that serve as
           ligands for calcium ions. This cd contains the first C2
           repeat, C2A, and has a type-I topology.
          Length = 125

 Score = 26.1 bits (58), Expect = 3.5
 Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 3/44 (6%)

Query: 36  TLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKT 76
            L P WN +  F     + +Q+ VL + V D   +S ++ +G+ 
Sbjct: 61  NLNPHWNETFLFEGFPYEKLQQRVLYLQVLDYDRFSRNDPIGEV 104


>gnl|CDD|189008 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N family incudes
           tricorn interacting factor F3, Endoplasmic reticulum
           aminopeptidase 1 (ERAP1), Aminopeptidase Q (APQ).  This
           M1 peptidase family includes eukaryotic and bacterial
           members: aminopeptidase N (APN), aminopeptidase Q (APQ,
           laeverin), endoplasmic reticulum aminopeptidase 1
           (ERAP1) as well as tricorn interacting factor F3.
           Aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC
           3.4.11.2), a Type II integral membrane protease,
           consists of a small N-terminal cytoplasmic domain, a
           single transmembrane domain and a large extracellular
           ectodomain that contains the active site. It
           preferentially cleaves neutral amino acids from the
           N-terminus of oligopeptides and is present in a variety
           of human tissues and cell types (leukocyte, fibroblast,
           endothelial and epithelial cells). APN expression is
           dysregulated in inflammatory diseases such as chronic
           pain, rheumatoid arthritis, multiple sclerosis, systemic
           sclerosis, systemic lupus erythematosus,
           polymyositis/dermatomyosytis and pulmonary sarcoidosis,
           and is enhanced in tumor cells such as melanoma, renal,
           prostate, pancreas, colon, gastric and thyroid cancers.
           It is considered a marker of differentiation since it is
           predominantly expressed on stem cells and on cells of
           the granulocytic and monocytic lineages at distinct
           stages of differentiation. Thus, APN inhibition may lead
           to the development of anti-cancer and anti-inflammatory
           drugs. ERAP1 also known as endoplasmic reticulum
           aminopeptidase associated with antigen processing
           (ERAAP), adipocyte derived leucine aminopeptidase
           (A-LAP) or aminopeptidase regulating tumor necrosis
           factor receptor I (THFRI) shedding (ARTS-1), associates
           with the closely related ER aminopeptidase ERAP2, for
           the final trimming of peptides within the ER for
           presentation by MHC class I molecules. ERAP1 is
           associated with ankylosing spondylitis (AS), an
           inflammatory arthritis that predominantly affects the
           spine. ERAP1 also aids in the shedding of membrane-bound
           cytokine receptors. The tricorn interacting factor F3,
           together with factors F1 and F2, degrades the tricorn
           protease products, producing free amino acids, thus
           completing the proteasomal degradation pathway. F3 is
           homologous to F2, but not F1, and shows a strong
           preference for glutamate in the P1' position. APQ, also
           known as laeverin, is specifically expressed in human
           embryo-derived extravillous trophoblasts (EVTs) that
           invade the uterus during early placentation. It cleaves
           the N-terminal amino acid of various peptides such as
           angiotensin III, endokinin C, and kisspeptin-10, all
           expressed in the placenta in large quantities. APN is a
           receptor for coronaviruses, although the virus receptor
           interaction site seems to be distinct from the enzymatic
           site and aminopeptidase activity is not necessary for
           viral infection. APNs are also putative Cry toxin
           receptors. Cry1 proteins are pore-forming toxins that
           bind to the midgut epithelial cell membrane of
           susceptible insect larvae, causing extensive damage.
           Several different toxins, including Cry1Aa, Cry1Ab,
           Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to
           bind to APNs; however, a direct role of APN in
           cytotoxicity has been yet to be firmly established.
          Length = 446

 Score = 26.4 bits (59), Expect = 5.5
 Identities = 9/22 (40%), Positives = 16/22 (72%)

Query: 32  ISINTLEPKWNSSMQFLIKDVQ 53
           + ++ LEP+WN   QF++ D+Q
Sbjct: 324 LGVDHLEPEWNMWDQFVLDDLQ 345


>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian
          uncoordinated) proteins; fungal group.  C2-like domains
          are thought to be involved in phospholipid binding in a
          Ca2+ independent manner in both Unc13 and Munc13.
          Caenorabditis elegans Unc13 has a central domain with
          sequence similarity to PKC, which includes C1 and
          C2-related domains. Unc13 binds phorbol esters and DAG
          with high affinity in a phospholipid manner.  Mutations
          in Unc13 results in abnormal neuronal connections and
          impairment in cholinergic neurotransmission in the
          nematode.  Munc13 is the mammalian homolog which are
          expressed in the brain.  There are 3 isoforms
          (Munc13-1, -2, -3) and are thought to play a role in
          neurotransmitter release and are hypothesized to be
          high-affinity receptors for phorbol esters.  Unc13 and
          Munc13 contain both C1 and C2 domains.  There are two
          C2 related domains present, one central and one at the
          carboxyl end.  Munc13-1 contains a third C2-like
          domain.  Munc13 interacts with syntaxin, synaptobrevin,
          and synaptotagmin suggesting a role for these as
          scaffolding proteins. C2 domains fold into an 8-standed
          beta-sandwich that can adopt 2 structural arrangements:
          Type I and Type II, distinguished by a circular
          permutation involving their N- and C-terminal beta
          strands. Many C2 domains are Ca2+-dependent
          membrane-targeting modules that bind a wide variety of
          substances including bind phospholipids, inositol
          polyphosphates, and intracellular proteins.  Most C2
          domain proteins are either signal transduction enzymes
          that contain a single C2 domain, such as protein kinase
          C, or membrane trafficking proteins which contain at
          least two C2 domains, such as synaptotagmin 1.
          However, there are a few exceptions to this including
          RIM isoforms and some splice variants of
          piccolo/aczonin and intersectin which only have a
          single C2 domain.  C2 domains with a calcium binding
          region have negatively charged residues, primarily
          aspartates, that serve as ligands for calcium ions.
          This cd contains the second C2 repeat, C2B, and has a
          type-II topology.
          Length = 126

 Score = 24.9 bits (55), Expect = 8.9
 Identities = 10/49 (20%), Positives = 21/49 (42%), Gaps = 1/49 (2%)

Query: 28 TTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
           T  I  +TL P+W+   +  +   +   +  TV+D+      +  G+ 
Sbjct: 39 KTRTIY-DTLNPRWDEEFELEVPAGEPLWISATVWDRSFVGKHDLCGRA 86


>gnl|CDD|236247 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma;
           Provisional.
          Length = 289

 Score = 25.5 bits (56), Expect = 9.0
 Identities = 19/83 (22%), Positives = 33/83 (39%), Gaps = 17/83 (20%)

Query: 48  LIKDVQ--EDVLCITVFDKG------HYSPDEFLGKTKR------VKGEAINPREPNLLM 93
           LIKD+   E+V  I    +       H  P  F+ +  +       +    +P+      
Sbjct: 158 LIKDLAEAENVKIIQSVTRDPEWPGCHGLPQGFIERVCKGVVTDLFREANTDPKNTYAA- 216

Query: 94  GSLCSKYVLYKFTVAEIIQRKFK 116
             +C   V+YKF   E+I R ++
Sbjct: 217 --ICGPPVMYKFVFKELINRGYR 237


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.321    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0645    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,132,564
Number of extensions: 512768
Number of successful extensions: 364
Number of sequences better than 10.0: 1
Number of HSP's gapped: 355
Number of HSP's successfully gapped: 51
Length of query: 127
Length of database: 10,937,602
Length adjustment: 85
Effective length of query: 42
Effective length of database: 7,167,512
Effective search space: 301035504
Effective search space used: 301035504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.4 bits)