RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy7073
(127 letters)
>gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin. A
single instance of the C2 domain is located C
terminally in the intersectin protein. Intersectin
functions as a scaffolding protein, providing a link
between the actin cytoskeleton and the components of
endocytosis and plays a role in signal transduction.
In addition to C2, intersectin contains several
additional domains including: Eps15 homology domains,
SH3 domains, a RhoGEF domain, and a PH domain. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. The members here have topology I.
Length = 136
Score = 117 bits (296), Expect = 3e-35
Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
Query: 4 GYKLKA--PTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITV 61
G LK K +C+V+MGSQEH T ++S +TL PKWNSSMQF +KD+++DVLCITV
Sbjct: 24 GRDLKPCNSNGKSDPYCEVSMGSQEHKTKVVS-DTLNPKWNSSMQFFVKDLEQDVLCITV 82
Query: 62 FDKGHYSPDEFLGKT 76
FD+ +SPD+FLG+T
Sbjct: 83 FDRDFFSPDDFLGRT 97
>gnl|CDD|175973 cd00030, C2, C2 domain. The C2 domain was first identified in
PKC. C2 domains fold into an 8-standed beta-sandwich
that can adopt 2 structural arrangements: Type I and
Type II, distinguished by a circular permutation
involving their N- and C-terminal beta strands. Many C2
domains are Ca2+-dependent membrane-targeting modules
that bind a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions.
Length = 102
Score = 56.7 bits (137), Expect = 1e-11
Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 2/62 (3%)
Query: 17 FCQVTMG-SQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
+ +V++G Q+ T ++ NTL P WN + +F + D + D L + V+DK +S D+FLG+
Sbjct: 23 YVKVSLGGKQKFKTKVVK-NTLNPVWNETFEFPVLDPESDTLTVEVWDKDRFSKDDFLGE 81
Query: 76 TK 77
+
Sbjct: 82 VE 83
>gnl|CDD|215765 pfam00168, C2, C2 domain.
Length = 85
Score = 55.7 bits (135), Expect = 2e-11
Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 4/75 (5%)
Query: 6 KLKAPTHKRQVFCQVTMGSQE---HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVF 62
K K + +V++G Q+ T ++ NTL P WN + F + + L I V+
Sbjct: 12 PPKDLNGKSDPYVKVSLGGQKKDTKKTKVVK-NTLNPVWNETFTFEVTLPELAELRIEVY 70
Query: 63 DKGHYSPDEFLGKTK 77
D + D+F+G+
Sbjct: 71 DYDRFGKDDFIGEVT 85
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB).
Ca2+-binding motif present in phospholipases, protein
kinases C, and synaptotagmins (among others). Some do
not appear to contain Ca2+-binding sites. Particular
C2s appear to bind phospholipids, inositol
polyphosphates, and intracellular proteins. Unusual
occurrence in perforin. Synaptotagmin and PLC C2s are
permuted in sequence with respect to N- and C-terminal
beta strands. SMART detects C2 domains using one or
both of two profiles.
Length = 101
Score = 53.6 bits (129), Expect = 2e-10
Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 4/74 (5%)
Query: 6 KLKAPTHKRQVFCQVTMGSQEHT---TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVF 62
K K + +V++ T ++ NTL P WN + +F + + L I V+
Sbjct: 13 PPKDKGGKSDPYVKVSLDGDPKEKKKTKVVK-NTLNPVWNETFEFEVPPPELAELEIEVY 71
Query: 63 DKGHYSPDEFLGKT 76
DK + D+F+G+
Sbjct: 72 DKDRFGRDDFIGQV 85
>gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present
in Synaptotagmin-like proteins. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Previously all synaptotagmins
were thought to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that
can adopt 2 structural arrangements: Type I and Type
II, distinguished by a circular permutation involving
their N- and C-terminal beta strands. Many C2 domains
are Ca2+-dependent membrane-targeting modules that bind
a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the first C2 repeat,
C2A, and has a type-I topology.
Length = 128
Score = 47.4 bits (113), Expect = 7e-08
Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
Query: 20 VTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
+++G+Q T I NTL PKWN +F I Q +L + ++DK ++ ++LG
Sbjct: 30 LSVGAQRFKTQTIP-NTLNPKWNYWCEFPIFSAQNQLLKLILWDKDRFAGKDYLG 83
>gnl|CDD|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple
C2 domain and Transmembrane region Proteins (MCTP).
MCTPs are involved in Ca2+ signaling at the membrane.
The cds in this family contain multiple C2 domains as
well as a C-terminal PRT domain. It is one of four
protein classes that are anchored to membranes via a
transmembrane region; the others being synaptotagmins,
extended synaptotagmins, and ferlins. MCTPs are the
only membrane-bound C2 domain proteins that contain two
functional TMRs. MCTPs are unique in that they bind
Ca2+ but not phospholipids. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the third C2 repeat, C2C, and has a
type-II topology.
Length = 119
Score = 45.4 bits (108), Expect = 3e-07
Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
Query: 13 KRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEF 72
K FC + + + T I TL P+WN F IKD+ DVL +TV+D+ EF
Sbjct: 21 KSDPFCVLELVNARLQTHTIY-KTLNPEWNKIFTFPIKDIH-DVLEVTVYDEDKDKKPEF 78
Query: 73 LGK 75
LGK
Sbjct: 79 LGK 81
>gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating
Proteins (GAP). ArfGAP is a GTPase activating protein
which regulates the ADP ribosylation factor Arf, a
member of the Ras superfamily of GTP-binding proteins.
The GTP-bound form of Arf is involved in Golgi
morphology and is involved in recruiting coat proteins.
ArfGAP is responsible for the GDP-bound form of Arf
which is necessary for uncoating the membrane and
allowing the Golgi to fuse with an acceptor
compartment. These proteins contain an N-terminal
ArfGAP domain containing the characteristic zinc finger
motif (Cys-x2-Cys-x(16,17)-x2-Cys) and C-terminal C2
domain. C2 domains were first identified in Protein
Kinase C (PKC). C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Length = 145
Score = 45.4 bits (108), Expect = 5e-07
Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
Query: 20 VTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
+T+G+Q+ T +I L P WN + + + L + VFDK +S D+ +G
Sbjct: 28 LTLGNQKVKTRVIK-KNLNPVWNEELTLSVPNP-MAPLKLEVFDKDTFSKDDSMG 80
>gnl|CDD|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present
in Synaptotagmin-like proteins. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Previously all synaptotagmins
were thought to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that
can adopt 2 structural arrangements: Type I and Type
II, distinguished by a circular permutation involving
their N- and C-terminal beta strands. Many C2 domains
are Ca2+-dependent membrane-targeting modules that bind
a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 105
Score = 41.4 bits (98), Expect = 8e-06
Identities = 11/51 (21%), Positives = 21/51 (41%), Gaps = 1/51 (1%)
Query: 16 VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGH 66
+ ++T+G + + T P W FL+++ + L I V D
Sbjct: 23 PYVELTVGKTTQKSKVKE-RTNNPVWEEGFTFLVRNPENQELEIEVKDDKT 72
>gnl|CDD|176028 cd08382, C2_Smurf-like, C2 domain present in Smad
ubiquitination-related factor (Smurf)-like proteins. A
single C2 domain is found in Smurf proteins,
C2-WW-HECT-domain E3s, which play an important role in
the downregulation of the TGF-beta signaling pathway.
Smurf proteins also regulate cell shape, motility, and
polarity by degrading small guanosine triphosphatases
(GTPases). C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Members here have type-II topology.
Length = 123
Score = 40.8 bits (96), Expect = 2e-05
Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 6/61 (9%)
Query: 17 FCQVTM-GSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSP--DEFL 73
F +T+ G Q H+T + TL+PKWN + ++ I VFD+ + FL
Sbjct: 24 FAVITVDGGQTHSTDVAK-KTLDPKWNEHFDLTVG--PSSIITIQVFDQKKFKKKDQGFL 80
Query: 74 G 74
G
Sbjct: 81 G 81
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13
(mammalian uncoordinated)-like proteins. C2-like
domains are thought to be involved in phospholipid
binding in a Ca2+ independent manner in both Unc13 and
Munc13. Caenorabditis elegans Unc13 has a central domain
with sequence similarity to PKC, which includes C1 and
C2-related domains. Unc13 binds phorbol esters and DAG
with high affinity in a phospholipid manner. Mutations
in Unc13 results in abnormal neuronal connections and
impairment in cholinergic neurotransmission in the
nematode. Munc13 is the mammalian homolog which are
expressed in the brain. There are 3 isoforms (Munc13-1,
-2, -3) and are thought to play a role in
neurotransmitter release and are hypothesized to be
high-affinity receptors for phorbol esters. Unc13 and
Munc13 contain both C1 and C2 domains. There are two C2
related domains present, one central and one at the
carboxyl end. Munc13-1 contains a third C2-like domain.
Munc13 interacts with syntaxin, synaptobrevin, and
synaptotagmin suggesting a role for these as scaffolding
proteins. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-II topology.
Length = 153
Score = 41.2 bits (97), Expect = 2e-05
Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
Query: 27 HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
T + TL P WN + +F ++DV D L + ++D D+FLG
Sbjct: 91 KVTEVKP-QTLNPVWNETFRFEVEDVSNDQLHLDIWDHD----DDFLG 133
>gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third
repeat in Synaptotagmin-like proteins. Synaptotagmin
is a membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Previously all synaptotagmins
were thought to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that
can adopt 2 structural arrangements: Type I and Type
II, distinguished by a circular permutation involving
their N- and C-terminal beta strands. Many C2 domains
are Ca2+-dependent membrane-targeting modules that bind
a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains either the first or
third repeat in Synaptotagmin-like proteins with a
type-I topology.
Length = 121
Score = 40.7 bits (96), Expect = 2e-05
Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 6/63 (9%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDK--GHYSPDEFLG 74
+ V +G+Q + +I L PKWN + ++ +V L I +FD+ D+FLG
Sbjct: 31 YVIVRVGAQTFKSKVIK-ENLNPKWNEVYEAVVDEVPGQELEIELFDEDPDK---DDFLG 86
Query: 75 KTK 77
+
Sbjct: 87 RLS 89
>gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in
Tricalbin-like proteins. 5 to 6 copies of the C2
domain are present in Tricalbin, a yeast homolog of
Synaptotagmin, which is involved in membrane
trafficking and sorting. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the second C2 repeat, C2B, and has a
type-II topology.
Length = 111
Score = 39.5 bits (93), Expect = 4e-05
Identities = 15/62 (24%), Positives = 29/62 (46%), Gaps = 3/62 (4%)
Query: 17 FCQVTMGSQE-HTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
+ ++ + + +TT + T P WN+S +FL+ D ++ + + V D D LG
Sbjct: 16 YAELYLNGKLVYTTRVKK-KTNNPSWNASTEFLVTDRRKSRVTVVVKDD-RDRHDPVLGS 73
Query: 76 TK 77
Sbjct: 74 VS 75
>gnl|CDD|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528
cDNA clone. The members of this CD are named after the
Human KIAA0528 cDNA clone. All members here contain a
single C2 repeat. No other information on this protein
is currently known. The C2 domain was first identified
in PKC. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Length = 110
Score = 39.2 bits (92), Expect = 5e-05
Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSS-MQFLIKD--VQEDVLCITVFDKGHYSPDEFL 73
F +V GS + T ++ +L P WNS +F + D +Q++ L I V D YS ++ +
Sbjct: 24 FVEVKFGSTTYKTDVVK-KSLNPVWNSEWFRFEVDDEELQDEPLQIRVMDHDTYSANDAI 82
Query: 74 GKT 76
GK
Sbjct: 83 GKV 85
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in
Phosphoinositide-specific phospholipases C (PLC). PLCs
are involved in the hydrolysis of
phosphatidylinositol-4,5-bisphosphate (PIP2) to
d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and
sn-1,2-diacylglycerol (DAG). 1,4,5-IP3 and DAG are
second messengers in eukaryotic signal transduction
cascades. PLC is composed of a N-terminal PH domain
followed by a series of EF hands, a catalytic TIM
barrel and a C-terminal C2 domain. C2 domains fold into
an 8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Members here have a type-II topology.
Length = 128
Score = 39.4 bits (93), Expect = 6e-05
Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
Query: 24 SQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
S + T ++ N P WN + +F + + L V+D+ D+FLG
Sbjct: 41 SAKFKTKVVKNNGFNPVWNETFEFDVTVPELAFLRFVVYDED-SGDDDFLG 90
>gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in
RasA1 and RasA4. RasA1 and RasA4 are GAP1s (GTPase
activating protein 1s ), Ras-specific GAP members,
which suppresses Ras function by enhancing the GTPase
activity of Ras proteins resulting in the inactive
GDP-bound form of Ras. In this way it can control
cellular proliferation and differentiation. Both
proteins contain two C2 domains, a Ras-GAP domain, a
plextrin homology (PH)-like domain, and a Bruton's
Tyrosine Kinase (BTK) zinc binding domain. C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 123
Score = 38.6 bits (90), Expect = 1e-04
Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
F +V Q TS++ + P+WN +F + + + L + V+D S ++FLGK
Sbjct: 24 FVRVFYNGQTLETSVVK-KSCYPRWNEVFEFELMEGADSPLSVEVWDWDLVSKNDFLGK 81
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in
Multiple C2 domain and Transmembrane region Proteins
(MCTP); plant subset. MCTPs are involved in Ca2+
signaling at the membrane. Plant-MCTPs are composed of
a variable N-terminal sequence, four C2 domains, two
transmembrane regions (TMRs), and a short C-terminal
sequence. It is one of four protein classes that are
anchored to membranes via a transmembrane region; the
others being synaptotagmins, extended synaptotagmins,
and ferlins. MCTPs are the only membrane-bound C2 domain
proteins that contain two functional TMRs. MCTPs are
unique in that they bind Ca2+ but not phospholipids. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the third C2
repeat, C2C, and has a type-II topology.
Length = 150
Score = 36.9 bits (86), Expect = 7e-04
Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 8/80 (10%)
Query: 16 VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
VF + +G+Q T P WN + F+ + ED L ++V D+ + DE LG+
Sbjct: 23 VFVKAQLGNQVLRTRPSQTRNGNPSWNEELMFVAAEPFEDHLILSVEDRVGPNKDEPLGR 82
Query: 76 T--------KRVKGEAINPR 87
+RV + R
Sbjct: 83 AVIPLNDIERRVDDRPVPSR 102
>gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in
the putative elicitor-responsive gene. In plants
elicitor-responsive proteins are triggered in response
to specific elicitor molecules such as glycolproteins,
peptides, carbohydrates and lipids. A host of defensive
responses are also triggered resulting in localized cell
death. Antimicrobial secondary metabolites, such as
phytoalexins, or defense-related proteins, including
pathogenesis-related (PR) proteins are also produced.
There is a single C2 domain present here. C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members have a type-II
topology.
Length = 124
Score = 35.0 bits (81), Expect = 0.002
Identities = 16/83 (19%), Positives = 33/83 (39%), Gaps = 10/83 (12%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDV---LCITVFDKGHYSPDEFL 73
+ + +QE + + + P+WN +F ++ L + + DK ++S D+F+
Sbjct: 25 YVIIQCRTQERKSKVAKGDGRNPEWNEKFKFTVEYPGWGGDTKLILRIMDKDNFSDDDFI 84
Query: 74 GKTKRVKGEAINPREPNLLMGSL 96
GEA + G
Sbjct: 85 -------GEATIHLKGLFEEGVE 100
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase
A2 (cPLA2). A single copy of the C2 domain is present
in cPLA2 which releases arachidonic acid from membranes
initiating the biosynthesis of potent inflammatory
mediators such as prostaglandins, leukotrienes, and
platelet-activating factor. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Members of this cd have a type-II topology.
Length = 119
Score = 34.9 bits (81), Expect = 0.003
Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
Query: 35 NTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
N++ P WN + +F I+ ++VL +TV D+ Y D+ LG
Sbjct: 44 NSINPVWNETFEFRIQSQVKNVLELTVMDE-DYVMDDHLGTV 84
>gnl|CDD|176024 cd08378, C2B_MCTP_PRT_plant, C2 domain second repeat found in
Multiple C2 domain and Transmembrane region Proteins
(MCTP); plant subset. MCTPs are involved in Ca2+
signaling at the membrane. Plant-MCTPs are composed of
a variable N-terminal sequence, four C2 domains, two
transmembrane regions (TMRs), and a short C-terminal
sequence. It is one of four protein classes that are
anchored to membranes via a transmembrane region; the
others being synaptotagmins, extended synaptotagmins,
and ferlins. MCTPs are the only membrane-bound C2
domain proteins that contain two functional TMRs. MCTPs
are unique in that they bind Ca2+ but not
phospholipids. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the second C2 repeat, C2B, and has a
type-II topology.
Length = 121
Score = 34.6 bits (80), Expect = 0.003
Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
Query: 8 KAPTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHY 67
P + +V +G+ + +T I T P+WN F +Q L ++V+DK
Sbjct: 11 GLPANSNDPVVEVKLGNYKGSTKAIE-RTSNPEWNQVFAFSKDRLQGSTLEVSVWDKD-K 68
Query: 68 SPDEFLGK 75
+ D+FLG
Sbjct: 69 AKDDFLGG 76
>gnl|CDD|176063 cd08681, C2_fungal_Inn1p-like, C2 domain found in fungal
Ingression 1 (Inn1) proteins. Saccharomyces cerevisiae
Inn1 associates with the contractile actomyosin ring at
the end of mitosis and is needed for cytokinesis. The
C2 domain of Inn1, located at the N-terminus, is
required for ingression of the plasma membrane. The
C-terminus is relatively unstructured and contains
eight PXXP motifs that are thought to mediate
interaction of Inn1 with other proteins with SH3
domains in the cytokinesis proteins Hof1 (an F-BAR
protein) and Cyk3 (whose overexpression can restore
primary septum formation in Inn1Delta cells) as well as
recruiting Inn1 to the bud-neck by binding to Cyk3.
Inn1 and Cyk3 appear to cooperate in activating chitin
synthase Chs2 for primary septum formation, which
allows coordination of actomyosin ring contraction with
ingression of the cleavage furrow. It is thought that
the C2 domain of Inn1 helps to preserve the link
between the actomyosin ring and the plasma membrane,
contributing both to membrane ingression, as well as to
stability of the contracting ring. Additionally, Inn1
might induce curvature of the plasma membrane adjacent
to the contracting ring, thereby promoting ingression
of the membrane. It has been shown that the C2 domain
of human synaptotagmin induces curvature in target
membranes and thereby contributes to fusion of these
membranes with synaptic vesicles. The C2 domain was
first identified in PKC. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions.
Length = 118
Score = 34.1 bits (79), Expect = 0.005
Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 1/64 (1%)
Query: 13 KRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEF 72
K+ +C + +G T P+W+ ++F I + ++ +L + VFD PD
Sbjct: 21 KQDPYCVLRIGGVTKKTKTDFRGGQHPEWDEELRFEITEDKKPILKVAVFDDDKRKPD-L 79
Query: 73 LGKT 76
+G T
Sbjct: 80 IGDT 83
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in
Tricalbin-like proteins. 5 to 6 copies of the C2
domain are present in Tricalbin, a yeast homolog of
Synaptotagmin, which is involved in membrane
trafficking and sorting. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the first C2 repeat, C2A, and has a
type-II topology.
Length = 124
Score = 33.7 bits (78), Expect = 0.008
Identities = 12/48 (25%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
Query: 29 TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
T + +T P WN + L+ + + L +TV+D D+ +G
Sbjct: 41 TKVKK-DTSNPVWNETKYILVNSLT-EPLNLTVYDFNDKRKDKLIGTA 86
>gnl|CDD|175984 cd04017, C2D_Ferlin, C2 domain fourth repeat in Ferlin. Ferlins
are involved in vesicle fusion events. Ferlins and
other proteins, such as Synaptotagmins, are implicated
in facilitating the fusion process when cell membranes
fuse together. There are six known human Ferlins:
Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
(Fer1L3), Fer1L4, Fer1L5, and Fer1L6. Defects in these
genes can lead to a wide range of diseases including
muscular dystrophy (dysferlin), deafness (otoferlin),
and infertility (fer-1, fertilization factor-1).
Structurally they have 6 tandem C2 domains, designated
as (C2A-C2F) and a single C-terminal transmembrane
domain, though there is a new study that disputes this
and claims that there are actually 7 tandem C2 domains
with another C2 domain inserted between C2D and C2E.
In a subset of them (Dysferlin, Myoferlin, and Fer1)
there is an additional conserved domain called DysF. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the fourth C2
repeat, C2D, and has a type-II topology.
Length = 135
Score = 33.7 bits (78), Expect = 0.008
Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 10/69 (14%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQF-------LIKDVQED--VLCITVFDKGHY 67
F +V+ +Q T +I TL P W+ ++ F +++ ++ ++ + +FD+
Sbjct: 25 FARVSFLNQSQETEVIK-ETLSPTWDQTLIFDEVELYGSPEEIAQNPPLVVVELFDQDSV 83
Query: 68 SPDEFLGKT 76
DEFLG++
Sbjct: 84 GKDEFLGRS 92
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in
Synaptotagmin-like proteins 1-4. All Slp members
basically share an N-terminal Slp homology domain (SHD)
and C-terminal tandem C2 domains (named the C2A domain
and the C2B domain) with the SHD and C2 domains being
separated by a linker sequence of various length.
Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
to the plasma membrane. Additionally, their C2A domains
are both Ca2+ independent, unlike the case in Slp3 and
Slp4/granuphilin in which their C2A domains are Ca2+
dependent. It is thought that SHD (except for the
Slp4-SHD) functions as a specific Rab27A/B-binding
domain. In addition to Slps, rabphilin, Noc2, and
Munc13-4 also function as Rab27-binding proteins. It has
been demonstrated that Slp3 and Slp4/granuphilin promote
dense-core vesicle exocytosis. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second
C2 repeat, C2B, and has a type-I topology.
Length = 162
Score = 32.7 bits (75), Expect = 0.023
Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
Query: 36 TLEPKWNSSM---QFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
++ P WN + +D+ + L +TV+D S ++FLG
Sbjct: 74 SVNPVWNHTFVYDGVSPEDLSQACLELTVWDHDKLSSNDFLG 115
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
Rab3-interacting molecule (RIM) proteins. RIMs are
believed to organize specialized sites of the plasma
membrane called active zones. They also play a role in
controlling neurotransmitter release, plasticity
processes, as well as memory and learning. RIM contains
an N-terminal zinc finger domain, a PDZ domain, and two
C-terminal C2 domains (C2A, C2B). C2 domains fold into
an 8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members here have a type-I
topology and do not bind Ca2+.
Length = 125
Score = 32.2 bits (74), Expect = 0.026
Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
Query: 35 NTLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKT 76
TL P+WN + ++ + ++E L +TV+D ++FLG+
Sbjct: 62 KTLNPEWNQTFEYSNVRRETLKERTLEVTVWDYDRDGENDFLGEV 106
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in
Multiple C2 domain and Transmembrane region Proteins
(MCTP); plant subset. MCTPs are involved in Ca2+
signaling at the membrane. Plant-MCTPs are composed of
a variable N-terminal sequence, four C2 domains, two
transmembrane regions (TMRs), and a short C-terminal
sequence. It is one of four protein classes that are
anchored to membranes via a transmembrane region; the
others being synaptotagmins, extended synaptotagmins,
and ferlins. MCTPs are the only membrane-bound C2 domain
proteins that contain two functional TMRs. MCTPs are
unique in that they bind Ca2+ but not phospholipids. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-II topology.
Length = 127
Score = 31.9 bits (73), Expect = 0.032
Identities = 18/80 (22%), Positives = 32/80 (40%), Gaps = 6/80 (7%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDV---QEDVLCITVF-DKGHYSPDEF 72
+ ++ Q+ T L P WN + F + D VL + V+ D+ F
Sbjct: 24 YVELDFDGQKKRTRTK-PKDLNPVWNEKLVFNVSDPSRLSNLVLEVYVYNDRRSGRRRSF 82
Query: 73 LGKTKRVKGEAINPREPNLL 92
LG+ R+ G + P ++
Sbjct: 83 LGRV-RISGTSFVPPSEAVV 101
>gnl|CDD|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural
precursor cell-expressed, developmentally
down-regulated 4 (NEDD4) and NEDD4-like
(NEDD4L/NEDD42). Nedd4 and Nedd4-2 are two of the nine
members of the Human Nedd4 family. All vertebrates
appear to have both Nedd4 and Nedd4-2 genes. They are
thought to participate in the regulation of epithelial
Na+ channel (ENaC) activity. They also have identical
specificity for ubiquitin conjugating enzymes (E2).
Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW
domains, and a ubiquitin ligase Hect domain. Their WW
domains can bind PPxY (PY) or LPSY motifs, and in vitro
studies suggest that WW3 and WW4 of both proteins bind
PY motifs in the key substrates, with WW3 generally
exhibiting higher affinity. Most Nedd4 family members,
especially Nedd4-2, also have multiple splice variants,
which might play different roles in regulating their
substrates. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
Length = 133
Score = 31.6 bits (72), Expect = 0.053
Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
TL PKWN F + + +E L VFD+ + D+FLG
Sbjct: 49 TLNPKWNEEFFFRV-NPREHRLLFEVFDENRLTRDDFLG 86
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple
C2 domain and Transmembrane region Proteins (MCTP).
MCTPs are involved in Ca2+ signaling at the membrane.
MCTP is composed of a variable N-terminal sequence,
three C2 domains, two transmembrane regions (TMRs), and
a short C-terminal sequence. It is one of four protein
classes that are anchored to membranes via a
transmembrane region; the others being synaptotagmins,
extended synaptotagmins, and ferlins. MCTPs are the
only membrane-bound C2 domain proteins that contain two
functional TMRs. MCTPs are unique in that they bind
Ca2+ but not phospholipids. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the second C2 repeat, C2B, and has a
type-II topology.
Length = 116
Score = 31.1 bits (71), Expect = 0.063
Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
Query: 15 QVFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
+ + +G++++ S + TL P+W + D Q +L I V+DK DEF+G
Sbjct: 22 DPYVKFRLGNEKYK-SKVCSKTLNPQWLEQFDLHLFDDQSQILEIEVWDKDTGKKDEFIG 80
Query: 75 KTK 77
+ +
Sbjct: 81 RCE 83
>gnl|CDD|200510 cd11249, Sema_3A, The Sema domain, a protein interacting module, of
semaphorin 3A (Sema3A). Sema3A has been reported to
inhibit the growth of certain experimental tumors and to
regulate endothelial cell migration and apoptosis in
vitro, as well as arteriogenesis in the muscle, skin
vessel permeability, and tumor angiogenesis in vivo. The
function of Sema3A is mediated through receptors
neuropilin-1 (NP1) and plexins, although little is known
about the requirement of specific plexins in its
receptor complex. It is known however that Plexin-A4 is
the receptor for Sema3A in the Toll-like receptor- and
sepsis-induced cytokine storm during immune response.
Sema3A is a member of the Class 3 semaphorin family of
secreted proteins. Semaphorins are regulatory molecules
in the development of the nervous system and in axonal
guidance. They also play important roles in other
biological processes, such as angiogenesis, immune
regulation, respiration systems and cancer. The Sema
domain is located at the N-terminus and contains four
disulfide bonds formed by eight conserved cysteine
residues. It serves as a receptor-recognition and
-binding module.
Length = 493
Score = 31.1 bits (70), Expect = 0.13
Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%)
Query: 60 TVFDKGHYSPDEF--LGKTKRVKGEAINPREPNLLMGSLCSKYVLYKFTVAEIIQRKFKL 117
T + GH+ D L + G +P +P LL SL LY T A+ + R F +
Sbjct: 117 TYIEVGHHPEDNIFRLEDSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAI 176
Query: 118 LR 119
R
Sbjct: 177 FR 178
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
alpha and gamma. A single C2 domain is found in PKC
alpha and gamma. The PKC family of serine/threonine
kinases regulates apoptosis, proliferation, migration,
motility, chemo-resistance, and differentiation. There
are 3 groups: group 1(alpha, betaI, beta II, gamma)
which require phospholipids and calcium, group 2 (delta,
epsilon, theta, eta) which do not require calcium for
activation, and group 3 (xi, iota/lambda) which are
atypical and can be activated in the absence of
diacylglycerol and calcium. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members here have a type-I
topology.
Length = 131
Score = 29.9 bits (68), Expect = 0.17
Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
Query: 36 TLEPKWNSSMQFLIKDVQEDV-LCITVFDKGHYSPDEFLGK 75
TL P WN + F +K +D L I V+D + ++F+G
Sbjct: 60 TLNPVWNETFTFDLKPADKDRRLSIEVWDWDRTTRNDFMGS 100
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
Rabphilin and Double C2 domain. Rabphilin is found
neurons and in neuroendrocrine cells, while Doc2 is
found not only in the brain but in tissues, including
mast cells, chromaffin cells, and osteoblasts.
Rabphilin and Doc2s share highly homologous tandem C2
domains, although their N-terminal structures are
completely different: rabphilin contains an N-terminal
Rab-binding domain (RBD),7 whereas Doc2 contains an
N-terminal Munc13-1-interacting domain (MID). C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 133
Score = 30.0 bits (68), Expect = 0.19
Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
Query: 27 HTTSIISINTLEPKWNSSMQFLIK--DVQEDVLCITVFDKGHYSPDEFLG 74
H T + TL P++N + IK D+ + L ITV+DK ++++G
Sbjct: 52 HKTQV-KKKTLNPEFNEEFFYDIKHSDLAKKTLEITVWDKDIGKSNDYIG 100
>gnl|CDD|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in
Rabphilin and Double C2 domain. Rabphilin is found
neurons and in neuroendrocrine cells, while Doc2 is
found not only in the brain but in tissues, including
mast cells, chromaffin cells, and osteoblasts.
Rabphilin and Doc2s share highly homologous tandem C2
domains, although their N-terminal structures are
completely different: rabphilin contains an N-terminal
Rab-binding domain (RBD),7 whereas Doc2 contains an
N-terminal Munc13-1-interacting domain (MID). C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-I topology.
Length = 123
Score = 29.9 bits (68), Expect = 0.20
Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 4/46 (8%)
Query: 35 NTLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
T P++N ++ + +D+Q L + V D+ + ++FLG+T+
Sbjct: 61 KTRNPEFNETLTYYGITEEDIQRKTLRLLVLDEDRFG-NDFLGETR 105
>gnl|CDD|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin. Ferlins
are involved in vesicle fusion events. Ferlins and
other proteins, such as Synaptotagmins, are implicated
in facilitating the fusion process when cell membranes
fuse together. There are six known human Ferlins:
Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
(Fer1L3), Fer1L4, Fer1L5, and Fer1L6. Defects in these
genes can lead to a wide range of diseases including
muscular dystrophy (dysferlin), deafness (otoferlin),
and infertility (fer-1, fertilization factor-1).
Structurally they have 6 tandem C2 domains, designated
as (C2A-C2F) and a single C-terminal transmembrane
domain, though there is a new study that disputes this
and claims that there are actually 7 tandem C2 domains
with another C2 domain inserted between C2D and C2E.
In a subset of them (Dysferlin, Myoferlin, and Fer1)
there is an additional conserved domain called DysF. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the fifth C2 repeat,
C2E, and has a type-II topology.
Length = 124
Score = 29.4 bits (67), Expect = 0.25
Identities = 11/44 (25%), Positives = 18/44 (40%)
Query: 34 INTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
NTL P + + +L I+V D D+ +G+T
Sbjct: 42 PNTLNPVFGKMFELEATLPGNSILKISVMDYDLLGSDDLIGETV 85
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in
Synaptotagmin. Synaptotagmin is a membrane-trafficking
protein characterized by a N-terminal transmembrane
region, a linker, and 2 C-terminal C2 domains. There are
several classes of Synaptotagmins. Previously all
synaptotagmins were thought to be calcium sensors in the
regulation of neurotransmitter release and hormone
secretion, but it has been shown that not all of them
bind calcium. Of the 17 identified synaptotagmins only
8 bind calcium (1-3, 5-7, 9, 10). The function of the
two C2 domains that bind calcium are: regulating the
fusion step of synaptic vesicle exocytosis (C2A) and
binding to phosphatidyl-inositol-3,4,5-triphosphate
(PIP3) in the absence of calcium ions and to
phosphatidylinositol bisphosphate (PIP2) in their
presence (C2B). C2B also regulates also the recycling
step of synaptic vesicles. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 134
Score = 29.5 bits (67), Expect = 0.28
Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 3/50 (6%)
Query: 29 TSIISINTLEPKWNSSMQFLIKD--VQEDVLCITVFDKGHYSPDEFLGKT 76
TS+ TL P +N + F + ++E L ITV DK +E +G+
Sbjct: 55 TSVK-KGTLNPVFNEAFSFDVPAEQLEEVSLVITVVDKDSVGRNEVIGQV 103
>gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in
Tricalbin-like proteins. 5 to 6 copies of the C2
domain are present in Tricalbin, a yeast homolog of
Synaptotagmin, which is involved in membrane
trafficking and sorting. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the fifth C2 repeat, C2E, and has a
type-II topology.
Length = 115
Score = 29.1 bits (66), Expect = 0.31
Identities = 13/42 (30%), Positives = 18/42 (42%)
Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
TL P WN S + + VL + V+D D+ LG
Sbjct: 42 TLNPVWNESFEVPVPSRVRAVLKVEVYDWDRGGKDDLLGSAY 83
>gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family
interacting proteins (FIP) class I. Rab GTPases
recruit various effector proteins to organelles and
vesicles. Rab11-family interacting proteins (FIPs) are
involved in mediating the role of Rab11. FIPs can be
divided into three classes: class I FIPs (Rip11a,
Rip11b, RCP, and FIP2) which contain a C2 domain after
N-terminus of the protein, class II FIPs (FIP3 and
FIP4) which contain two EF-hands and a proline rich
region, and class III FIPs (FIP1) which exhibits no
homology to known protein domains. All FIP proteins
contain a highly conserved, 20-amino acid motif at the
C-terminus of the protein, known as Rab11/25 binding
domain (RBD). Class I FIPs are thought to bind to
endocytic membranes via their C2 domain, which
interacts directly with phospholipids. Class II FIPs do
not have any membrane binding domains leaving much to
speculate about the mechanism involving FIP3 and FIP4
interactions with endocytic membranes. The members in
this CD are class I FIPs. The exact function of the
Rab11 and FIP interaction is unknown, but there is
speculation that it involves the role of forming a
targeting complex that recruits a group of proteins
involved in membrane transport to organelles. The C2
domain was first identified in PKC. C2 domains fold
into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions.
Length = 126
Score = 28.6 bits (64), Expect = 0.63
Identities = 17/79 (21%), Positives = 31/79 (39%), Gaps = 6/79 (7%)
Query: 4 GYKLKAPTHKRQVFCQVTMGSQEHTTSIISINTLEPKWNSSMQF-----LIKDVQEDVLC 58
G K + + + +G ++++TS+ T P W F L + L
Sbjct: 10 GLLCKGKSGTNDAYVIIQLGKEKYSTSVKE-KTTSPVWKEECSFELPGLLSGNGNRATLQ 68
Query: 59 ITVFDKGHYSPDEFLGKTK 77
+TV + D+FLG+
Sbjct: 69 LTVMHRNLLGLDKFLGQVS 87
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in
Synaptotagmin 1. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Synaptotagmin 1, a member of the
class 1 synaptotagmins, is located in the brain and
endocranium and localized to the synaptic vesicles and
secretory granules. It functions as a Ca2+ sensor for
fast exocytosis. It, like synaptotagmin-2, has an
N-glycosylated N-terminus. Synaptotagmin 4, a member of
class 4 synaptotagmins, is located in the brain. It
functions are unknown. It, like synaptotagmin-11, has an
Asp to Ser substitution in its C2A domain. Previously
all synaptotagmins were thought to be calcium sensors in
the regulation of neurotransmitter release and hormone
secretion, but it has been shown that not all of them
bind calcium. Of the 17 identified synaptotagmins only
8 bind calcium (1-3, 5-7, 9, 10). The function of the
two C2 domains that bind calcium are: regulating the
fusion step of synaptic vesicle exocytosis (C2A) and
binding to phosphatidyl-inositol-3,4,5-triphosphate
(PIP3) in the absence of calcium ions and to
phosphatidylinositol bisphosphate (PIP2) in their
presence (C2B). C2B also regulates also the recycling
step of synaptic vesicles. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 136
Score = 28.1 bits (63), Expect = 0.72
Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
Query: 30 SIISINTLEPKWNSSMQFLI--KDVQEDVLCITVFDKGHYSPDEFLGK 75
+ I TL P +N S F + + +Q+ L +TV D ++ +GK
Sbjct: 56 TTIKKRTLNPYYNESFSFEVPFEQIQKVHLIVTVLDYDRIGKNDPIGK 103
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2
domain [General function prediction only].
Length = 1227
Score = 29.0 bits (65), Expect = 0.81
Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
Query: 29 TSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKTK 77
T + NTL P WN + L+ D L ++++D + D+ +G T+
Sbjct: 475 TRVKK-NTLNPVWNETFYILLNSF-TDPLNLSLYDFNSFKSDKVVGSTQ 521
Score = 27.0 bits (60), Expect = 3.6
Identities = 20/110 (18%), Positives = 37/110 (33%), Gaps = 4/110 (3%)
Query: 17 FCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
F ++ + + + + TL P WN + + +DVL I V D ++ LG
Sbjct: 1064 FVKLFLNEKSVYKTKVVKKTLNPVWNEEFTIEVLNRVKDVLTINVNDWDSGEKNDLLGTA 1123
Query: 77 KRVKGEAINPREPNLLMGSLCSKYVLYK---FTVAEIIQRKFKLLRFDRE 123
+ + P L K + + K+ L +E
Sbjct: 1124 EI-DLSKLEPGGTTNSNIPLDGKTFIVLDGTLHPGFNFRSKYALNVSRKE 1172
>gnl|CDD|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple
C2 domain and Transmembrane region Proteins (MCTP).
MCTPs are involved in Ca2+ signaling at the membrane.
MCTP is composed of a variable N-terminal sequence,
three C2 domains, two transmembrane regions (TMRs), and
a short C-terminal sequence. It is one of four protein
classes that are anchored to membranes via a
transmembrane region; the others being synaptotagmins,
extended synaptotagmins, and ferlins. MCTPs are the
only membrane-bound C2 domain proteins that contain two
functional TMRs. MCTPs are unique in that they bind
Ca2+ but not phospholipids. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the first C2 repeat, C2A, and has a
type-II topology.
Length = 121
Score = 27.6 bits (62), Expect = 1.2
Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
Query: 36 TLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLG 74
L P W+ I+DV + + I VFD D+F+G
Sbjct: 43 NLNPVWDEKFTLPIEDVTQPLY-IKVFDYDRGLTDDFMG 80
>gnl|CDD|132259 TIGR03215, ac_ald_DH_ac, acetaldehyde dehydrogenase (acetylating).
Members of this protein family are acetaldehyde
dehydrogenase (acetylating), EC 1.2.1.10. This enzyme
oxidizes acetaldehyde, using NAD(+), and attaches
coenzyme A (CoA), yielding acetyl-CoA. It occurs as a
late step in the meta-cleavage pathways of a variety of
compounds, including catechol, biphenyl, toluene,
salicylate, etc.
Length = 285
Score = 27.7 bits (62), Expect = 1.4
Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 11/35 (31%)
Query: 70 DEFLGKTKRV--------KGEAI---NPREPNLLM 93
DEF T R KG+AI NP EP L+M
Sbjct: 164 DEFTETTSRALEQVGGAKKGKAIIILNPAEPPLMM 198
>gnl|CDD|237677 PRK14333, PRK14333, (dimethylallyl)adenosine tRNA
methylthiotransferase; Provisional.
Length = 448
Score = 27.7 bits (62), Expect = 1.7
Identities = 10/23 (43%), Positives = 17/23 (73%)
Query: 72 FLGKTKRVKGEAINPREPNLLMG 94
+LG+ + V E INP++P+ +MG
Sbjct: 386 YLGRIEEVLVEGINPKDPSQVMG 408
>gnl|CDD|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3
ubiquitin ligase. E3 ubiquitin ligase is part of the
ubiquitylation mechanism responsible for controlling
surface expression of membrane proteins. The
sequential action of several enzymes are involved:
ubiquitin-activating enzyme E1, ubiquitin-conjugating
enzyme E2, and ubiquitin-protein ligase E3 which is
responsible for substrate recognition and promoting the
transfer of ubiquitin to the target protein. E3
ubiquitin ligase is composed of an N-terminal C2
domain, 4 WW domains, and a HECTc domain. C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions.
Length = 125
Score = 26.5 bits (59), Expect = 2.6
Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 2/62 (3%)
Query: 16 VFCQVTMGSQEHTTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGK 75
+ +VT+ Q + +S T PKWN L+ + L V+ D LG+
Sbjct: 24 PYVEVTVDGQPPKKTEVSKKTSNPKWNEHFTVLVT--PQSTLEFKVWSHHTLKADVLLGE 81
Query: 76 TK 77
Sbjct: 82 AS 83
>gnl|CDD|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin. Ferlins
are involved in vesicle fusion events. Ferlins and
other proteins, such as Synaptotagmins, are implicated
in facilitating the fusion process when cell membranes
fuse together. There are six known human Ferlins:
Dysferlin (Fer1L1), Otoferlin (Fer1L2), Myoferlin
(Fer1L3), Fer1L4, Fer1L5, and Fer1L6. Defects in these
genes can lead to a wide range of diseases including
muscular dystrophy (dysferlin), deafness (otoferlin),
and infertility (fer-1, fertilization factor-1).
Structurally they have 6 tandem C2 domains, designated
as (C2A-C2F) and a single C-terminal transmembrane
domain, though there is a new study that disputes this
and claims that there are actually 7 tandem C2 domains
with another C2 domain inserted between C2D and C2E.
In a subset of them (Dysferlin, Myoferlin, and Fer1)
there is an additional conserved domain called DysF. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a
single C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin
which only have a single C2 domain. C2 domains with a
calcium binding region have negatively charged
residues, primarily aspartates, that serve as ligands
for calcium ions. This cd contains the first C2 repeat,
C2A, and has a type-II topology.
Length = 127
Score = 26.4 bits (59), Expect = 3.1
Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 3/53 (5%)
Query: 27 HTTSIISINTLEPKWNSSMQFLIKDVQE--DVLCITVFDKGHYSPDEFLGKTK 77
T ++ N L P WN + ++ + + + L I V D + +G
Sbjct: 28 KKTRVLE-NELNPVWNETFEWPLAGSPDPDESLEIVVKDYEKVGRNRLIGSAT 79
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in
Synaptotagmin 7. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Synaptotagmin 7, a member of
class 2 synaptotagmins, is located in presynaptic plasma
membranes in neurons, dense-core vesicles in endocrine
cells, and lysosomes in fibroblasts. It has been shown
to play a role in regulation of Ca2+-dependent lysosomal
exocytosis in fibroblasts and may also function as a
vesicular Ca2+-sensor. It is distinguished from the
other synaptotagmins by having over 12 splice forms.
Previously all synaptotagmins were thought to be calcium
sensors in the regulation of neurotransmitter release
and hormone secretion, but it has been shown that not
all of them bind calcium. Of the 17 identified
synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
The function of the two C2 domains that bind calcium
are: regulating the fusion step of synaptic vesicle
exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-I topology.
Length = 125
Score = 26.1 bits (58), Expect = 3.5
Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 3/44 (6%)
Query: 36 TLEPKWNSSMQFL---IKDVQEDVLCITVFDKGHYSPDEFLGKT 76
L P WN + F + +Q+ VL + V D +S ++ +G+
Sbjct: 61 NLNPHWNETFLFEGFPYEKLQQRVLYLQVLDYDRFSRNDPIGEV 104
>gnl|CDD|189008 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N family incudes
tricorn interacting factor F3, Endoplasmic reticulum
aminopeptidase 1 (ERAP1), Aminopeptidase Q (APQ). This
M1 peptidase family includes eukaryotic and bacterial
members: aminopeptidase N (APN), aminopeptidase Q (APQ,
laeverin), endoplasmic reticulum aminopeptidase 1
(ERAP1) as well as tricorn interacting factor F3.
Aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC
3.4.11.2), a Type II integral membrane protease,
consists of a small N-terminal cytoplasmic domain, a
single transmembrane domain and a large extracellular
ectodomain that contains the active site. It
preferentially cleaves neutral amino acids from the
N-terminus of oligopeptides and is present in a variety
of human tissues and cell types (leukocyte, fibroblast,
endothelial and epithelial cells). APN expression is
dysregulated in inflammatory diseases such as chronic
pain, rheumatoid arthritis, multiple sclerosis, systemic
sclerosis, systemic lupus erythematosus,
polymyositis/dermatomyosytis and pulmonary sarcoidosis,
and is enhanced in tumor cells such as melanoma, renal,
prostate, pancreas, colon, gastric and thyroid cancers.
It is considered a marker of differentiation since it is
predominantly expressed on stem cells and on cells of
the granulocytic and monocytic lineages at distinct
stages of differentiation. Thus, APN inhibition may lead
to the development of anti-cancer and anti-inflammatory
drugs. ERAP1 also known as endoplasmic reticulum
aminopeptidase associated with antigen processing
(ERAAP), adipocyte derived leucine aminopeptidase
(A-LAP) or aminopeptidase regulating tumor necrosis
factor receptor I (THFRI) shedding (ARTS-1), associates
with the closely related ER aminopeptidase ERAP2, for
the final trimming of peptides within the ER for
presentation by MHC class I molecules. ERAP1 is
associated with ankylosing spondylitis (AS), an
inflammatory arthritis that predominantly affects the
spine. ERAP1 also aids in the shedding of membrane-bound
cytokine receptors. The tricorn interacting factor F3,
together with factors F1 and F2, degrades the tricorn
protease products, producing free amino acids, thus
completing the proteasomal degradation pathway. F3 is
homologous to F2, but not F1, and shows a strong
preference for glutamate in the P1' position. APQ, also
known as laeverin, is specifically expressed in human
embryo-derived extravillous trophoblasts (EVTs) that
invade the uterus during early placentation. It cleaves
the N-terminal amino acid of various peptides such as
angiotensin III, endokinin C, and kisspeptin-10, all
expressed in the placenta in large quantities. APN is a
receptor for coronaviruses, although the virus receptor
interaction site seems to be distinct from the enzymatic
site and aminopeptidase activity is not necessary for
viral infection. APNs are also putative Cry toxin
receptors. Cry1 proteins are pore-forming toxins that
bind to the midgut epithelial cell membrane of
susceptible insect larvae, causing extensive damage.
Several different toxins, including Cry1Aa, Cry1Ab,
Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to
bind to APNs; however, a direct role of APN in
cytotoxicity has been yet to be firmly established.
Length = 446
Score = 26.4 bits (59), Expect = 5.5
Identities = 9/22 (40%), Positives = 16/22 (72%)
Query: 32 ISINTLEPKWNSSMQFLIKDVQ 53
+ ++ LEP+WN QF++ D+Q
Sbjct: 324 LGVDHLEPEWNMWDQFVLDDLQ 345
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian
uncoordinated) proteins; fungal group. C2-like domains
are thought to be involved in phospholipid binding in a
Ca2+ independent manner in both Unc13 and Munc13.
Caenorabditis elegans Unc13 has a central domain with
sequence similarity to PKC, which includes C1 and
C2-related domains. Unc13 binds phorbol esters and DAG
with high affinity in a phospholipid manner. Mutations
in Unc13 results in abnormal neuronal connections and
impairment in cholinergic neurotransmission in the
nematode. Munc13 is the mammalian homolog which are
expressed in the brain. There are 3 isoforms
(Munc13-1, -2, -3) and are thought to play a role in
neurotransmitter release and are hypothesized to be
high-affinity receptors for phorbol esters. Unc13 and
Munc13 contain both C1 and C2 domains. There are two
C2 related domains present, one central and one at the
carboxyl end. Munc13-1 contains a third C2-like
domain. Munc13 interacts with syntaxin, synaptobrevin,
and synaptotagmin suggesting a role for these as
scaffolding proteins. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of
piccolo/aczonin and intersectin which only have a
single C2 domain. C2 domains with a calcium binding
region have negatively charged residues, primarily
aspartates, that serve as ligands for calcium ions.
This cd contains the second C2 repeat, C2B, and has a
type-II topology.
Length = 126
Score = 24.9 bits (55), Expect = 8.9
Identities = 10/49 (20%), Positives = 21/49 (42%), Gaps = 1/49 (2%)
Query: 28 TTSIISINTLEPKWNSSMQFLIKDVQEDVLCITVFDKGHYSPDEFLGKT 76
T I +TL P+W+ + + + + TV+D+ + G+
Sbjct: 39 KTRTIY-DTLNPRWDEEFELEVPAGEPLWISATVWDRSFVGKHDLCGRA 86
>gnl|CDD|236247 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma;
Provisional.
Length = 289
Score = 25.5 bits (56), Expect = 9.0
Identities = 19/83 (22%), Positives = 33/83 (39%), Gaps = 17/83 (20%)
Query: 48 LIKDVQ--EDVLCITVFDKG------HYSPDEFLGKTKR------VKGEAINPREPNLLM 93
LIKD+ E+V I + H P F+ + + + +P+
Sbjct: 158 LIKDLAEAENVKIIQSVTRDPEWPGCHGLPQGFIERVCKGVVTDLFREANTDPKNTYAA- 216
Query: 94 GSLCSKYVLYKFTVAEIIQRKFK 116
+C V+YKF E+I R ++
Sbjct: 217 --ICGPPVMYKFVFKELINRGYR 237
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.321 0.135 0.408
Gapped
Lambda K H
0.267 0.0645 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,132,564
Number of extensions: 512768
Number of successful extensions: 364
Number of sequences better than 10.0: 1
Number of HSP's gapped: 355
Number of HSP's successfully gapped: 51
Length of query: 127
Length of database: 10,937,602
Length adjustment: 85
Effective length of query: 42
Effective length of database: 7,167,512
Effective search space: 301035504
Effective search space used: 301035504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.4 bits)