RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy7083
(95 letters)
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The third SH3 domain (or SH3C) of
ITSN1 has been shown to bind many proteins including
dynamin1/2, CIN85, c-Cbl, SHIP2, Reps1, synaptojanin-1,
and WNK, among others. The SH3C of ITSN2 has been shown
to bind the K15 protein of Kaposi's sarcoma-associated
herpesvirus. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 52
Score = 98.6 bits (246), Expect = 3e-29
Identities = 39/52 (75%), Positives = 44/52 (84%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
YIA YPY+S EPGDLTFN +VI VTKK+ +WWTGTIGDRTG+FPSNYV P
Sbjct: 1 EYIALYPYESNEPGDLTFNAGDVILVTKKDGEWWTGTIGDRTGIFPSNYVRP 52
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or
SH3C) of Intersectin-2. Intersectin-2 (ITSN2) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN2 also functions as a
specific GEF for Cdc42 activation in epithelial
morphogenesis, and is required in mitotic spindle
orientation. It exists in alternatively spliced short
and long isoforms. The short isoform contains two Eps15
homology domains (EH1 and EH2), a coiled-coil region
and five SH3 domains (SH3A-E), while the long isoform,
in addition, contains RhoGEF (also called
Dbl-homologous or DH), Pleckstrin homology (PH) and C2
domains. The third SH3 domain (SH3C) of ITSN2 has been
shown to bind the K15 protein of Kaposi's
sarcoma-associated herpesvirus. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 83.5 bits (206), Expect = 3e-23
Identities = 36/51 (70%), Positives = 43/51 (84%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
YIA YPY S+EPGDLTFN+ E I VT+K+ +WWTG+I DRTG+FPSNYV P
Sbjct: 2 YIALYPYSSSEPGDLTFNEGEEILVTQKDGEWWTGSIEDRTGIFPSNYVRP 52
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or
SH3C) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
third SH3 domain (or SH3C) of ITSN1 has been shown to
bind many proteins including dynamin1/2, CIN85, c-Cbl,
SHIP2, Reps1, synaptojanin-1, and WNK, among others.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 80.0 bits (197), Expect = 8e-22
Identities = 35/51 (68%), Positives = 42/51 (82%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
Y+A Y Y+S E GDLTF Q +VI VTKK+ DWWTGT+GD+TG+FPSNYV P
Sbjct: 2 YVAMYTYESNEQGDLTFQQGDVILVTKKDGDWWTGTVGDKTGVFPSNYVRP 52
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and
similar fungal proteins. This family is composed of
the Saccharomyces cerevisiae proteins, Ysc84p (also
called LAS17-binding protein 4, Lsb4p) and Lsb3p, and
similar fungal proteins. They contain an N-terminal
SYLF domain (also called DUF500) and a C-terminal SH3
domain. Ysc84p localizes to actin patches and plays an
important in actin polymerization during endocytosis.
The N-terminal domain of both Ysc84p and Lsb3p can bind
and bundle actin filaments. A study of the yeast SH3
domain interactome predicts that the SH3 domains of
Lsb3p and Lsb4p may function as molecular hubs for the
assembly of endocytic complexes. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 67.8 bits (166), Expect = 6e-17
Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNYV 60
+A Y + +PGDL F + ++I + KK +NDWWTG IG R G+FP+NYV
Sbjct: 1 KAVALYDFAGEQPGDLAFQKGDIITILKKSDSQNDWWTGRIGGREGIFPANYV 53
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains. Src homology 3 (SH3)
domains bind to target proteins through sequences
containing proline and hydrophobic amino acids.
Pro-containing polypeptides may bind to SH3 domains in
2 different binding orientations.
Length = 56
Score = 66.4 bits (163), Expect = 2e-16
Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)
Query: 8 SQEYYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGD-RTGLFPSNYV 60
A Y Y + +P +L+F + ++I V +K +D WW G +G + GLFPSNYV
Sbjct: 1 EGPQVRALYDYTAQDPDELSFKKGDIITVLEKSDDGWWKGRLGRGKEGLFPSNYV 55
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily. Src Homology 3
(SH3) domains are protein interaction domains that bind
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. Thus, they
are referred to as proline-recognition domains (PRDs).
SH3 domains are less selective and show more diverse
specificity compared to other PRDs. They have been
shown to bind peptide sequences that lack the PxxP
motif; examples include the PxxDY motif of Eps8 and the
RKxxYxxY sequence in SKAP55. SH3 domain containing
proteins play versatile and diverse roles in the cell,
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies, among others. Many members of this
superfamily are adaptor proteins that associate with a
number of protein partners, facilitating complex
formation and signal transduction.
Length = 51
Score = 65.9 bits (162), Expect = 2e-16
Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 2/51 (3%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGD-RTGLFPSNY 59
Y A Y Y++ + +L+F + ++I V +K++D WW G + R GLFP+NY
Sbjct: 1 YARALYDYEAQDDDELSFKKGDIITVLEKDDDGWWEGELNGGREGLFPANY 51
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain
containing Ysc84-like 1 (SH3YL1) protein. SH3YL1
localizes to the plasma membrane and is required for
dorsal ruffle formation. It binds phosphoinositides
(PIs) with high affinity through its N-terminal SYLF
domain (also called DUF500). In addition, SH3YL1
contains a C-terminal SH3 domain which has been
reported to bind to N-WASP, dynamin 2, and SHIP2 (a PI
5-phosphatase). SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 63.6 bits (155), Expect = 2e-15
Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYV---TKKENDWWTGTIGDRTGLFPSNYV 60
A Y ++ +P DL+F + I V T + DWW G + R G+FP+NYV
Sbjct: 4 ALYSFEGQQPCDLSFQAGDRITVLTRTDSQFDWWEGRLRGRVGIFPANYV 53
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of
Growth factor receptor-bound protein 2 (GRB2) and
related proteins. This family includes the adaptor
protein GRB2 and related proteins including Drosophila
melanogaster Downstream of receptor kinase (DRK),
Caenorhabditis elegans Sex muscle abnormal protein 5
(Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
and similar proteins. Family members contain an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. GRAP2 plays
an important role in T cell receptor (TCR) signaling by
promoting the formation of the SLP-76:LAT complex,
which couples the TCR to the Ras pathway. GRAP acts as
a negative regulator of T cell receptor (TCR)-induced
lymphocyte proliferation by downregulating the
signaling to the Ras/ERK pathway. The C-terminal SH3
domains (SH3c) of GRB2 and GRAP2 have been shown to
bind to classical PxxP motif ligands, as well as to
non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 63.0 bits (154), Expect = 4e-15
Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
A Y ++ EPG+L F + ++I V + DWW G + R G+FP+NYV P
Sbjct: 4 ALYDFNPQEPGELEFRRGDIITVLDSSDPDWWKGELRGRVGIFPANYVQP 53
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast
stimulating factor 1. OSTF1, also named OSF or SH3P2,
is a signaling protein containing SH3 and
ankyrin-repeat domains. It acts through a Src-related
pathway to enhance the formation of osteoclasts and
bone resorption. It also acts as a negative regulator
of cell motility. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 61.9 bits (151), Expect = 9e-15
Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVT-KKENDWWTGTIGDRTGLFPSNYVVP 62
+ A Y Y++ P +L+F + +++Y++ K + +WW T G +TGL PSNYV
Sbjct: 2 FRALYDYEAQHPDELSFEEGDLLYISDKSDPNWWKATCGGKTGLIPSNYVEE 53
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The fifth SH3 domain (or SH3E) of
ITSN1 has been shown to bind many protein partners
including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
N-WASP, and synaptojanin-1, among others. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 57.0 bits (138), Expect = 9e-13
Identities = 23/51 (45%), Positives = 34/51 (66%), Gaps = 1/51 (1%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
IA +PY + +L+F + ++I V K++ DWW G + +TGLFPSNYV P
Sbjct: 3 IALFPYTAQNEDELSFQKGDIINVLSKDDPDWWRGELNGQTGLFPSNYVEP 53
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor
proteins. Abl interactor (Abi) proteins are adaptor
proteins serving as binding partners and substrates of
Abl tyrosine kinases. They are involved in regulating
actin cytoskeletal reorganization and play important
roles in membrane-ruffling, endocytosis, cell motility,
and cell migration. They localize to sites of actin
polymerization in epithelial adherens junction and
immune synapses, as well as to the leading edge of
lamellipodia. Vertebrates contain two Abi proteins,
Abi1 and Abi2. Abi1 displays a wide expression pattern
while Abi2 is highly expressed in the eye and brain.
Abi proteins contain a homeobox homology domain, a
proline-rich region, and a SH3 domain. The SH3 domain
of Abi binds to a PxxP motif in Abl. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 55.8 bits (135), Expect = 3e-12
Identities = 21/49 (42%), Positives = 33/49 (67%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
+A Y Y + + +L+F + ++IYVTKK ++ W+ G + TGLFP NYV
Sbjct: 3 VALYDYTADKDDELSFQEGDIIYVTKKNDDGWYEGVLNGVTGLFPGNYV 51
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie,
If, and similar proteins. Myosins Ie (MyoIe) and If
(MyoIf) are nonmuscle, unconventional, long tailed,
class I myosins containing an N-terminal motor domain
and a myosin tail with TH1, TH2, and SH3 domains. MyoIe
interacts with the endocytic proteins, dynamin and
synaptojanin-1, through its SH3 domain; it may play a
role in clathrin-dependent endocytosis. In the kidney,
MyoIe is critical for podocyte function and normal
glomerular filtration. Mutations in MyoIe is associated
with focal segmental glomerulosclerosis, a disease
characterized by massive proteinuria and progression to
end-stage kidney disease. MyoIf is predominantly
expressed in the immune system; it plays a role in
immune cell motility and innate immunity. Mutations in
MyoIf may be associated with the loss of hearing. The
MyoIf gene has also been found to be fused to the MLL
(Mixed lineage leukemia) gene in infant acute myeloid
leukemias (AML). SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 55.5 bits (134), Expect = 4e-12
Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A Y YD+ + +L+FN+ ++I + K+ + WWTG + + GLFP NYV
Sbjct: 4 ALYAYDAQDTDELSFNEGDIIEILKEDPSGWWTGRLRGKEGLFPGNYV 51
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive
eXchange factors. PIX proteins are Rho guanine
nucleotide exchange factors (GEFs), which activate
small GTPases by exchanging bound GDP for free GTP.
They act as GEFs for both Cdc42 and Rac 1, and have
been implicated in cell motility, adhesion, neurite
outgrowth, and cell polarity. Vertebrates contain two
proteins from the PIX subfamily, alpha-PIX and
beta-PIX. Alpha-PIX, also called ARHGEF6, is localized
in dendritic spines where it regulates spine
morphogenesis. Mutations in the ARHGEF6 gene cause
X-linked intellectual disability in humans. Beta-PIX
play roles in regulating neuroendocrine exocytosis,
focal adhesion maturation, cell migration, synaptic
vesicle localization, and insulin secretion. PIX
proteins contain an N-terminal SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains, and a C-terminal
leucine-zipper domain for dimerization. The SH3 domain
of PIX binds to an atypical PxxxPR motif in
p21-activated kinases (PAKs) with high affinity. The
binding of PAKs to PIX facilitate the localization of
PAKs to focal complexes and also localizes PAKs to PIX
targets Cdc43 and Rac, leading to the activation of
PAKs. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 54.2 bits (131), Expect = 1e-11
Identities = 20/48 (41%), Positives = 32/48 (66%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A + ++ T +L+F++ ++I VT+ E WW GT+ +TG FPSNYV
Sbjct: 4 AKFNFEGTNEDELSFDKGDIITVTQVVEGGWWEGTLNGKTGWFPSNYV 51
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain. SH3 (Src homology 3) domains are
often indicative of a protein involved in signal
transduction related to cytoskeletal organisation.
First described in the Src cytoplasmic tyrosine kinase.
The structure is a partly opened beta barrel.
Length = 47
Score = 53.0 bits (128), Expect = 3e-11
Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGT-IGDRTGLFPS 57
+A Y Y + EP +L+F + ++I V +K +D WW G G + GL PS
Sbjct: 1 VALYDYTAREPDELSFKKGDIIIVLEKSDDGWWKGRLKGGKEGLIPS 47
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain. SH3 (Src homology 3)
domains are often indicative of a protein involved in
signal transduction related to cytoskeletal
organisation. First described in the Src cytoplasmic
tyrosine kinase. The structure is a partly opened beta
barrel.
Length = 53
Score = 51.7 bits (125), Expect = 1e-10
Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDRTGLFPSNYVVP 62
Y + Y +T+P +L+ + +V+ V K+ N WW G G R GL PS+YV
Sbjct: 1 YGRVIFDYVATDPNELSLKKGDVVKVLDKDDNGWWEGERGGRRGLVPSSYVEE 53
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak
Interactive eXchange factor. Beta-PIX, also called Rho
guanine nucleotide exchange factor 7 (ARHGEF7) or Cool
(Cloned out of Library)-1, activates small GTPases by
exchanging bound GDP for free GTP. It acts as a GEF for
both Cdc42 and Rac 1, and plays important roles in
regulating neuroendocrine exocytosis, focal adhesion
maturation, cell migration, synaptic vesicle
localization, and insulin secretion. PIX proteins
contain an N-terminal SH3 domain followed by RhoGEF
(also called Dbl-homologous or DH) and Pleckstrin
Homology (PH) domains, and a C-terminal leucine-zipper
domain for dimerization. The SH3 domain of PIX binds to
an atypical PxxxPR motif in p21-activated kinases
(PAKs) with high affinity. The binding of PAKs to PIX
facilitate the localization of PAKs to focal complexes
and also localizes PAKs to PIX targets Cdc43 and Rac,
leading to the activation of PAKs. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 54
Score = 51.2 bits (122), Expect = 2e-10
Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
A + + T +L+F++ +VI+VT+ E WW GT RTG FPSNYV
Sbjct: 4 AKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYV 51
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of
CD2-associated protein and similar proteins. This
subfamily is composed of the first SH3 domain (SH3A) of
CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
similar domains. CD2AP and CIN85 are adaptor proteins
that bind to protein partners and assemble complexes
that have been implicated in T cell activation, kidney
function, and apoptosis of neuronal cells. They also
associate with endocytic proteins, actin cytoskeleton
components, and other adaptor proteins involved in
receptor tyrosine kinase (RTK) signaling. CD2AP and the
main isoform of CIN85 contain three SH3 domains, a
proline-rich region, and a C-terminal coiled-coil
domain. All of these domains enable CD2AP and CIN85 to
bind various protein partners and assemble complexes
that have been implicated in many different functions.
SH3A of both proteins bind to an atypical PXXXPR motif
at the C-terminus of Cbl and the cytoplasmic domain of
the cell adhesion protein CD2. CIN85 SH3A binds to
internal proline-rich motifs within the proline-rich
region; this intramolecular interaction serves as a
regulatory mechanism to keep CIN85 in a closed
conformation, preventing the recruitment of other
proteins. CIN85 SH3A has also been shown to bind
ubiquitin. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 51.1 bits (123), Expect = 2e-10
Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGDRTGLFPSNYV 60
I + YD+ EP +LT ++I V K E WW GT+ + G+FP N+V
Sbjct: 2 VIVEFDYDAEEPDELTLKVGDIITNVKKMEEGWWEGTLNGKRGMFPDNFV 51
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of
GRB2-related adaptor protein 2. GRAP2 is also called
GADS (GRB2-related adapter downstream of Shc), GrpL,
GRB2L, Mona, or GRID (Grb2-related protein with insert
domain). It is expressed specifically in the
hematopoietic system. It plays an important role in T
cell receptor (TCR) signaling by promoting the
formation of the SLP-76:LAT complex, which couples the
TCR to the Ras pathway. It also has roles in
antigen-receptor and tyrosine kinase mediated
signaling. GRAP2 is unique from other GRB2-like adaptor
proteins in that it can be regulated by caspase
cleavage. It contains an N-terminal SH3 domain, a
central SH2 domain, and a C-terminal SH3 domain. The
C-terminal SH3 domain of GRAP2 binds to different
motifs found in substrate peptides including the
typical PxxP motif in hematopoietic progenitor kinase 1
(HPK1), the RxxK motif in SLP-76 and HPK1, and the
RxxxxK motif in phosphatase-like protein HD-PTP. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 50.6 bits (121), Expect = 3e-10
Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
A Y +++ E +L FN +VI V N WW G + + GLFP+NYV P
Sbjct: 4 ALYDFEALEDDELGFNSGDVIEVLDSSNPSWWKGRLHGKLGLFPANYVAP 53
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine
nucleotide exchange factors. This subfamily is
composed of the Saccharomyces cerevisiae guanine
nucleotide exchange factors (GEFs) Sdc25 and Cdc25, and
similar proteins. These GEFs regulate Ras by
stimulating the GDP/GTP exchange on Ras. Cdc25 is
involved in the Ras/PKA pathway that plays an important
role in the regulation of metabolism, stress responses,
and proliferation, depending on available nutrients and
conditions. Proteins in this subfamily contain an
N-terminal SH3 domain as well as REM (Ras exchanger
motif) and RasGEF domains at the C-terminus. SH3
domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 55
Score = 49.2 bits (118), Expect = 1e-09
Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 6/53 (11%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRT-----GLFPSNY 59
+A Y + L+F ++IYV K + WW G I + G FPSNY
Sbjct: 3 VALYDFTPKSKNQLSFKAGDIIYVLNKDPSGWWDGVIISSSGKVKRGWFPSNY 55
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or
SH3E) of Intersectin-2. Intersectin-2 (ITSN2) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN2 also functions as a
specific GEF for Cdc42 activation in epithelial
morphogenesis, and is required in mitotic spindle
orientation. It exists in alternatively spliced short
and long isoforms. The short isoform contains two Eps15
homology domains (EH1 and EH2), a coiled-coil region
and five SH3 domains (SH3A-E), while the long isoform,
in addition, contains RhoGEF (also called
Dbl-homologous or DH), Pleckstrin homology (PH) and C2
domains. The fifth SH3 domain (or SH3E) of ITSN2 is
expected to bind protein partners, similar to ITSN1
which has been shown to bind many protein partners
including SGIP1, Sos1, dynamin1/2, CIN85, c-Cbl, SHIP2,
N-WASP, and synaptojanin-1, among others. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 49.2 bits (117), Expect = 1e-09
Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
IA Y Y + +L+F++ ++I V K++ DWW G I TGLFPSNYV
Sbjct: 4 IAMYDYTANNEDELSFSKGQLINVLNKDDPDWWQGEINGVTGLFPSNYV 52
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain
containing ring finger proteins. This model represents
the first SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
POSHER), SH3RF3 (POSH2), and similar domains. Members
of this family are scaffold proteins that function as
E3 ubiquitin-protein ligases. They all contain an
N-terminal RING finger domain and multiple SH3 domains;
SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
has three. SH3RF1 plays a role in calcium homeostasis
through the control of the ubiquitin domain protein
Herp. It may also have a role in regulating death
receptor mediated and JNK mediated apoptosis. SH3RF3
interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3RF2 acts
as an anti-apoptotic regulator of the JNK pathway by
binding to and promoting the degradation of SH3RF1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 48.5 bits (116), Expect = 2e-09
Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A Y Y+ EPGDL+F + ++I + K+ + +W+ G + G FP++YV
Sbjct: 4 ALYNYEGKEPGDLSFKKGDIILLRKRIDENWYHGECNGKQGFFPASYV 51
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of
SH3 and cysteine-rich domain-containing (Stac)
proteins. Stac proteins are putative adaptor proteins
that contain a cysteine-rich C1 domain and one or two
SH3 domains at the C-terminus. There are three
mammalian members (Stac1, Stac2, and Stac3) of this
family. Stac1 and Stac3 contain two SH3 domains while
Stac2 contains a single SH3 domain at the C-terminus.
This model represents the first C-terminal SH3 domain
of Stac1 and Stac3, and the single C-terminal SH3
domain of Stac2. Stac1 and Stac2 have been found to be
expressed differently in mature dorsal root ganglia
(DRG) neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 48.7 bits (116), Expect = 2e-09
Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
Y+A Y + E DL + I + N DWW G I DR G FP+N+V
Sbjct: 1 TYVALYKFKPQENEDLEMRPGDKITLLDDSNEDWWKGKIEDRVGFFPANFV 51
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator
Associated with Focal adhesion kinase and similar
proteins. This subfamily is composed of Rho GTPase
activating proteins (GAPs) with similarity to GRAF.
Members contain an N-terminal BAR domain, followed by a
Pleckstrin homology (PH) domain, a Rho GAP domain, and
a C-terminal SH3 domain. Although vertebrates harbor
four Rho GAPs in the GRAF subfamily including GRAF,
GRAF2, GRAF3, and Oligophrenin-1 (OPHN1), only three
are included in this model. OPHN1 contains the BAR, PH
and GAP domains, but not the C-terminal SH3 domain.
GRAF and GRAF2 show GAP activity towards RhoA and
Cdc42. GRAF influences Rho-mediated cytoskeletal
rearrangements and binds focal adhesion kinase. GRAF2
regulates caspase-activated p21-activated protein
kinase-2. The SH3 domain of GRAF and GRAF2 binds
PKNbeta, a target of the small GTPase Rho. SH3 domains
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs; they play a
role in the regulation of enzymes by intramolecular
interactions, changing the subcellular localization of
signal pathway components and mediate multiprotein
complex assemblies.
Length = 54
Score = 48.1 bits (115), Expect = 3e-09
Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 2/51 (3%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIY--VTKKENDWWTGTIGDRTGLFPSNYVVP 62
A Y + + +L+F ++I E W GT+ RTGL P NYV
Sbjct: 4 ALYACKAEDESELSFEPGQIITNVQPSDEPGWLEGTLNGRTGLIPENYVEF 54
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain
containing ring finger protein 1, an E3
ubiquitin-protein ligase. SH3RF1 is also called POSH
(Plenty of SH3s) or SH3MD2 (SH3 multiple domains
protein 2). It is a scaffold protein that acts as an E3
ubiquitin-protein ligase. It plays a role in calcium
homeostasis through the control of the ubiquitin domain
protein Herp. It may also have a role in regulating
death receptor mediated and JNK mediated apoptosis.
SH3RF1 also enhances the ubiquitination of ROMK1
potassium channel resulting in its increased
endocytosis. It contains an N-terminal RING finger
domain and four SH3 domains. This model represents the
first SH3 domain, located at the N-terminal half, of
SH3RF1. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 48.0 bits (114), Expect = 4e-09
Identities = 17/48 (35%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A Y Y+ EPGDL F++ ++I + ++ + +W+ G + G FP+N+V
Sbjct: 5 ALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTNFV 52
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3
domain of the p67phox subunit of NADPH oxidase.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox) which
plays a crucial role in the cellular response to
bacterial infection. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p67phox plays a regulatory role and contains
N-terminal TPR, first SH3 (or N-terminal or central
SH3), PB1, and C-terminal SH3 domains. It binds, via
its C-terminal SH3 domain, to a proline-rich region of
p47phox and upon activation, this complex assembles
with flavocytochrome b558, the Nox2-p22phox
heterodimer. Concurrently, RacGTP translocates to the
membrane and interacts with the TPR domain of p67phox,
which leads to the activation of NADPH oxidase. The PB1
domain of p67phox binds to its partner PB1 domain in
p40phox, and this facilitates the assembly of
p47phox-p67phox at the membrane. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 47.9 bits (114), Expect = 4e-09
Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
+A + Y++++P DL F + +VI V K N DW G + G+FPS +V
Sbjct: 1 QVVALFSYEASQPEDLEFQKGDVILVLSKVNEDWLEGQCKGKIGIFPSAFVED 53
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of
SH3 and cysteine-rich domain-containing protein 3
(Stac3). Stac proteins are putative adaptor proteins
that contain a cysteine-rich C1 domain and one or two
SH3 domains at the C-terminus. There are three
mammalian members (Stac1, Stac2, and Stac3) of this
family. Stac1 and Stac3 contain two SH3 domains while
Stac2 contains a single SH3 domain at the C-terminus.
Stac1 and Stac2 have been found to be expressed
differently in mature dorsal root ganglia (DRG)
neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 47.6 bits (113), Expect = 4e-09
Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYVV 61
Y++A Y + + E DL F+ E I V N+ WW G IG++TG FP N+++
Sbjct: 1 YFVALYRFKALEKDDLDFHPGERITVIDDSNEEWWRGKIGEKTGYFPMNFII 52
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3
domain of Fungal Actin-binding protein 1. Abp1 is an
adaptor protein that functions in receptor-mediated
endocytosis and vesicle trafficking. It contains an
N-terminal actin-binding module, the
actin-depolymerizing factor (ADF) homology domain, a
central proline-rich region, and a C-terminal SH3
domain (many yeast Abp1 proteins contain two C-terminal
SH3 domains). Yeast Abp1 also contains two acidic
domains that bind directly to the Arp2/3 complex, which
is required to initiate actin polymerization. The SH3
domain of yeast Abp1 binds and localizes the kinases,
Ark1p and Prk1p, which facilitate actin patch
disassembly following vesicle internalization. It also
mediates the localization to the actin patch of the
synaptojanin-like protein, Sjl2p, which plays a key
role in endocytosis. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 47.5 bits (113), Expect = 4e-09
Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTF-NQDEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
A Y YD+ E +L+F D++I + ++DWW G GLFPSNYV
Sbjct: 4 ALYDYDAAEDNELSFFENDKIINIEFVDDDWWLGECHGSRGLFPSNYV 51
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage
Kinases 1, 2, and 3. MLKs 1, 2, and 3 are
Serine/Threonine Kinases (STKs), catalyzing the
transfer of the gamma-phosphoryl group from ATP to S/T
residues on protein substrates. MLKs act as
mitogen-activated protein kinase kinase kinases
(MAP3Ks, MKKKs, MAPKKKs), which phosphorylate and
activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. MLKs play
roles in immunity and inflammation, as well as in cell
death, proliferation, and cell cycle regulation. Little
is known about the specific function of MLK1, also
called MAP3K9. It is capable of activating the c-Jun
N-terminal kinase pathway. Mice lacking both MLK1 and
MLK2 are viable, fertile, and have normal life spans.
MLK2, also called MAP3K10, is abundant in brain,
skeletal muscle, and testis. It functions upstream of
the MAPK, c-Jun N-terminal kinase. It binds
hippocalcin, a calcium-sensor protein that protects
neurons against calcium-induced cell death. Both MLK2
and hippocalcin may be associated with the pathogenesis
of Parkinson's disease. MLK3, also called MAP3K11, is
highly expressed in breast cancer cells and its
signaling through c-Jun N-terminal kinase has been
implicated in the migration, invasion, and malignancy
of cancer cells. It also functions as a negative
regulator of Inhibitor of Nuclear Factor-KappaB Kinase
(IKK) and thus, impacts inflammation and immunity. MLKs
contain an SH3 domain, a catalytic kinase domain, a
leucine zipper, a proline-rich region, and a CRIB
domain that mediates binding to GTP-bound Cdc42 and
Rac. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 47.8 bits (114), Expect = 4e-09
Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 6/58 (10%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND------WWTGTIGDRTGLFPSNYVVP 62
+ A + Y+++ +LT + + + V K++ WWTG I DR G+FPSNYV
Sbjct: 1 VWTAVFDYEASAEDELTLRRGDRVEVLSKDSAVSGDEGWWTGKINDRVGIFPSNYVTS 58
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide
Synthase TRaffic INducer. Nostrin is expressed in
endothelial and epithelial cells and is involved in the
regulation, trafficking and targeting of endothelial
NOS (eNOS). It facilitates the endocytosis of eNOS by
coordinating the functions of dynamin and the
Wiskott-Aldrich syndrome protein (WASP). Increased
expression of Nostrin may be correlated to
preeclampsia. Nostrin contains an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 47.3 bits (113), Expect = 5e-09
Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVT-KKENDWWTGTIGDRTGLFPSNYV 60
A Y Y + +L+ ++I V K+++ WW G + + G+FP+ YV
Sbjct: 4 ALYSYTANREDELSLQPGDIIEVHEKQDDGWWLGELNGKKGIFPATYV 51
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and
cysteine-rich domain-containing protein 2 (Stac2).
Stac proteins are putative adaptor proteins that
contain a cysteine-rich C1 domain and one or two SH3
domains at the C-terminus. There are three mammalian
members (Stac1, Stac2, and Stac3) of this family. Stac2
contains a single SH3 domain at the C-terminus unlike
Stac1 and Stac3, which contain two C-terminal SH3
domains. Stac1 and Stac2 have been found to be
expressed differently in mature dorsal root ganglia
(DRG) neurons. Stac1 is mainly expressed in peptidergic
neurons while Stac2 is found in a subset of
nonpeptidergic and all trkB+ neurons. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 47.6 bits (113), Expect = 5e-09
Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
Y+A Y + E DL + + V N DWW G GDR G FP+N+V
Sbjct: 2 YVALYKFLPQENNDLPLQPGDRVMVVDDSNEDWWKGKSGDRVGFFPANFV 51
>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases.
MLKs are Serine/Threonine Kinases (STKs), catalyzing
the transfer of the gamma-phosphoryl group from ATP to
S/T residues on protein substrates. MLKs act as
mitogen-activated protein kinase kinase kinases
(MAP3Ks, MKKKs, MAPKKKs), which phosphorylate and
activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. MLKs play
roles in immunity and inflammation, as well as in cell
death, proliferation, and cell cycle regulation.
Mammals have four MLKs (MLK1-4), mostly conserved in
vertebrates, which contain an SH3 domain, a catalytic
kinase domain, a leucine zipper, a proline-rich region,
and a CRIB domain that mediates binding to GTP-bound
Cdc42 and Rac. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 47.5 bits (113), Expect = 5e-09
Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 6/57 (10%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND------WWTGTIGDRTGLFPSNYVVP 62
+ A + YD+ +LT + + + V K+ WWTG IGD+ G+FPSNYV P
Sbjct: 2 WTALFDYDARGEDELTLRRGQPVEVLSKDAAVSGDEGWWTGKIGDKVGIFPSNYVAP 58
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and
double SH3 domains proteins. This group is composed of
FCH and double SH3 domains protein 1 (FCHSD1) and
FCHSD2. These proteins have a common domain structure
consisting of an N-terminal F-BAR (FES-CIP4 Homology
and Bin/Amphiphysin/Rvs), two SH3, and C-terminal
proline-rich domains. They have only been characterized
in silico and their functions remain unknown. This
group also includes the insect protein, nervous wreck,
which acts as a regulator of synaptic growth signaling.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 47.4 bits (113), Expect = 6e-09
Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 5/49 (10%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-----WWTGTIGDRTGLFPS 57
A Y Y++ +L+F + +I + +K+++ WW G R G+FPS
Sbjct: 4 ALYDYEAQSDEELSFPEGAIIRILRKDDNGVDDGWWEGEFNGRVGVFPS 52
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth
factor receptor-bound protein 2. GRB2 is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. It is
ubiquitously expressed in all tissues throughout
development and is important in cell cycle progression,
motility, morphogenesis, and angiogenesis. In
lymphocytes, GRB2 is associated with antigen receptor
signaling components. GRB2 contains an N-terminal SH3
domain, a central SH2 domain, and a C-terminal SH3
domain. The C-terminal SH3 domain of GRB2 binds to Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, as well as to the proline-rich C-terminus
of FGRF2. SH3 domains are protein interaction domains
that typically bind to proline-rich ligands with
moderate affinity and selectivity, preferentially to
PxxP motifs. They play versatile and diverse roles in
the cell including the regulation of enzymes, changing
the subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 47.1 bits (112), Expect = 6e-09
Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
A + +D E G+L F + + I V + +WW G +TG+FP NYV P
Sbjct: 4 ALFDFDPQEDGELGFRRGDFIEVMDNSDPNWWKGACHGQTGMFPRNYVTP 53
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of
CD2-associated protein. CD2AP, also called CMS (Cas
ligand with Multiple SH3 domains) or METS1
(Mesenchyme-to-Epithelium Transition protein with SH3
domains), is a cytosolic adaptor protein that plays a
role in regulating the cytoskeleton. It is critical in
cell-to-cell union necessary for kidney function. It
also stabilizes the contact between a T cell and
antigen-presenting cells. It is primarily expressed in
podocytes at the cytoplasmic face of the slit diaphragm
and serves as a linker anchoring podocin and nephrin to
the actin cytoskeleton. CD2AP contains three SH3
domains, a proline-rich region, and a C-terminal
coiled-coil domain. All of these domains enable CD2AP
to bind various protein partners and assemble complexes
that have been implicated in many different functions.
This alignment model represents the third SH3 domain
(SH3C) of CD2AP. SH3C has been shown to bind ubiquitin.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 47.5 bits (113), Expect = 6e-09
Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)
Query: 9 QEYYIAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNYVV 61
+EY A + Y+ T +L F + E+I + K E WW G + + G+FP N+V
Sbjct: 1 KEYCKALFHYEGTNEDELDFKEGEIILIISKDTGEPGWWKGELNGKEGVFPDNFVS 56
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A)
of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The first SH3 domain (or SH3A) of
ITSN1 has been shown to bind many proteins including
Sos1, dynamin1/2, CIN85, c-Cbl, PI3K-C2, SHIP2, N-WASP,
and CdGAP, among others. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 47.0 bits (112), Expect = 7e-09
Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNYV 60
Y A Y +++ P +++F ++I V + E W G + +TG FP+NYV
Sbjct: 1 KYRALYAFEARNPDEISFQPGDIIQVDESQVAEPGWLAGELKGKTGWFPANYV 53
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of
CD2-associated protein and similar proteins. This
subfamily is composed of the third SH3 domain (SH3C) of
CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and
similar domains. CD2AP and CIN85 are adaptor proteins
that bind to protein partners and assemble complexes
that have been implicated in T cell activation, kidney
function, and apoptosis of neuronal cells. They also
associate with endocytic proteins, actin cytoskeleton
components, and other adaptor proteins involved in
receptor tyrosine kinase (RTK) signaling. CD2AP and the
main isoform of CIN85 contain three SH3 domains, a
proline-rich region, and a C-terminal coiled-coil
domain. All of these domains enable CD2AP and CIN85 to
bind various protein partners and assemble complexes
that have been implicated in many different functions.
SH3C of both proteins have been shown to bind to
ubiquitin. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 47.0 bits (112), Expect = 7e-09
Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND---WWTGTIGDRTGLFPSNYVVP 62
+ Y++ +LT + +++ + K+ + WW G + + G+FP N+V P
Sbjct: 1 KARVLFDYEAENEDELTLREGDIVTILSKDCEDKGWWKGELNGKRGVFPDNFVEP 55
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or
SH3B) of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The second SH3 domain (or SH3B)
of ITSN1 has been shown to bind WNK and CdGAP. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 47.0 bits (112), Expect = 7e-09
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTI-GDRTGLFPSNYV 60
A YP+ + + L+F + ++I V +++ WW G + G G FP +YV
Sbjct: 2 ATALYPWRAKKENHLSFAKGDIITVLEQQEMWWFGELEGGEEGWFPKSYV 51
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV. This
subfamily is composed of proteins with similarity to
Myosin XVa. Myosin XVa is an unconventional myosin that
is critical for the normal growth of mechanosensory
stereocilia of inner ear hair cells. Mutations in the
myosin XVa gene are associated with nonsyndromic
hearing loss. Myosin XVa contains a unique N-terminal
extension followed by a motor domain, light
chain-binding IQ motifs, and a tail consisting of a
pair of MyTH4-FERM tandems separated by a SH3 domain,
and a PDZ domain. SH3 domains bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs; they play a role in the
regulation of enzymes by intramolecular interactions,
changing the subcellular localization of signal pathway
components and mediate multiprotein complex assemblies.
Length = 56
Score = 46.9 bits (112), Expect = 1e-08
Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND----WWTGTIGDRTGLFPSNYVVP 62
Y +A Y + + L+F++ +VI + KE W GT+ R+G FP YV P
Sbjct: 1 YVVAVRAYITRDQTLLSFHKGDVIKLLPKEGPLDPGWLFGTLDGRSGAFPKEYVQP 56
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak
Interactive eXchange factor. Alpha-PIX, also called
Rho guanine nucleotide exchange factor 6 (ARHGEF6) or
Cool (Cloned out of Library)-2, activates small GTPases
by exchanging bound GDP for free GTP. It acts as a GEF
for both Cdc42 and Rac 1, and is localized in dendritic
spines where it regulates spine morphogenesis. It
controls dendritic length and spine density in the
hippocampus. Mutations in the ARHGEF6 gene cause
X-linked intellectual disability in humans. PIX
proteins contain an N-terminal SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains, and a C-terminal
leucine-zipper domain for dimerization. The SH3 domain
of PIX binds to an atypical PxxxPR motif in
p21-activated kinases (PAKs) with high affinity. The
binding of PAKs to PIX facilitate the localization of
PAKs to focal complexes and also localizes PAKs to PIX
targets Cdc43 and Rac, leading to the activation of
PAKs. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 46.9 bits (111), Expect = 1e-08
Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTK-KENDWWTGTIGDRTGLFPSNYV 60
A + + T +L+ + ++IYVT+ +E WW GT+ +TG FPSNYV
Sbjct: 6 ARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGKTGWFPSNYV 53
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin
and related proteins. This subfamily includes
cortactin, Abp1 (actin-binding protein 1),
hematopoietic lineage cell-specific protein 1 (HS1),
and similar proteins. These proteins are involved in
regulating actin dynamics through direct or indirect
interaction with the Arp2/3 complex, which is required
to initiate actin polymerization. They all contain at
least one C-terminal SH3 domain. Cortactin and HS1 bind
Arp2/3 and actin through an N-terminal region that
contains an acidic domain and several copies of a
repeat domain found in cortactin and HS1. Abp1 binds
actin via an N-terminal actin-depolymerizing factor
(ADF) homology domain. Yeast Abp1 binds Arp2/3 directly
through two acidic domains. Mammalian Abp1 does not
directly interact with Arp2/3; instead, it regulates
actin dynamics indirectly by interacting with dynamin
and WASP family proteins. The C-terminal region of
these proteins acts as an adaptor or scaffold that can
connect membrane trafficking and signaling proteins
that bind the SH3 domain within the actin network. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 46.2 bits (110), Expect = 2e-08
Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGD-RTGLFPSNYV 60
A Y Y + E +++F + ++I + + + WW G + GLFP+NYV
Sbjct: 3 KALYDYQAAEDNEISFVEGDIITQIEQIDEGWWLGVNAKGQKGLFPANYV 52
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3
domain, ankyrin repeat and PH domain containing
proteins. ASAPs are Arf GTPase activating proteins
(GAPs) and they function in regulating cell growth,
migration, and invasion. They contain an N-terminal BAR
domain, followed by a Pleckstrin homology (PH) domain,
an Arf GAP domain, ankyrin (ANK) repeats, and a
C-terminal SH3 domain. Vertebrates contain at least
three members, ASAP1, ASAP2, and ASAP3, but some ASAP3
proteins do not seem to harbor a C-terminal SH3 domain.
ASAP1 and ASAP2 show GTPase activating protein (GAP)
activity towards Arf1 and Arf5. They do not show GAP
activity towards Arf6, but are able to mediate Arf6
signaling by binding stably to GTP-Arf6. ASAP3 is an
Arf6-specific GAP. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 45.8 bits (109), Expect = 2e-08
Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 4/50 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTI---GDRTGLFPSNY 59
A Y + +LTF++ E+I VT +E+ +WW G I R G+FP ++
Sbjct: 4 ALYDCQADNDDELTFSEGEIIVVTGEEDDEWWEGHIEGDPSRRGVFPVSF 53
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or
SH3E) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
fifth SH3 domain (or SH3E) of ITSN1 has been shown to
bind many protein partners including SGIP1, Sos1,
dynamin1/2, CIN85, c-Cbl, SHIP2, N-WASP, and
synaptojanin-1, among others. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 45.7 bits (108), Expect = 3e-08
Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
I Y Y + +L F++ ++I V KE+ DWW G + + GLFPSNYV
Sbjct: 4 IGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGELNGQVGLFPSNYV 52
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar
domains. This subfamily is composed of Saccharomyces
cerevisiae Bbc1p, also called Mti1p (Myosin tail
region-interacting protein), and similar proteins.
Bbc1p interacts with and regulates type I myosins in
yeast, Myo3p and Myo5p, which are involved in actin
cytoskeletal reorganization. It also binds and inhibits
Las17, a WASp family protein that functions as an
activator of the Arp2/3 complex. Bbc1p contains an
N-terminal SH3 domain. SH3 domains bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs; they play a role in the
regulation of enzymes by intramolecular interactions,
changing the subcellular localization of signal pathway
components and mediate multiprotein complex assemblies.
Length = 60
Score = 45.4 bits (108), Expect = 4e-08
Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 6/54 (11%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGD-----RTGLFPSNYV 60
A YPY+S DL F+ ++I VT++E DW+ G D + G+FP N+V
Sbjct: 5 KALYPYESDHEDDLNFDVGQLITVTEEEDADWYFGEYVDSNGNTKEGIFPKNFV 58
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor
proteins. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2 (also called Nckbeta or
Growth factor receptor-bound protein 4, Grb4), which
show partly overlapping functions but also bind
distinct targets. Their SH3 domains are involved in
recruiting downstream effector molecules, such as the
N-WASP/Arp2/3 complex, which when activated induces
actin polymerization that results in the production of
pedestals, or protrusions of the plasma membrane. The
second SH3 domain of Nck appears to prefer ligands
containing the APxxPxR motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially a PxxP motif. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 45.3 bits (108), Expect = 4e-08
Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYVVP 62
+ + Y++ +L+ + + + V +K +D WW G + G FPSNYV
Sbjct: 2 AVVKFNYEAQREDELSLRKGDRVLVLEKSSDGWWRGECNGQVGWFPSNYVTE 53
>gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C
(PLC) gamma 2. PLCgamma2 is primarily expressed in
haematopoietic cells, specifically in B cells. It is
activated by tyrosine phosphorylation by B cell
receptor (BCR) kinases and is recruited to the plasma
membrane where its substrate is located. It is required
in pre-BCR signaling and in the maturation of B cells.
PLCs catalyze the hydrolysis of phosphatidylinositol
(4,5)-bisphosphate [PtdIns(4,5)P2] to produce
Ins(1,4,5)P3 and diacylglycerol (DAG). Ins(1,4,5)P3
initiates the calcium signaling cascade while DAG
functions as an activator of PKC. PLCgamma contains a
Pleckstrin homology (PH) domain followed by an
elongation factor (EF) domain, two catalytic regions of
PLC domains that flank two tandem SH2 domains, followed
by a SH3 domain and C2 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 45.2 bits (107), Expect = 4e-08
Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGDRTG-LFPSNYV 60
A Y Y + +L+F + +I+ V+K+ WW G G + FPSNYV
Sbjct: 4 ALYDYRAKRSDELSFCKGALIHNVSKETGGWWKGDYGGKVQHYFPSNYV 52
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of
GRB2-related adaptor protein. GRAP is a GRB-2 like
adaptor protein that is highly expressed in lymphoid
tissues. It acts as a negative regulator of T cell
receptor (TCR)-induced lymphocyte proliferation by
downregulating the signaling to the Ras/ERK pathway. It
has been identified as a regulator of TGFbeta signaling
in diabetic kidney tubules and may have a role in the
pathogenesis of the disease. GRAP contains an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. The C-terminal SH3 domains
(SH3c) of the related proteins, GRB2 and GRAP2, have
been shown to bind to classical PxxP motif ligands, as
well as to non-classical motifs. GRB2 SH3c binds Gab2
(Grb2-associated binder 2) through epitopes containing
RxxK motifs, while the SH3c of GRAP2 binds to the
phosphatase-like protein HD-PTP via a RxxxxK motif. SH3
domains are protein interaction domains that typically
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 44.8 bits (106), Expect = 5e-08
Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
A Y + + +P L+F + ++I V + +WW G I R G FP NYV P
Sbjct: 4 AQYDFSAEDPSQLSFRRGDIIEVLDCPDPNWWRGRISGRVGFFPRNYVHP 53
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing
Adaptor Molecules. STAMs were discovered as proteins
that are highly phosphorylated following cytokine and
growth factor stimulation. They function in cytokine
signaling and surface receptor degradation, as well as
regulate Golgi morphology. They associate with many
proteins including Jak2 and Jak3 tyrosine kinases, Hrs,
AMSH, and UBPY. STAM adaptor proteins contain VHS
(Vps27, Hrs, STAM homology), ubiquitin interacting
(UIM), and SH3 domains. There are two vertebrate STAMs,
STAM1 and STAM2, which may be functionally redundant;
vertebrate STAMs contain ITAM motifs. They are part of
the endosomal sorting complex required for transport
(ESCRT-0). STAM2 deficiency in mice did not cause any
obvious abnormality, while STAM1 deficiency resulted in
growth retardation. Loss of both STAM1 and STAM2 in
mice proved lethal, indicating that STAMs are important
for embryonic development. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 44.8 bits (106), Expect = 7e-08
Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A Y +++ E +LTF E+I V + +WW G+ GLFP+N+V
Sbjct: 5 ALYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGSNHRGEGLFPANFV 52
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of
the p67phox subunit of NADPH oxidase and similar
proteins. This subfamily is composed of p67phox, NADPH
oxidase activator 1 (Noxa1), and similar proteins.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), and Noxa1 are homologs and are the cytosolic
subunits of the phagocytic (Nox2) and nonphagocytic
(Nox1) NADPH oxidase complexes, respectively. NADPH
oxidase catalyzes the transfer of electrons from NADPH
to oxygen during phagocytosis forming superoxide and
reactive oxygen species. p67phox and Noxa1 play
regulatory roles. p67phox contains N-terminal TPR,
first SH3 (or N-terminal or central SH3), PB1, and
C-terminal SH3 domains. Noxa1 has a similar domain
architecture except it is lacking the N-terminal SH3
domain. The TPR domain of both binds activated
GTP-bound Rac, while the C-terminal SH3 domain of
p67phox and Noxa1 binds the polyproline motif found at
the C-terminus of p47phox and Noxo1, respectively. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 44.4 bits (105), Expect = 7e-08
Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
+A + Y++ P DL F + + I V + N W G R G+FP +VVP
Sbjct: 3 VALHRYEAQGPEDLGFREGDTIDVLSEVNEAWLEGHSDGRVGIFPKCFVVP 53
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain
containing ring finger 3, an E3 ubiquitin-protein
ligase. SH3RF3 is also called POSH2 (Plenty of SH3s 2)
or SH3MD4 (SH3 multiple domains protein 4). It is a
scaffold protein with E3 ubiquitin-protein ligase
activity. It was identified in the screen for
interacting partners of p21-activated kinase 2 (PAK2).
It may play a role in regulating JNK mediated apoptosis
in certain conditions. It also interacts with
GTP-loaded Rac1. SH3RF3 is highly homologous to SH3RF1;
it also contains an N-terminal RING finger domain and
four SH3 domains. This model represents the first SH3
domain, located at the N-terminal half, of SH3RF3. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 44.1 bits (104), Expect = 1e-07
Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
A Y Y+ EPGDL FN+ ++I + +K ++ W+ G + G P++Y+
Sbjct: 5 ALYSYEGKEPGDLKFNKGDIIILRRKVDENWYHGELNGCHGFLPASYI 52
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I
fungal Myosins. Type I myosins (myosin-I) are
actin-dependent motors in endocytic actin structures
and actin patches. They play roles in membrane traffic
in endocytic and secretory pathways, cell motility, and
mechanosensing. Saccharomyces cerevisiae has two
myosins-I, Myo3 and Myo5, which are involved in
endocytosis and the polarization of the actin
cytoskeleton. Myosin-I contains an N-terminal
actin-activated ATPase, a phospholipid-binding TH1
(tail homology 1) domain, and a C-terminal extension
which includes an F-actin-binding TH2 domain, an SH3
domain, and an acidic peptide that participates in
activating the Arp2/3complex. The SH3 domain of
myosin-I is required for myosin-I-induced actin
polymerization. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 43.9 bits (104), Expect = 1e-07
Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDRT--GLFPSNYVVP 62
Y A Y + + +L+ +D+++Y+ +KE N WW D + G P+ Y+
Sbjct: 2 YKALYDFAGSVANELSLKKDDIVYIVQKEDNGWWLAKKLDESKEGWVPAAYLEE 55
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2.
Abi2 is highly expressed in the brain and eye. It
regulates actin cytoskeletal reorganization at adherens
junctions and dendritic spines, which is important in
cell morphogenesis, migration, and cognitive function.
Mice deficient with Abi2 show defects in orientation
and migration of lens fibers, neuronal migration,
dendritic spine morphology, as well as deficits in
learning and memory. Abi proteins are adaptor proteins
serving as binding partners and substrates of Abl
tyrosine kinases. They are involved in regulating actin
cytoskeletal reorganization and play important roles in
membrane-ruffling, endocytosis, cell motility, and cell
migration. Abi proteins contain a homeobox homology
domain, a proline-rich region, and a SH3 domain. The
SH3 domain of Abi binds to a PxxP motif in Abl. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 61
Score = 44.2 bits (104), Expect = 1e-07
Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
E +A Y Y + +L+F + +IYV KK +D W+ G + TGLFP NYV
Sbjct: 3 EKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYV 54
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox
subunit of NADPH oxidase and similar domains. This
family is composed of the tandem SH3 domains of p47phox
subunit of NADPH oxidase and Nox Organizing protein 1
(NoxO1), the four SH3 domains of Tks4 (Tyr kinase
substrate with four SH3 domains), the five SH3 domains
of Tks5, the SH3 domain of obscurin, Myosin-I, and
similar domains. Most members of this group also
contain Phox homology (PX) domains, except for obscurin
and Myosin-I. p47phox and NoxO1 are regulators of the
phagocytic NADPH oxidase complex (also called Nox2 or
gp91phox) and nonphagocytic NADPH oxidase Nox1,
respectively. They play roles in the activation of
their respective NADPH oxidase, which catalyzes the
transfer of electrons from NADPH to molecular oxygen to
form superoxide. Tks proteins are Src substrates and
scaffolding proteins that play important roles in the
formation of podosomes and invadopodia, the dynamic
actin-rich structures that are related to cell
migration and cancer cell invasion. Obscurin is a giant
muscle protein that plays important roles in the
organization and assembly of the myofibril and the
sarcoplasmic reticulum. Type I myosins (Myosin-I) are
actin-dependent motors in endocytic actin structures
and actin patches. They play roles in membrane traffic
in endocytic and secretory pathways, cell motility, and
mechanosensing. Myosin-I contains an N-terminal
actin-activated ATPase, a phospholipid-binding TH1
(tail homology 1) domain, and a C-terminal extension
which includes an F-actin-binding TH2 domain, an SH3
domain, and an acidic peptide that participates in
activating the Arp2/3complex. The SH3 domain of
myosin-I is required for myosin-I-induced actin
polymerization. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 43.8 bits (104), Expect = 1e-07
Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYVVP 62
Y+A Y++ +++ + EV+ V +K ++ WW GD+ G P++Y+ P
Sbjct: 2 YVAIADYEAQGDDEISLQEGEVVEVLEKNDSGWWYVRKGDKEGWVPASYLEP 53
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing
Adaptor Molecule 2. STAM2, also called EAST (Epidermal
growth factor receptor-associated protein with SH3 and
TAM domain) or Hbp (Hrs binding protein), is part of
the endosomal sorting complex required for transport
(ESCRT-0). It plays a role in sorting mono-ubiquinated
endosomal cargo for trafficking to the lysosome for
degradation. It is also involved in the regulation of
exocytosis. STAMs were discovered as proteins that are
highly phosphorylated following cytokine and growth
factor stimulation. They function in cytokine signaling
and surface receptor degradation, as well as regulate
Golgi morphology. They associate with many proteins
including Jak2 and Jak3 tyrosine kinases, Hrs, AMSH,
and UBPY. STAM adaptor proteins contain VHS (Vps27,
Hrs, STAM homology), ubiquitin interacting (UIM), and
SH3 domains. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 43.9 bits (103), Expect = 2e-07
Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A Y +++ E +LTF E+I V + +WW G GLFPSN+V
Sbjct: 6 ALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGVGLFPSNFV 53
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal
peroxisomal membrane protein Pex13p. Pex13p, located
in the peroxisomal membrane, contains two transmembrane
regions and a C-terminal SH3 domain. It binds to the
peroxisomal targeting type I (PTS1) receptor Pex5p and
the docking factor Pex14p through its SH3 domain. It is
essential for both PTS1 and PTS2 protein import
pathways into the peroxisomal matrix. Pex13p binds
Pex14p, which contains a PxxP motif, in a classical
fashion to the proline-rich ligand binding site of its
SH3 domain. It binds the WxxxF/Y motif of Pex5p in a
novel site that does not compete with Pex14p binding.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 60
Score = 43.4 bits (103), Expect = 2e-07
Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 8/55 (14%)
Query: 14 AAYPYDSTEPG-DLTFNQDEVIYVTKK------ENDWWTGTIGD-RTGLFPSNYV 60
A Y + P +L+ + +++ V K +++WW G D R G FPSNYV
Sbjct: 4 ALYDFTPENPEMELSLKKGDIVAVLSKTDPLGRDSEWWKGRTRDGRIGWFPSNYV 58
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3
domain-containing protein 21 (SH3D21) and similar
proteins. N-terminal SH3 domain of the uncharacterized
protein SH3 domain-containing protein 21, and similar
uncharacterized domains, it belongs to the CD2AP-like_3
subfamily of proteins. The CD2AP-like_3 subfamily is
composed of the third SH3 domain (SH3C) of CD2AP, CIN85
(Cbl-interacting protein of 85 kDa), and similar
domains. CD2AP and CIN85 are adaptor proteins that bind
to protein partners and assemble complexes that have
been implicated in T cell activation, kidney function,
and apoptosis of neuronal cells. They also associate
with endocytic proteins, actin cytoskeleton components,
and other adaptor proteins involved in receptor
tyrosine kinase (RTK) signaling. CD2AP and the main
isoform of CIN85 contain three SH3 domains, a
proline-rich region, and a C-terminal coiled-coil
domain. All of these domains enable CD2AP and CIN85 to
bind various protein partners and assemble complexes
that have been implicated in many different functions.
SH3C of both proteins have been shown to bind to
ubiquitin. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 43.2 bits (102), Expect = 2e-07
Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND---WWTGTIGDRTGLFPSNYVVP 62
Y + Y+ P +L + +VI V KE + WW G + R G FP N+V+P
Sbjct: 1 YCRVLFDYNPVAPDELALKKGDVIEVISKETEDEGWWEGELNGRRGFFPDNFVMP 55
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A.
Endophilins play roles in synaptic vesicle formation,
virus budding, mitochondrial morphology maintenance,
receptor-mediated endocytosis inhibition, and endosomal
sorting. They are classified into two types, A and B.
Vertebrates contain three endophilin-A isoforms (A1,
A2, and A3). Endophilin-A proteins are enriched in the
brain and play multiple roles in receptor-mediated
endocytosis. They tubulate membranes and regulate
calcium influx into neurons to trigger the activation
of the endocytic machinery. They are also involved in
the sorting of plasma membrane proteins, actin filament
assembly, and the uncoating of clathrin-coated vesicles
for fusion with endosomes. Endophilins contain an
N-terminal N-BAR domain (BAR domain with an additional
N-terminal amphipathic helix), followed by a variable
region containing proline clusters, and a C-terminal
SH3 domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 43.4 bits (103), Expect = 2e-07
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 3/49 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK--ENDWWTGTIGDRTGLFPSNYV 60
A Y ++ G+L F + ++I +T + EN W+ G + ++G FP NYV
Sbjct: 5 ALYDFEPENEGELGFKEGDIITLTNQIDEN-WYEGMVNGQSGFFPVNYV 52
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like
Rho guanine nucleotide exchange factors. Members of
this family contain a SH3 domain followed by RhoGEF
(also called Dbl-homologous or DH) and Pleckstrin
Homology (PH) domains. They include the Rho guanine
nucleotide exchange factors ARHGEF9, ASEF (also called
ARHGEF4), ASEF2, and similar proteins. GEFs activate
small GTPases by exchanging bound GDP for free GTP.
ARHGEF9 specifically activates Cdc42, while both ASEF
and ASEF2 can activate Rac1 and Cdc42. ARHGEF9 is
highly expressed in the brain and it interacts with
gephyrin, a postsynaptic protein associated with GABA
and glycine receptors. ASEF plays a role in
angiogenesis and cell migration. ASEF2 is important in
cell migration and adhesion dynamics. ASEF exists in an
autoinhibited form and is activated upon binding of the
tumor suppressor APC (adenomatous polyposis coli),
leading to the activation of Rac1 or Cdc42. In its
autoinhibited form, the SH3 domain of ASEF forms an
extensive interface with the DH and PH domains,
blocking the Rac binding site. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 43.1 bits (102), Expect = 2e-07
Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A + + + +P +L F +VI V + DWW G+I D G FP+++V
Sbjct: 1 LAEALWDHVTMDPEELGFKAGDVIEVLDMSDKDWWWGSIRDEEGWFPASFV 51
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin.
Cortactin was originally identified as a substrate of
Src kinase. It is an actin regulatory protein that
binds to the Arp2/3 complex and stabilizes branched
actin filaments. It is involved in cellular processes
that affect cell motility, adhesion, migration,
endocytosis, and invasion. It is expressed ubiquitously
except in hematopoietic cells, where the homolog
hematopoietic lineage cell-specific 1 (HS1) is
expressed instead. Cortactin contains an N-terminal
acidic domain, several copies of a repeat domain found
in cortactin and HS1, a proline-rich region, and a
C-terminal SH3 domain. The N-terminal region interacts
with the Arp2/3 complex and F-actin, and is crucial in
regulating branched actin assembly. Cortactin also
serves as a scaffold and provides a bridge to the actin
cytoskeleton for membrane trafficking and signaling
proteins that bind to its SH3 domain. Binding partners
for the SH3 domain of cortactin include dynamin2,
N-WASp, MIM, FGD1, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 42.8 bits (101), Expect = 3e-07
Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVI-YVTKKENDWWTGTIGDRTGLFPSNYV 60
+A Y Y + + +++F+ D++I + + WW G + GLFP+NYV
Sbjct: 3 VALYDYQAADDDEISFDPDDIITNIEMIDEGWWRGVCRGKYGLFPANYV 51
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox
subunit of NADPH oxidase. p40phox, also called
Neutrophil cytosol factor 4 (NCF-4), is a cytosolic
subunit of the phagocytic NADPH oxidase complex (also
called Nox2 or gp91phox) which plays a crucial role in
the cellular response to bacterial infection. NADPH
oxidase catalyzes the transfer of electrons from NADPH
to oxygen during phagocytosis forming superoxide and
reactive oxygen species. p40phox positively regulates
NADPH oxidase in both phosphatidylinositol-3-phosphate
(PI3P)-dependent and PI3P-independent manner. It
contains an N-terminal PX domain, a central SH3 domain,
and a C-terminal PB1 domain that interacts with
p67phox. The SH3 domain of p40phox binds to canonical
polyproline and noncanonical motifs at the C-terminus
of p47phox. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 42.5 bits (100), Expect = 4e-07
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A + + +L F +VI++ + N DW GT+ TG+FP ++V
Sbjct: 4 ALFDFTGNSKLELNFKAGDVIFLLSRVNKDWLEGTVRGATGIFPLSFV 51
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and
SH3 domain containing (Sorbs) proteins and similar
domains. This family, also called the vinexin family,
is composed predominantly of adaptor proteins
containing one sorbin homology (SoHo) and three SH3
domains. Members include the second SH3 domains of
Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or
Sorbs3), and similar domains. They are involved in the
regulation of cytoskeletal organization, cell adhesion,
and growth factor signaling. Members of this family
bind multiple partners including signaling molecules
like c-Abl, c-Arg, Sos, and c-Cbl, as well as
cytoskeletal molecules such as vinculin and afadin.
They may have overlapping functions. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 42.3 bits (100), Expect = 4e-07
Identities = 17/49 (34%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
A Y +++ +L+F + +VI +T++ ++ W+ G IG R G+FP +YV
Sbjct: 3 RAKYNFNADTGVELSFRKGDVITLTRRVDENWYEGRIGGRQGIFPVSYV 51
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C
(PLC) gamma. PLC catalyzes the hydrolysis of
phosphatidylinositol (4,5)-bisphosphate [PtdIns(4,5)P2]
to produce Ins(1,4,5)P3 and diacylglycerol (DAG) in
response to various receptors. Ins(1,4,5)P3 initiates
the calcium signaling cascade while DAG functions as an
activator of PKC. PLCgamma catalyzes this reaction in
tyrosine kinase-dependent signaling pathways. It is
activated and recruited to its substrate at the
membrane. Vertebrates contain two forms of PLCgamma,
PLCgamma1, which is widely expressed, and PLCgamma2,
which is primarily found in haematopoietic cells.
PLCgamma contains a Pleckstrin homology (PH) domain
followed by an elongation factor (EF) domain, two
catalytic regions of PLC domains that flank two tandem
SH2 domains, followed by a SH3 domain and C2 domain.
The SH3 domain of PLCgamma1 directly interacts with
dynamin-1 and can serve as a guanine nucleotide
exchange factor (GEF). It also interacts with Cbl,
inhibiting its phosphorylation and activity. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 42.3 bits (100), Expect = 5e-07
Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGDR-TGLFPSNYV 60
A Y Y + P +L+F + +I V K++ WW G G + FP+NYV
Sbjct: 4 ALYDYRAQRPDELSFCKHAIITNVEKEDGGWWRGDYGGKKQKWFPANYV 52
>gnl|CDD|212937 cd12004, SH3_Lyn, Src homology 3 domain of Lyn Protein Tyrosine
Kinase. Lyn is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
Lyn is expressed in B lymphocytes and myeloid cells. It
exhibits both positive and negative regulatory roles in
B cell receptor (BCR) signaling. Lyn, as well as Fyn
and Blk, promotes B cell activation by phosphorylating
ITAMs (immunoreceptor tyr activation motifs) in CD19
and in Ig components of BCR. It negatively regulates
signaling by its unique ability to phosphorylate ITIMs
(immunoreceptor tyr inhibition motifs) in cell surface
receptors like CD22 and CD5. Lyn also plays an
important role in G-CSF receptor signaling by
phosphorylating a variety of adaptor molecules. Src
kinases contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 42.7 bits (100), Expect = 5e-07
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGT--IGDRTGLFPSNYV 60
+A YPYD DL+F + E + V ++ +WW + G PSNYV
Sbjct: 3 VALYPYDGIHEDDLSFKKGEKLKVIEEHGEWWKARSLTTKKEGFIPSNYV 52
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of
CD2-associated protein and similar proteins. This
subfamily is composed of the second SH3 domain (SH3B)
of CD2AP, CIN85 (Cbl-interacting protein of 85 kDa),
and similar domains. CD2AP and CIN85 are adaptor
proteins that bind to protein partners and assemble
complexes that have been implicated in T cell
activation, kidney function, and apoptosis of neuronal
cells. They also associate with endocytic proteins,
actin cytoskeleton components, and other adaptor
proteins involved in receptor tyrosine kinase (RTK)
signaling. CD2AP and the main isoform of CIN85 contain
three SH3 domains, a proline-rich region, and a
C-terminal coiled-coil domain. All of these domains
enable CD2AP and CIN85 to bind various protein partners
and assemble complexes that have been implicated in
many different functions. SH3B of both proteins have
been shown to bind to Cbl. In the case of CD2AP, its
SH3B binds to Cbl at a site distinct from the
c-Cbl/SH3A binding site. The CIN85 SH3B also binds
ubiquitin. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 42.3 bits (100), Expect = 5e-07
Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
+ Y +L + I V + + WW G + + G+FPSN+V
Sbjct: 4 VLFSYTPQNEDELELKVGDTIEVLGEVEEGWWEGKLNGKVGVFPSNFV 51
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1.
Abi1, also called e3B1, is a central regulator of actin
cytoskeletal reorganization through interactions with
many protein complexes. It is part of WAVE, a
nucleation-promoting factor complex, that links Rac 1
activation to actin polymerization causing lamellipodia
protrusion at the plasma membrane. Abi1 interact with
formins to promote protrusions at the leading edge of
motile cells. It also is a target of alpha4 integrin,
regulating membrane protrusions at sites of integrin
engagement. Abi proteins are adaptor proteins serving
as binding partners and substrates of Abl tyrosine
kinases. They are involved in regulating actin
cytoskeletal reorganization and play important roles in
membrane-ruffling, endocytosis, cell motility, and cell
migration. Abi proteins contain a homeobox homology
domain, a proline-rich region, and a SH3 domain. The
SH3 domain of Abi binds to a PxxP motif in Abl. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 59
Score = 42.7 bits (100), Expect = 5e-07
Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
+A Y Y + +L+F + +IYV KK +D W+ G TGLFP NYV
Sbjct: 3 VAIYDYSKDKDDELSFMEGAIIYVIKKNDDGWYEGVCNGVTGLFPGNYV 51
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing
Adaptor Molecule 1. STAM1 is part of the endosomal
sorting complex required for transport (ESCRT-0) and is
involved in sorting ubiquitinated cargo proteins from
the endosome. It may also be involved in the regulation
of IL2 and GM-CSF mediated signaling, and has been
implicated in neural cell survival. STAMs were
discovered as proteins that are highly phosphorylated
following cytokine and growth factor stimulation. They
function in cytokine signaling and surface receptor
degradation, as well as regulate Golgi morphology. They
associate with many proteins including Jak2 and Jak3
tyrosine kinases, Hrs, AMSH, and UBPY. STAM adaptor
proteins contain VHS (Vps27, Hrs, STAM homology),
ubiquitin interacting (UIM), and SH3 domains. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 41.9 bits (98), Expect = 8e-07
Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A Y +++ E +LTF ++I + + +WW G TGLFPSN+V
Sbjct: 5 AIYDFEAAEDNELTFKAGDIITILDDSDPNWWKGETPQGTGLFPSNFV 52
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding
protein Eve-1. Eve-1, also called SH3
domain-containing protein 19 (SH3D19) or EEN-binding
protein (EBP), exists in multiple alternatively spliced
isoforms. The longest isoform contains five SH3 domain
in the C-terminal region and seven proline-rich motifs
in the N-terminal region. It is abundantly expressed in
skeletal muscle and heart, and may be involved in
regulating the activity of ADAMs (A disintegrin and
metalloproteases). Eve-1 interacts with EEN, an
endophilin involved in endocytosis and may be the
target of the MLL-EEN fusion protein that is implicated
in leukemogenesis. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 52
Score = 41.8 bits (98), Expect = 9e-07
Identities = 14/37 (37%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
Query: 25 DLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
DL+ N E++Y+ +K + +W+ G + TG+FP+N+V
Sbjct: 15 DLSLNSGEIVYLLEKIDTEWYRGKCKNTTGIFPANHV 51
>gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or
SH3B) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
second SH3 domain (or SH3B) of ITSN1 has been shown to
bind WNK and CdGAP. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 52
Score = 41.6 bits (97), Expect = 1e-06
Identities = 17/47 (36%), Positives = 30/47 (63%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
A YP+ + + L FN+++VI V ++++ WW G + + G FP +YV
Sbjct: 4 ALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPKSYV 50
>gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH
oxidase activator 1. Noxa1 is a homolog of p67phox and
is a cytosolic subunit of the nonphagocytic NADPH
oxidase complex Nox1, which catalyzes the transfer of
electrons from NADPH to molecular oxygen to form
superoxide. Noxa1 is co-expressed with Nox1 in colon,
stomach, uterus, prostate, and vascular smooth muscle
cells, consistent with its regulatory role. It does not
interact with p40phox, unlike p67phox, making Nox1
activity independent of p40phox, unlike Nox2. Noxa1
contains TPR, PB1, and C-terminal SH3 domains, but
lacks the central SH3 domain that is present in
p67phox. The TPR domain binds activated GTP-bound Rac.
The C-terminal SH3 domain binds the polyproline motif
found at the C-terminus of Noxo1, a homolog of p47phox.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 41.3 bits (97), Expect = 1e-06
Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
+A + Y + P DL F+Q + I + + N +W G R G+FP + V
Sbjct: 3 VAQHDYSAQGPEDLEFSQGDTIDILSEVNQEWLEGHCDGRIGIFPKCFAVR 53
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase
Activating Proteins. Slit-Robo GTPase Activating
Proteins (srGAPs) are Rho GAPs that interact with
Robo1, the transmembrane receptor of Slit proteins.
Slit proteins are secreted proteins that control axon
guidance and the migration of neurons and leukocytes.
Vertebrates contain three isoforms of srGAPs
(srGAP1-3), all of which are expressed during embryonic
and early development in the nervous system but with
different localization and timing. A fourth member has
also been reported (srGAP4, also called ARHGAP4).
srGAPs contain an N-terminal F-BAR domain, a Rho GAP
domain, and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 40.8 bits (96), Expect = 2e-06
Identities = 13/51 (25%), Positives = 23/51 (45%), Gaps = 1/51 (1%)
Query: 13 IAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
A + Y +L+F + D + + +DWW G + + GL P Y+
Sbjct: 3 TAQFDYTGRSERELSFKKGDSLTLYRQVSDDWWRGQLNGQDGLVPHKYITL 53
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding
protein Eve-1. Eve-1, also called SH3
domain-containing protein 19 (SH3D19) or EEN-binding
protein (EBP), exists in multiple alternatively spliced
isoforms. The longest isoform contains five SH3 domain
in the C-terminal region and seven proline-rich motifs
in the N-terminal region. It is abundantly expressed in
skeletal muscle and heart, and may be involved in
regulating the activity of ADAMs (A disintegrin and
metalloproteases). Eve-1 interacts with EEN, an
endophilin involved in endocytosis and may be the
target of the MLL-EEN fusion protein that is implicated
in leukemogenesis. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 50
Score = 40.9 bits (96), Expect = 2e-06
Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNY 59
+A Y + DL+F + + I VT+ + +W G + R G+FP +
Sbjct: 3 VALYDFTGETEEDLSFQRGDRILVTEHLDAEWSRGRLNGREGIFPRAF 50
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain
containing ring finger 2. SH3RF2 is also called POSHER
(POSH-eliminating RING protein) or HEPP1 (heart protein
phosphatase 1-binding protein). It acts as an
anti-apoptotic regulator of the JNK pathway by binding
to and promoting the degradation of SH3RF1 (or POSH), a
scaffold protein that is required for pro-apoptotic JNK
activation. It may also play a role in cardiac
functions together with protein phosphatase 1. SH3RF2
contains an N-terminal RING finger domain and three SH3
domains. This model represents the first SH3 domain,
located at the N-terminal half, of SH3RF2. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 40.7 bits (95), Expect = 2e-06
Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A Y PGDL FN+ +VI + ++ + +W+ G I +G+FP++ V
Sbjct: 5 ALCNYRGHNPGDLKFNKGDVILLRRQLDENWYLGEINGVSGIFPASSV 52
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like
Protein Tyrosine Kinases. Src subfamily members
include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, Yes,
and Brk. Src (or c-Src) proteins are cytoplasmic (or
non-receptor) PTKs which are anchored to the plasma
membrane. They contain an N-terminal SH4 domain with a
myristoylation site, followed by SH3 and SH2 domains, a
tyr kinase domain, and a regulatory C-terminal region
containing a conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). However,
Brk lacks the N-terminal myristoylation sites. Src
proteins are involved in signaling pathways that
regulate cytokine and growth factor responses,
cytoskeleton dynamics, cell proliferation, survival,
and differentiation. They were identified as the first
proto-oncogene products, and they regulate cell
adhesion, invasion, and motility in cancer cells, and
tumor vasculature, contributing to cancer progression
and metastasis. Src kinases are overexpressed in a
variety of human cancers, making them attractive
targets for therapy. They are also implicated in acute
inflammatory responses and osteoclast function. Src,
Fyn, Yes, and Yrk are widely expressed, while Blk, Lck,
Hck, Fgr, Lyn, and Brk show a limited expression
pattern. This subfamily also includes Drosophila
Src42A, Src oncogene at 42A (also known as Dsrc41)
which accumulates at sites of cell-cell or cell-matrix
adhesion, and participates in Drosphila development and
wound healing. It has been shown to promote tube
elongation in the tracheal system, is essential for
proper cell-cell matching during dorsal closure, and
regulates cell-cell contacts in developing Drosophila
eyes. The SH3 domain of Src kinases contributes to
substrate recruitment by binding adaptor
proteins/substrates, and regulation of kinase activity
through an intramolecular interaction. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 40.6 bits (96), Expect = 2e-06
Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 11/55 (20%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWW------TGTIGDRTGLFPSNY 59
Y+A Y Y++ DL+F + + + + + DWW TG + G PSNY
Sbjct: 2 YVALYDYEARTDDDLSFKKGDRLQILDDSDGDWWLARHLSTG----KEGYIPSNY 52
>gnl|CDD|212942 cd12009, SH3_Blk, Src homology 3 domain of Blk Protein Tyrosine
Kinase. Blk is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
It is expressed specifically in B-cells and is involved
in pre-BCR (B-cell receptor) signaling. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 40.6 bits (95), Expect = 2e-06
Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 2/54 (3%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGT--IGDRTGLFPSNYVVP 62
IA Y + + DL + E + V K + +WW + G PSNYV
Sbjct: 1 CVIAQYDFVPSNERDLQLKKGEKLQVLKSDGEWWLAKSLTTGKEGYIPSNYVAR 54
>gnl|CDD|212781 cd11847, SH3_Brk, Src homology 3 domain of Brk (Breast tumor
kinase) Protein Tyrosine Kinase (PTK), also called
PTK6. Brk is a cytoplasmic (or non-receptor) PTK with
limited homology to Src kinases. It has been found to
be overexpressed in a majority of breast tumors. It
plays roles in normal cell differentiation,
proliferation, survival, migration, and cell cycle
progression. Brk substrates include RNA-binding
proteins (SLM-1/2, Sam68), transcription factors
(STAT3/5), and signaling molecules (Akt, paxillin,
IRS-4). Src kinases in general contain an N-terminal
SH4 domain with a myristoylation site, followed by SH3
and SH2 domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr; they are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
However, Brk lacks the N-terminal myristoylation site.
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 40.6 bits (95), Expect = 3e-06
Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 6/55 (10%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDR------TGLFPSNYV 60
Y A + + + +L+F + + ++ DWWT DR G P+NY+
Sbjct: 2 YKALWDFKARGDEELSFQAGDQFRIAERSGDWWTALKLDRAGGVVAQGFVPNNYL 56
>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase
4. MLK4 is a Serine/Threonine Kinase (STK), catalyzing
the transfer of the gamma-phosphoryl group from ATP to
S/T residues on protein substrates. MLKs act as
mitogen-activated protein kinase kinase kinases
(MAP3Ks, MKKKs, MAPKKKs), which phosphorylate and
activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which
in turn phosphorylate and activate MAPKs during
signaling cascades that are important in mediating
cellular responses to extracellular signals. MLKs play
roles in immunity and inflammation, as well as in cell
death, proliferation, and cell cycle regulation. The
specific function of MLK4 is yet to be determined.
Mutations in the kinase domain of MLK4 have been
detected in colorectal cancers. MLK4 contains an SH3
domain, a catalytic kinase domain, a leucine zipper, a
proline-rich region, and a CRIB domain that mediates
binding to GTP-bound Cdc42 and Rac. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 58
Score = 40.3 bits (94), Expect = 4e-06
Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKE------NDWWTGTIGDRTGLFPSNYVVP 62
+ A Y Y+++ +L+ + +V+ V ++ + WW G I R G+FP+NYV
Sbjct: 2 WTALYDYEASGEDELSLRRGDVVEVLSQDAAVSGDDGWWAGKIRHRLGIFPANYVTR 58
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 2. SH3RF2 is also called POSHER
(POSH-eliminating RING protein) or HEPP1 (heart protein
phosphatase 1-binding protein). It acts as an
anti-apoptotic regulator of the JNK pathway by binding
to and promoting the degradation of SH3RF1 (or POSH), a
scaffold protein that is required for pro-apoptotic JNK
activation. It may also play a role in cardiac
functions together with protein phosphatase 1. SH3RF2
contains an N-terminal RING finger domain and three SH3
domains. This model represents the third SH3 domain,
located in the middle, of SH3RF2. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 40.1 bits (94), Expect = 4e-06
Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 11/58 (18%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW-------TGTIGDRTGLFPSNYVVP 62
+A + Y + P +L + E + V K + W TG R G+FPSNYV P
Sbjct: 2 CVALHSYSAHRPEELELQKGEGVRVLGKFQEGWLRGLSLVTG----RVGIFPSNYVSP 55
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 1 (SH3RF1), SH3RF3, and similar
domains. SH3RF1 (or POSH) and SH3RF3 (or POSH2) are
scaffold proteins that function as E3 ubiquitin-protein
ligases. They contain an N-terminal RING finger domain
and four SH3 domains. This model represents the third
SH3 domain, located in the middle of SH3RF1 and SH3RF3,
and similar domains. SH3RF1 plays a role in calcium
homeostasis through the control of the ubiquitin domain
protein Herp. It may also have a role in regulating
death receptor mediated and JNK mediated apoptosis.
SH3RF3 interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 40.1 bits (94), Expect = 4e-06
Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGT--IGDRTGLFPSNYVVP 62
Y+A YPY +P +L + E+ VT+K D W+ GT ++G+FP NYV P
Sbjct: 2 YVALYPYKPQKPDELELRKGEMYTVTEKCQDGWFKGTSLRTGQSGVFPGNYVQP 55
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage
cell-specific protein 1. HS1, also called HCLS1
(hematopoietic cell-specific Lyn substrate 1), is a
cortactin homolog expressed specifically in
hematopoietic cells. It is an actin regulatory protein
that binds the Arp2/3 complex and stabilizes branched
actin filaments. It is required for cell spreading and
signaling in lymphocytes. It regulates cytoskeletal
remodeling that controls lymphocyte trafficking, and it
also affects tissue invasion and infiltration of
leukemic B cells. Like cortactin, HS1 contains an
N-terminal acidic domain, several copies of a repeat
domain found in cortactin and HS1, a proline-rich
region, and a C-terminal SH3 domain. The N-terminal
region binds the Arp2/3 complex and F-actin, while the
C-terminal region acts as an adaptor or scaffold that
can connect varied proteins that bind the SH3 domain
within the actin network. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 40.2 bits (94), Expect = 4e-06
Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVI-YVTKKENDWWTGTIGDRTGLFPSNYV 60
+A Y Y +++F+ E I + + WW GT GLFP+NYV
Sbjct: 4 VALYDYQGEGDDEISFDPQETITDIEMVDEGWWKGTCHGHRGLFPANYV 52
>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or
SH3D) of Intersectin. Intersectins (ITSNs) are adaptor
proteins that function in exo- and endocytosis, actin
cytoskeletal reorganization, and signal transduction.
They are essential for initiating clathrin-coated pit
formation. They bind to many proteins through their
multidomain structure and facilitate the assembly of
multimeric complexes. Vertebrates contain two ITSN
proteins, ITSN1 and ITSN2, which exist in alternatively
spliced short and long isoforms. The short isoforms
contain two Eps15 homology domains (EH1 and EH2), a
coiled-coil region and five SH3 domains (SH3A-E), while
the long isoforms, in addition, contain RhoGEF (also
called Dbl-homologous or DH), Pleckstrin homology (PH)
and C2 domains. ITSN1 and ITSN2 are both widely
expressed, with variations depending on tissue type and
stage of development. The fourth SH3 domain (or SH3D)
of ITSN1 has been shown to bind SHIP2, Numb, CdGAP, and
N-WASP. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 40.0 bits (94), Expect = 4e-06
Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 6/50 (12%)
Query: 17 PYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDR-----TGLFPSNYV 60
P+ +T L+ +++ V KK + WW G + R G FP+NYV
Sbjct: 7 PFTATAENQLSLAVGQLVLVRKKSPSGWWEGELQARGKKRQIGWFPANYV 56
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein
Tyrosine Kinases. The Tec (Tyrosine kinase expressed
in hepatocellular carcinoma) subfamily is composed of
Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and
similar proteins. They are cytoplasmic (or nonreceptor)
tyr kinases containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. Most Tec subfamily members (except Rlk)
also contain an N-terminal pleckstrin homology (PH)
domain, which binds the products of PI3K and allows
membrane recruitment and activation. In addition, some
members contain the Tec homology (TH) domain, which
contains proline-rich and zinc-binding regions. Tec
kinases are expressed mainly by haematopoietic cells,
although Tec and Bmx are also found in endothelial
cells. B-cells express Btk and Tec, while T-cells
express Itk, Txk, and Tec. Collectively, Tec kinases
are expressed in a variety of myeloid cells such as
mast cells, platelets, macrophages, and dendritic
cells. Each Tec kinase shows a distinct cell-type
pattern of expression. The function of Tec kinases in
lymphoid cells have been studied extensively. They play
important roles in the development, differentiation,
maturation, regulation, survival, and function of
B-cells and T-cells. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 39.9 bits (94), Expect = 4e-06
Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 2/52 (3%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGD-RTGLFPSNYVVP 62
+A Y + EPGDL + E V WW + G PSNYV
Sbjct: 3 VALYDFQPIEPGDLPLEKGEEYVVLDDSNEHWWRARDKNGNEGYIPSNYVTE 54
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity
signaling protein Sho1p. Sho1p (or Sho1), also called
SSU81 (Suppressor of SUA8-1 mutation), is a yeast
membrane protein that regulates adaptation to high salt
conditions by activating the HOG (high-osmolarity
glycerol) pathway. High salt concentrations lead to the
localization to the membrane of the MAPKK Pbs2, which
is then activated by the MAPKK Ste11 and in turn,
activates the MAPK Hog1. Pbs2 is localized to the
membrane though the interaction of its PxxP motif with
the SH3 domain of Sho1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 39.7 bits (93), Expect = 5e-06
Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 3/50 (6%)
Query: 14 AAYPYDST--EPGDLTFNQDEVIYVTKKENDWWTGTIGD-RTGLFPSNYV 60
A YPYD++ +P +L+F + E++ V+ WW + TG+ PSNY+
Sbjct: 4 ALYPYDASPDDPNELSFEKGEILEVSDTSGKWWQARKSNGETGICPSNYL 53
>gnl|CDD|212783 cd11849, SH3_SPIN90, Src homology 3 domain of SH3 protein
interacting with Nck, 90 kDa (SPIN90). SPIN90 is also
called NCK interacting protein with SH3 domain
(NCKIPSD), Dia-interacting protein (DIP), 54 kDa
vimentin-interacting protein (VIP54), or
WASP-interacting SH3-domain protein (WISH). It is an
F-actin binding protein that regulates actin
polymerization and endocytosis. It associates with the
Arp2/3 complex near actin filaments and determines
filament localization at the leading edge of
lamellipodia. SPIN90 is expressed in the early stages
of neuronal differentiation and plays a role in
regulating growth cone dynamics and neurite outgrowth.
It also interacts with IRSp53 and regulates cell
motility by playing a role in the formation of membrane
protrusions. SPIN90 contains an N-terminal SH3 domain,
a proline-rich domain, and a C-terminal VCA
(verprolin-homology and cofilin-like acidic) domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 39.6 bits (93), Expect = 6e-06
Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGT-IGDRTGLFPSNYV 60
Y A Y + S EP L+F++ E + ++ N WW T TG P+NYV
Sbjct: 2 YRALYDFKSAEPNTLSFSEGETFLLLERSNAHWWLVTNHSGETGYVPANYV 52
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper
integration site-1 (AHI-1). AHI-1, also called
Jouberin, is expressed in high levels in the brain,
gonad tissues, and skeletal muscle. It is an adaptor
protein that interacts with the small GTPase Rab8a and
regulates it distribution and function, affecting
cilium formation and vesicle transport. Mutations in
the AHI-1 gene can cause Joubert syndrome, a disorder
characterized by brainstem malformations, cerebellar
aplasia/hypoplasia, and retinal dystrophy. AHI-1
variation is also associated with susceptibility to
schizophrenia and type 2 diabetes mellitus progression.
AHI-1 contains WD40 and SH3 domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 39.4 bits (92), Expect = 7e-06
Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGD-RTGLFPSNYV 60
+A Y Y + +LT ++ ++I V K+ND WW G++ + + G FP+NYV
Sbjct: 3 VALYDYTANRSDELTIHRGDIIRVLYKDNDNWWFGSLVNGQQGYFPANYV 52
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain
containing ring finger proteins. This model represents
the second SH3 domain of SH3RF1 (or POSH), SH3RF2 (or
POSHER), SH3RF3 (POSH2), and similar domains. Members
of this family are scaffold proteins that function as
E3 ubiquitin-protein ligases. They all contain an
N-terminal RING finger domain and multiple SH3 domains;
SH3RF1 and SH3RF3 have four SH3 domains while SH3RF2
has three. SH3RF1 plays a role in calcium homeostasis
through the control of the ubiquitin domain protein
Herp. It may also have a role in regulating death
receptor mediated and JNK mediated apoptosis. SH3RF3
interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3RF2 acts
as an anti-apoptotic regulator of the JNK pathway by
binding to and promoting the degradation of SH3RF1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 39.2 bits (92), Expect = 8e-06
Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)
Query: 13 IAAYPYDST---EPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNY 59
A Y ++ E LTF + +VI V ++ ++ W G +GD+ G+FP ++
Sbjct: 3 KALYDFEMKDEDEKDCLTFKKGDVITVIRRVDENWAEGRLGDKIGIFPISF 53
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of
Cbl-interacting protein of 85 kDa. CIN85, also called
SH3 domain-containing kinase-binding protein 1
(SH3KBP1) or CD2-binding protein 3 (CD2BP3) or Ruk, is
an adaptor protein that is involved in the
downregulation of receptor tyrosine kinases by
facilitating endocytosis through interaction with
endophilin-associated ubiquitin ligase Cbl proteins. It
is also important in many other cellular processes
including vesicle-mediated transport, cytoskeletal
remodelling, apoptosis, cell adhesion and migration,
and viral infection, among others. CIN85 exists as
multiple variants from alternative splicing; the main
variant contains three SH3 domains, a proline-rich
region, and a C-terminal coiled-coil domain. All of
these domains enable CIN85 to bind various protein
partners and assemble complexes that have been
implicated in many different functions. This alignment
model represents the first SH3 domain (SH3A) of CIN85;
SH3A binds to internal proline-rich motifs within the
proline-rich region. This intramolecular interaction
serves as a regulatory mechanism to keep CIN85 in a
closed conformation, preventing the recruitment of
other proteins. SH3A has also been shown to bind
ubiquitin and to an atypical PXXXPR motif at the
C-terminus of Cbl and the cytoplasmic end of the cell
adhesion protein CD2. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 39.5 bits (92), Expect = 8e-06
Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGDRTGLFPSNYV 60
I + Y + +LT ++I + K + WW G I R GLFP N+V
Sbjct: 3 IVEFDYKAQHEDELTITVGDIITKIKKDDGGWWEGEIKGRRGLFPDNFV 51
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating
of p53 proteins (ASPP). The ASPP family of proteins
bind to important regulators of apoptosis (p53, Bcl-2,
and RelA) and cell growth (APCL, PP1). They share
similarity at their C-termini, where they harbor a
proline-rich region, four ankyrin (ANK) repeats, and an
SH3 domain. Vertebrates contain three members of the
family: ASPP1, ASPP2, and iASPP. ASPP1 and ASPP2
activate the apoptotic function of the p53 family of
tumor suppressors (p53, p63, and p73), while iASPP is
an oncoprotein that specifically inhibits p53-induced
apoptosis. The expression of ASPP proteins is altered
in tumors; ASPP1 and ASPP2 are downregulated whereas
iASPP is upregulated is some cancer types. ASPP
proteins also bind and regulate protein phosphatase 1
(PP1), and this binding is competitive with p53
binding. The SH3 domain and the ANK repeats of ASPP
contribute to the p53 binding site; they bind to the
DNA binding domain of p53. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 39.3 bits (92), Expect = 8e-06
Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 4/50 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK----ENDWWTGTIGDRTGLFPSNY 59
A + Y++ +L+F + + + V +K E +WW + D+ G P N
Sbjct: 5 ALFDYEAENGDELSFREGDELTVLRKGDDDETEWWWARLNDKEGYVPRNL 54
>gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3
domain-containing protein 2. RUSC2, also called Iporin
or Interacting protein of Rab1, is expressed
ubiquitously with highest amounts in the brain and
testis. It interacts with the small GTPase Rab1 and the
Golgi matrix protein GM130, and may function in linking
GTPases to certain intracellular signaling pathways.
RUSC proteins are adaptor proteins consisting of RUN,
leucine zipper, and SH3 domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 52
Score = 39.1 bits (91), Expect = 9e-06
Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%)
Query: 20 STEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNYV 60
+TEPG L+FN+ +++ V ++ + DW ++G +GL P YV
Sbjct: 10 ATEPGQLSFNKGDILQVLSRADGDWLRCSLGPDSGLVPIAYV 51
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of
Cbl-interacting protein of 85 kDa. CIN85, also called
SH3 domain-containing kinase-binding protein 1
(SH3KBP1) or CD2-binding protein 3 (CD2BP3) or Ruk, is
an adaptor protein that is involved in the
downregulation of receptor tyrosine kinases by
facilitating endocytosis through interaction with
endophilin-associated ubiquitin ligase Cbl proteins. It
is also important in many other cellular processes
including vesicle-mediated transport, cytoskeletal
remodelling, apoptosis, cell adhesion and migration,
and viral infection, among others. CIN85 exists as
multiple variants from alternative splicing; the main
variant contains three SH3 domains, a proline-rich
region, and a C-terminal coiled-coil domain. All of
these domains enable CIN85 to bind various protein
partners and assemble complexes that have been
implicated in many different functions. This alignment
model represents the third SH3 domain (SH3C) of CIN85.
SH3C has been shown to bind ubiquitin. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 39.1 bits (91), Expect = 1e-05
Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 3/48 (6%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKKE---NDWWTGTIGDRTGLFPSNYV 60
+PY++ +LT + +++ + K+ WW G + R G+FP N+V
Sbjct: 6 FPYEAQNEDELTIKEGDIVTLISKDCIDAGWWEGELNGRRGVFPDNFV 53
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of
CD2-associated protein. CD2AP, also called CMS (Cas
ligand with Multiple SH3 domains) or METS1
(Mesenchyme-to-Epithelium Transition protein with SH3
domains), is a cytosolic adaptor protein that plays a
role in regulating the cytoskeleton. It is critical in
cell-to-cell union necessary for kidney function. It
also stabilizes the contact between a T cell and
antigen-presenting cells. It is primarily expressed in
podocytes at the cytoplasmic face of the slit diaphragm
and serves as a linker anchoring podocin and nephrin to
the actin cytoskeleton. CD2AP contains three SH3
domains, a proline-rich region, and a C-terminal
coiled-coil domain. All of these domains enable CD2AP
to bind various protein partners and assemble complexes
that have been implicated in many different functions.
This alignment model represents the second SH3 domain
(SH3B) of CD2AP. SH3B binds to c-Cbl in a site
(TPSSRPLR is the core binding motif) distinct from the
c-Cbl/SH3A binding site. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 39.2 bits (91), Expect = 1e-05
Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
+ Y +L ++I + ++ E WW+GT+ ++GLFPSN+V
Sbjct: 7 FEYVPQNEDELELKVGDIIDINEEVEEGWWSGTLNGKSGLFPSNFV 52
>gnl|CDD|212766 cd11832, SH3_Shank, Src homology 3 domain of SH3 and multiple
ankyrin repeat domains (Shank) proteins. Shank
proteins carry scaffolding functions through multiple
sites of protein-protein interaction in its domain
architecture, including ankyrin (ANK) repeats, a long
proline rich region, as well as SH3, PDZ, and SAM
domains. They bind a variety of membrane and cytosolic
proteins, and exist in alternatively spliced isoforms.
They are highly enriched in postsynaptic density (PSD)
where they interact with the cytoskeleton and with
postsynaptic membrane receptors including NMDA and
glutamate receptors. They are crucial in the
construction and organization of the PSD and dendritic
spines of excitatory synapses. There are three members
of this family (Shank1, Shank2, Shank3) which show
distinct and cell-type specific patterns of expression.
Shank1 is brain-specific; Shank2 is found in neurons,
glia, endocrine cells, liver, and kidney; Shank3 is
widely expressed. The SH3 domain of Shank binds GRIP, a
scaffold protein that binds AMPA receptors and Eph
receptors/ligands. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 50
Score = 38.6 bits (90), Expect = 1e-05
Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTK-KENDWWTGTIGDRTGLFPS 57
Y+IA Y E G+++ ++ + + V E +W G++ RTG FPS
Sbjct: 1 YFIAVKSYSPQEEGEISLHKGDRVKVLSIGEGGFWEGSVRGRTGWFPS 48
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and
SH3 domain containing (Sorbs) proteins and similar
domains. This family, also called the vinexin family,
is composed predominantly of adaptor proteins
containing one sorbin homology (SoHo) and three SH3
domains. Members include the first SH3 domains of
Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or
Sorbs3), and similar domains. They are involved in the
regulation of cytoskeletal organization, cell adhesion,
and growth factor signaling. Members of this family
bind multiple partners including signaling molecules
like c-Abl, c-Arg, Sos, and c-Cbl, as well as
cytoskeletal molecules such as vinculin and afadin.
They may have overlapping functions. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 38.5 bits (90), Expect = 2e-05
Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A YP+ + +L+ + ++IY+ ++ + +W+ G R G+FP++YV
Sbjct: 3 RALYPFKAQSAKELSLKKGDIIYIRRQIDKNWYEGEHNGRVGIFPASYV 51
>gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10
Regulator of Kinase adaptor proteins. CRK adaptor
proteins consists of SH2 and SH3 domains, which bind
tyrosine-phosphorylated peptides and proline-rich
motifs, respectively. They function downstream of
protein tyrosine kinases in many signaling pathways
started by various extracellular signals, including
growth and differentiation factors. Cellular CRK
(c-CRK) contains a single SH2 domain, followed by
N-terminal and C-terminal SH3 domains. It is involved
in the regulation of many cellular processes including
cell growth, motility, adhesion, and apoptosis. CRK has
been implicated in the malignancy of various human
cancers. The N-terminal SH3 domain of CRK binds a
number of target proteins including DOCK180, C3G, SOS,
and cABL. The CRK family includes two alternatively
spliced protein forms, CRKI and CRKII, that are
expressed by the CRK gene, and the CRK-like (CRKL)
protein, which is expressed by a distinct gene (CRKL).
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 38.5 bits (90), Expect = 2e-05
Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGD-RTGLFPSNYV 60
EY A + + + DL F + E++ V +K + WW + +TG+ P YV
Sbjct: 1 EYVRALFDFPGNDDEDLPFKKGEILTVIRKPEEQWWNARNSEGKTGMIPVPYV 53
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain
of VAV1 protein. VAV1 is expressed predominantly in
the hematopoietic system and it plays an important role
in the development and activation of B and T cells. It
is activated by tyrosine phosphorylation to function as
a guanine nucleotide exchange factor (GEF) for Rho
GTPases following cell surface receptor activation,
triggering various effects such as cytoskeletal
reorganization, transcription regulation, cell cycle
progression, and calcium mobilization. It also serves
as a scaffold protein and has been shown to interact
with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
gene, ZAP-70, SLP76, and Syk, among others. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The C-terminal SH3 domain of Vav1 interacts
with a wide variety of proteins including cytoskeletal
regulators (zyxin), RNA-binding proteins (Sam68),
transcriptional regulators, viral proteins, and dynamin
2. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 38.8 bits (90), Expect = 2e-05
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK--ENDWWTGTIGDRTGLFPSNYV 60
A Y + + + +L+ + ++I + K + WW G I R G FP+NYV
Sbjct: 4 ARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYV 52
>gnl|CDD|212917 cd11984, SH3_Shank3, Src homology 3 domain of SH3 and multiple
ankyrin repeat domains protein 3. Shank3, also called
ProSAP2 (Proline-rich synapse-associated protein 2), is
widely expressed. It plays a role in the formation of
dendritic spines and synapses. Haploinsufficiency of
the Shank3 gene causes the 22q13
deletion/Phelan-McDermid syndrome, and variants of
Shank3 have been implicated in autism spectrum
disorder, schizophrenia, and intellectual disability.
Shank proteins carry scaffolding functions through
multiple sites of protein-protein interaction in its
domain architecture, including ankyrin (ANK) repeats, a
long proline rich region, as well as SH3, PDZ, and SAM
domains. The SH3 domain of Shank binds GRIP, a scaffold
protein that binds AMPA receptors and Eph
receptors/ligands. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 52
Score = 38.4 bits (89), Expect = 2e-05
Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNYV 60
+IA Y G++ N+ E + V + E +W GT+ RTG FP++ V
Sbjct: 3 FIAVKAYSPQGEGEIQLNRGERVKVLSIGEGGFWEGTVKGRTGWFPADCV 52
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan
Actin-binding protein 1. Abp1, also called
drebrin-like protein, is an adaptor protein that
functions in receptor-mediated endocytosis and vesicle
trafficking. It contains an N-terminal actin-binding
module, the actin-depolymerizing factor (ADF) homology
domain, a helical domain, and a C-terminal SH3 domain.
Mammalian Abp1, unlike yeast Abp1, does not contain an
acidic domain that interacts with the Arp2/3 complex.
It regulates actin dynamics indirectly by interacting
with dynamin and WASP family proteins. Abp1 deficiency
causes abnormal organ structure and function of the
spleen, heart, and lung of mice. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 54
Score = 38.5 bits (90), Expect = 2e-05
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVI-YVTKKENDWWTGTIGD-RTGLFPSNYV 60
A Y Y + + +++F+ ++I + + + WW GT D GLFP+NYV
Sbjct: 4 ALYDYQAADDTEISFDPGDIITDIEQIDEGWWRGTGPDGTYGLFPANYV 52
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9
and similar proteins. Sorting nexins (SNXs) are Phox
homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNXs differ from each
other in their lipid-binding specificity, subcellular
localization and specific function in the endocytic
pathway. This subfamily consists of SH3 domain
containing SNXs including SNX9, SNX18, SNX33, and
similar proteins. SNX9 is localized to plasma membrane
endocytic sites and acts primarily in clathrin-mediated
endocytosis, while SNX18 is localized to peripheral
endosomal structures, and acts in a trafficking pathway
that is clathrin-independent but relies on AP-1 and
PACS1. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 38.1 bits (89), Expect = 2e-05
Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 5/54 (9%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTG--TIGDRTGLFPSNYV 60
A Y +DS G+L+ EV+ +T+++ W G + G+ GLFPS+YV
Sbjct: 1 KVRALYDFDSQPSGELSLRAGEVLTITRQDVGDGWLEGRNSRGEV-GLFPSSYV 53
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor
proteins. This group contains the third SH3 domain of
Nck, the first SH3 domain of Caenorhabditis elegans
Ced-2 (Cell death abnormality protein 2), and similar
domains. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2 (also called Nckbeta or
Growth factor receptor-bound protein 4, Grb4), which
show partly overlapping functions but also bind
distinct targets. Their SH3 domains are involved in
recruiting downstream effector molecules, such as the
N-WASP/Arp2/3 complex, which when activated induces
actin polymerization that results in the production of
pedestals, or protrusions of the plasma membrane. The
third SH3 domain of Nck appears to prefer ligands with
a PxAPxR motif. SH3 domains are protein interaction
domains that usually bind to proline-rich ligands with
moderate affinity and selectivity, preferentially a
PxxP motif. Ced-2 is a cell corpse engulfment protein
that interacts with Ced-5 in a pathway that regulates
the activation of Ced-10, a Rac small GTPase.
Length = 56
Score = 38.1 bits (89), Expect = 3e-05
Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 12/56 (21%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWW-----TGTIGDRTGLFPSNYV 60
+A YP+ +L+F + E + + +K + DWW GT TGL P NYV
Sbjct: 3 VALYPFTGENDEELSFEKGERLEIIEKPEDDPDWWKARNALGT----TGLVPRNYV 54
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine
Kinase. Src (or c-Src) is a cytoplasmic (or
non-receptor) PTK and is the vertebrate homolog of the
oncogenic protein (v-Src) from Rous sarcoma virus.
Together with other Src subfamily proteins, it is
involved in signaling pathways that regulate cytokine
and growth factor responses, cytoskeleton dynamics,
cell proliferation, survival, and differentiation. Src
also play a role in regulating cell adhesion, invasion,
and motility in cancer cells, and tumor vasculature,
contributing to cancer progression and metastasis.
Elevated levels of Src kinase activity have been
reported in a variety of human cancers. Several
inhibitors of Src have been developed as anti-cancer
drugs. Src is also implicated in acute inflammatory
responses and osteoclast function. Src kinases contain
an N-terminal SH4 domain with a myristoylation site,
followed by SH3 and SH2 domains, a tyr kinase domain,
and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 38.2 bits (88), Expect = 3e-05
Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 5/55 (9%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVI-YVTKKENDWWTG---TIGDRTGLFPSNYVVP 62
++A Y Y+S DL+F + E + V E DWW T G +TG PSNYV P
Sbjct: 2 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTG-QTGYIPSNYVAP 55
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain
of VAV proteins. VAV proteins function both as
cytoplasmic guanine nucleotide exchange factors (GEFs)
for Rho GTPases and scaffold proteins and they play
important roles in cell signaling by coupling cell
surface receptors to various effector functions. They
play key roles in processes that require cytoskeletal
reorganization including immune synapse formation,
phagocytosis, cell spreading, and platelet aggregation,
among others. Vertebrates have three VAV proteins
(VAV1, VAV2, and VAV3). VAV proteins contain several
domains that enable their function: N-terminal calponin
homology (CH), acidic, RhoGEF (also called
Dbl-homologous or DH), Pleckstrin Homology (PH), C1
(zinc finger), SH2, and two SH3 domains. The SH3 domain
of VAV is involved in the localization of proteins to
specific sites within the cell, by interacting with
proline-rich sequences within target proteins. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 38.0 bits (88), Expect = 3e-05
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEV--IYVTKKENDWWTGTIGDRTGLFPSNYV 60
A Y + + + +L+ + +V IY K + WW G I R G FPS YV
Sbjct: 3 KARYDFCARDMRELSLKEGDVVKIYNKKGQQGWWRGEINGRIGWFPSTYV 52
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding
protein Eve-1. Eve-1, also called SH3
domain-containing protein 19 (SH3D19) or EEN-binding
protein (EBP), exists in multiple alternatively spliced
isoforms. The longest isoform contains five SH3 domain
in the C-terminal region and seven proline-rich motifs
in the N-terminal region. It is abundantly expressed in
skeletal muscle and heart, and may be involved in
regulating the activity of ADAMs (A disintegrin and
metalloproteases). Eve-1 interacts with EEN, an
endophilin involved in endocytosis and may be the
target of the MLL-EEN fusion protein that is implicated
in leukemogenesis. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 51
Score = 37.8 bits (88), Expect = 3e-05
Identities = 12/49 (24%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
+A + ++ + +L+F++ +VI + + + W G + + G+FP N+V
Sbjct: 3 VARFDFEGEQEDELSFSEGDVITLKEYVGEEWAKGELNGKIGIFPLNFV 51
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or
SH3A) of Intersectin-2. Intersectin-2 (ITSN2) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN2 also functions as a
specific GEF for Cdc42 activation in epithelial
morphogenesis, and is required in mitotic spindle
orientation. It exists in alternatively spliced short
and long isoforms. The short isoform contains two Eps15
homology domains (EH1 and EH2), a coiled-coil region
and five SH3 domains (SH3A-E), while the long isoform,
in addition, contains RhoGEF (also called
Dbl-homologous or DH), Pleckstrin homology (PH) and C2
domains. The first SH3 domain (or SH3A) of ITSN2 is
expected to bind many protein partners, similar to
ITSN1 which has been shown to bind Sos1, dynamin1/2,
CIN85, c-Cbl, PI3K-C2, SHIP2, N-WASP, and CdGAP, among
others. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 37.9 bits (88), Expect = 3e-05
Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNYV 60
Y A YP+++ +++FN ++I V +K E W G+ G FP NYV
Sbjct: 4 YRALYPFEARNHDEMSFNAGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYV 55
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or
SH3B) of Intersectin-2. Intersectin-2 (ITSN2) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN2 also functions as a
specific GEF for Cdc42 activation in epithelial
morphogenesis, and is required in mitotic spindle
orientation. It exists in alternatively spliced short
and long isoforms. The short isoform contains two Eps15
homology domains (EH1 and EH2), a coiled-coil region
and five SH3 domains (SH3A-E), while the long isoform,
in addition, contains RhoGEF (also called
Dbl-homologous or DH), Pleckstrin homology (PH) and C2
domains. The second SH3 domain (or SH3B) of ITSN2 is
expected to bind protein partners, similar to ITSN1
which has been shown to bind WNK and CdGAP. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 37.7 bits (87), Expect = 4e-05
Identities = 12/35 (34%), Positives = 23/35 (65%)
Query: 26 LTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
L F+++++I V +++ +WW G + G FP +YV
Sbjct: 16 LNFSKNDIITVLEQQENWWFGEVHGGRGWFPKSYV 50
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of
GRB2-related adaptor protein. GRAP is a GRB-2 like
adaptor protein that is highly expressed in lymphoid
tissues. It acts as a negative regulator of T cell
receptor (TCR)-induced lymphocyte proliferation by
downregulating the signaling to the Ras/ERK pathway. It
has been identified as a regulator of TGFbeta signaling
in diabetic kidney tubules and may have a role in the
pathogenesis of the disease. GRAP contains an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. The N-terminal SH3 domain of the
related protein GRB2 binds to Sos and Sos-derived
proline-rich peptides. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 37.5 bits (87), Expect = 4e-05
Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTIGDRTGLFPSNYV 60
+A Y + +TE +L F + +++ + E+D W+ + R G P NY+
Sbjct: 3 VALYSFQATESDELPFQKGDILKILNMEDDQNWYKAELQGREGYIPKNYI 52
>gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of
CD2-associated protein. CD2AP, also called CMS (Cas
ligand with Multiple SH3 domains) or METS1
(Mesenchyme-to-Epithelium Transition protein with SH3
domains), is a cytosolic adaptor protein that plays a
role in regulating the cytoskeleton. It is critical in
cell-to-cell union necessary for kidney function. It
also stabilizes the contact between a T cell and
antigen-presenting cells. It is primarily expressed in
podocytes at the cytoplasmic face of the slit diaphragm
and serves as a linker anchoring podocin and nephrin to
the actin cytoskeleton. CD2AP contains three SH3
domains, a proline-rich region, and a C-terminal
coiled-coil domain. All of these domains enable CD2AP
to bind various protein partners and assemble complexes
that have been implicated in many different functions.
This alignment model represents the first SH3 domain
(SH3A) of CD2AP. SH3A binds to the PXXXPR motif present
in c-Cbl and the cytoplasmic domain of cell adhesion
protein CD2. Its interaction with CD2 anchors CD2 at
sites of cell contact. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 56
Score = 37.5 bits (87), Expect = 4e-05
Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK--ENDWWTGTIGDRTGLFPSNYV 60
YI Y YD+ +LT E+I KK E W G + R G+FP N+V
Sbjct: 2 YIVEYDYDAVHEDELTIRVGEIIRNVKKLEEEGWLEGELNGRRGMFPDNFV 52
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and
SH3 domain containing 2 (Sorbs2), also called
Arg-binding protein 2 (ArgBP2). Sorbs2 or ArgBP2 is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. It regulates actin-dependent
processes including cell adhesion, morphology, and
migration. It is expressed in many tissues and is
abundant in the heart. Like vinexin, it is found in
focal adhesion where it interacts with vinculin and
afadin. It also localizes in epithelial cell stress
fibers and in cardiac muscle cell Z-discs. Sorbs2 has
been implicated to play roles in the signaling of
c-Arg, Akt, and Pyk2. Other interaction partners of
Sorbs2 include c-Abl, flotillin, spectrin, dynamin 1/2,
synaptojanin, PTP-PEST, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 37.7 bits (87), Expect = 4e-05
Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A Y + + +L+F + + +Y+ +K + +W+ G R G+FP +YV
Sbjct: 5 AVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYV 52
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of
Growth factor receptor-bound protein 2 (GRB2) and
related proteins. This family includes the adaptor
protein GRB2 and related proteins including Drosophila
melanogaster Downstream of receptor kinase (DRK),
Caenorhabditis elegans Sex muscle abnormal protein 5
(Sem-5), GRB2-related adaptor protein (GRAP), GRAP2,
and similar proteins. Family members contain an
N-terminal SH3 domain, a central SH2 domain, and a
C-terminal SH3 domain. GRB2/Sem-5/DRK is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. GRAP2 plays
an important role in T cell receptor (TCR) signaling by
promoting the formation of the SLP-76:LAT complex,
which couples the TCR to the Ras pathway. GRAP acts as
a negative regulator of T cell receptor (TCR)-induced
lymphocyte proliferation by downregulating the
signaling to the Ras/ERK pathway. The N-terminal SH3
domain of GRB2 binds to Sos and Sos-derived
proline-rich peptides. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 37.3 bits (87), Expect = 5e-05
Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTIGDRTGLFPSNYV 60
+A + + +T +L+F + ++ V E+D W+ + + GL P NY+
Sbjct: 3 VAKHDFKATAEDELSFKKGSILKVLNMEDDPNWYKAELDGKEGLIPKNYI 52
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain
of VAV3 protein. VAV3 is ubiquitously expressed and
functions as a phosphorylation-dependent guanine
nucleotide exchange factor (GEF) for RhoA, RhoG, and
Rac1. It has been implicated to function in the
hematopoietic, bone, cerebellar, and cardiovascular
systems. VAV3 is essential in axon guidance in neurons
that control blood pressure and respiration. It is
overexpressed in prostate cancer cells and it plays a
role in regulating androgen receptor transcriptional
activity. VAV proteins contain several domains that
enable their function: N-terminal calponin homology
(CH), acidic, RhoGEF (also called Dbl-homologous or
DH), Pleckstrin Homology (PH), C1 (zinc finger), SH2,
and two SH3 domains. The SH3 domain of VAV is involved
in the localization of proteins to specific sites
within the cell, by interacting with proline-rich
sequences within target proteins. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 37.3 bits (86), Expect = 5e-05
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEV--IYVTKKENDWWTGTIGDRTGLFPSNYV 60
IA Y + + + +L+ + +V IY N WW G + R G FPS YV
Sbjct: 4 IARYDFCARDMRELSLLKGDVVKIYTKMSTNGWWRGEVNGRVGWFPSTYV 53
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba. DNMBP or
Tuba is a cdc42-specific guanine nucleotide exchange
factor (GEF) that contains four N-terminal SH3 domains,
a central RhoGEF [or Dbl homology (DH)] domain followed
by a Bin/Amphiphysin/Rvs (BAR) domain, and two
C-terminal SH3 domains. It provides a functional link
between dynamin and key regulatory proteins of the
actin cytoskeleton. It plays an important role in
regulating cell junction configuration. The four
N-terminal SH3 domains of DNMBP binds the GTPase
dynamin, which plays an important role in the fission
of endocytic vesicles. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 51
Score = 37.3 bits (87), Expect = 5e-05
Identities = 10/39 (25%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
Query: 23 PGDLTFNQDEVIYVTK-KENDWWTGTIGDRTGLFPSNYV 60
+L + +V+ +T + W+ G + R G+FP +V
Sbjct: 13 DEELDLREGDVVTITGILDKGWFRGELNGRRGIFPEGFV 51
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3
domain of Fungal Actin-binding protein 1. Abp1 is an
adaptor protein that functions in receptor-mediated
endocytosis and vesicle trafficking. It contains an
N-terminal actin-binding module, the
actin-depolymerizing factor (ADF) homology domain, a
central proline-rich region, and a C-terminal SH3
domain (many yeast Abp1 proteins contain two C-terminal
SH3 domains). Yeast Abp1 also contains two acidic
domains that bind directly to the Arp2/3 complex, which
is required to initiate actin polymerization. The SH3
domain of yeast Abp1 binds and localizes the kinases,
Ark1p and Prk1p, which facilitate actin patch
disassembly following vesicle internalization. It also
mediates the localization to the actin patch of the
synaptojanin-like protein, Sjl2p, which plays a key
role in endocytosis. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 37.1 bits (86), Expect = 5e-05
Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 2/47 (4%)
Query: 16 YPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGD-RTGLFPSNYV 60
Y Y+ E ++ + E++ + + DWW GT +GLFPSNYV
Sbjct: 6 YDYEKDEDNEIELVEGEIVTNIEMVDEDWWMGTNSKGESGLFPSNYV 52
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis
protein 3 and similar proteins. Cytokinesis protein 3
(Cyk3 or Cyk3p) is a component of the actomyosin ring
independent cytokinesis pathway in yeast. It interacts
with Inn1 and facilitates its recruitment to the bud
neck, thereby promoting cytokinesis. Cyk3p contains an
N-terminal SH3 domain and a C-terminal
transglutaminase-like domain. The Cyk3p SH3 domain
binds to the C-terminal proline-rich region of Inn1.
SH3 domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 53
Score = 37.1 bits (86), Expect = 5e-05
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGT-IGDRT-GLFPSNYV 60
A Y + GDL F + ++I V + WW+G + G+FPSN+V
Sbjct: 4 AVYSWAGETEGDLGFLEGDLIEVLSIGDGSWWSGKLRRNGAEGIFPSNFV 53
>gnl|CDD|212920 cd11987, SH3_Intersectin1_1, First Src homology 3 domain (or
SH3A) of Intersectin-1. Intersectin-1 (ITSN1) is an
adaptor protein that functions in exo- and endocytosis,
actin cytoskeletal reorganization, and signal
transduction. It plays a role in clathrin-coated pit
(CCP) formation. It binds to many proteins through its
multidomain structure and facilitate the assembly of
multimeric complexes. ITSN1 localizes in membranous
organelles, CCPs, the Golgi complex, and may be
involved in the cell membrane trafficking system. It
exists in alternatively spliced short and long
isoforms. The short isoform contains two Eps15 homology
domains (EH1 and EH2), a coiled-coil region and five
SH3 domains (SH3A-E), while the long isoform, in
addition, contains RhoGEF (also called Dbl-homologous
or DH), Pleckstrin homology (PH) and C2 domains. The
first SH3 domain (or SH3A) of ITSN1 has been shown to
bind many proteins including Sos1, dynamin1/2, CIN85,
c-Cbl, PI3K-C2, SHIP2, N-WASP, and CdGAP, among others.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 37.3 bits (86), Expect = 5e-05
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNY 59
YY A YP+++ ++T +++ V + E W G + +TG FP+NY
Sbjct: 1 YYRALYPFEARSHDEITIQPGDIVMVDESQTGEPGWLGGELKGKTGWFPANY 52
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain
of SH3 domain containing ring finger 1 (SH3RF1),
SH3RF3, and similar domains. SH3RF1 (or POSH) and
SH3RF3 (or POSH2) are scaffold proteins that function
as E3 ubiquitin-protein ligases. They contain an
N-terminal RING finger domain and four SH3 domains.
This model represents the fourth SH3 domain, located at
the C-terminus of SH3RF1 and SH3RF3, and similar
domains. SH3RF1 plays a role in calcium homeostasis
through the control of the ubiquitin domain protein
Herp. It may also have a role in regulating death
receptor mediated and JNK mediated apoptosis. SH3RF3
interacts with p21-activated kinase 2 (PAK2) and
GTP-loaded Rac1. It may play a role in regulating JNK
mediated apoptosis in certain conditions. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 37.1 bits (86), Expect = 6e-05
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
Query: 17 PYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTI--GDRTGLFPSNYVVP 62
PY +L + ++++V KK D W+ GT+ +TGLFP ++V
Sbjct: 7 PYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRTGKTGLFPGSFVES 55
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C
and Casein kinase Substrate in Neurons (PACSIN)
proteins. PACSINs, also called Synaptic
dynamin-associated proteins (Syndapins), act as
regulators of cytoskeletal and membrane dynamics. They
bind both dynamin and Wiskott-Aldrich syndrome protein
(WASP), and may provide direct links between the actin
cytoskeletal machinery through WASP and
dynamin-dependent endocytosis. Vetebrates harbor three
isoforms with distinct expression patterns and specific
functions. PACSINs contain an N-terminal F-BAR domain
and a C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 37.0 bits (86), Expect = 6e-05
Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTIGDRTGLFPSNYV 60
A Y Y+ E +L+F +++ ++E++ W G + R GL+P+NYV
Sbjct: 4 ALYDYEGQESDELSFKAGDILTKLEEEDEQGWCKGRLDGRVGLYPANYV 52
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase
Activating Protein 4. srGAP4, also called ARHGAP4, is
highly expressed in hematopoietic cells and may play a
role in lymphocyte differentiation. It is able to
stimulate the GTPase activity of Rac1, Cdc42, and RhoA.
In the nervous system, srGAP4 has been detected in
differentiating neurites and may be involved in axon
and dendritic growth. srGAPs are Rho GAPs that interact
with Robo1, the transmembrane receptor of Slit
proteins. Slit proteins are secreted proteins that
control axon guidance and the migration of neurons and
leukocytes. srGAPs contain an N-terminal F-BAR domain,
a Rho GAP domain, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 37.1 bits (86), Expect = 7e-05
Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNYV 60
+A + Y +L+F + +V+ + +K +DWW G GL P Y+
Sbjct: 5 VACFDYTGRTAQELSFKRGDVLLLHSKASSDWWRGEHNGMRGLIPHKYI 53
>gnl|CDD|212912 cd11979, SH3_VAV1_1, First Src homology 3 domain of VAV1 protein.
VAV1 is expressed predominantly in the hematopoietic
system and it plays an important role in the
development and activation of B and T cells. It is
activated by tyrosine phosphorylation to function as a
guanine nucleotide exchange factor (GEF) for Rho
GTPases following cell surface receptor activation,
triggering various effects such as cytoskeletal
reorganization, transcription regulation, cell cycle
progression, and calcium mobilization. It also serves
as a scaffold protein and has been shown to interact
with Ku70, Socs1, Janus kinase 2, SIAH2, S100B, Abl
gene, ZAP-70, SLP76, and Syk, among others. VAV
proteins contain several domains that enable their
function: N-terminal calponin homology (CH), acidic,
RhoGEF (also called Dbl-homologous or DH), Pleckstrin
Homology (PH), C1 (zinc finger), SH2, and two SH3
domains. The first SH3 domain of Vav1 has been shown to
bind the adaptor protein Grb2. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 63
Score = 37.3 bits (86), Expect = 7e-05
Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 17/68 (25%)
Query: 6 ELSQEYY------IAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTG--TIGDRTGLF 55
E+ QEYY A P+ PGD ++ +TK E + WW G T + G F
Sbjct: 3 EVFQEYYGIPPPPGAFGPFLRLNPGD-------IVELTKAEAEQNWWEGRNTSTNEIGWF 55
Query: 56 PSNYVVPY 63
P N V PY
Sbjct: 56 PCNRVKPY 63
>gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain
containing ring finger 2. SH3RF2 is also called POSHER
(POSH-eliminating RING protein) or HEPP1 (heart protein
phosphatase 1-binding protein). It acts as an
anti-apoptotic regulator of the JNK pathway by binding
to and promoting the degradation of SH3RF1 (or POSH), a
scaffold protein that is required for pro-apoptotic JNK
activation. It may also play a role in cardiac
functions together with protein phosphatase 1. SH3RF2
contains an N-terminal RING finger domain and three SH3
domains. This model represents the second SH3 domain,
located C-terminal of the first SH3 domain at the
N-terminal half, of SH3RF2. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 36.7 bits (85), Expect = 9e-05
Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
Query: 26 LTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
L F +D++I V + + +W G +GD+ G+FP +V
Sbjct: 22 LKFQKDDIITVISRVDENWAEGKLGDQVGIFPILFV 57
>gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C
(PLC) gamma 1. PLCgamma1 is widely expressed and is
essential in growth and development. It is activated by
the TrkA receptor tyrosine kinase and functions as a
key regulator of cell differentiation. It is also the
predominant PLCgamma in T cells and is required for T
cell and NK cell function. PLCs catalyze the hydrolysis
of phosphatidylinositol (4,5)-bisphosphate
[PtdIns(4,5)P2] to produce Ins(1,4,5)P3 and
diacylglycerol (DAG). Ins(1,4,5)P3 initiates the
calcium signaling cascade while DAG functions as an
activator of PKC. PLCgamma contains a Pleckstrin
homology (PH) domain followed by an elongation factor
(EF) domain, two catalytic regions of PLC domains that
flank two tandem SH2 domains, followed by a SH3 domain
and C2 domain. The SH3 domain of PLCgamma1 directly
interacts with dynamin-1 and can serve as a guanine
nucleotide exchange factor (GEF). It also interacts
with Cbl, inhibiting its phosphorylation and activity.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 60
Score = 36.5 bits (84), Expect = 1e-04
Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIY-VTKKENDWWTGTIGDRTGL-FPSNYV 60
A + Y + +LTF ++ +I V K+E WW G G + L FPSNYV
Sbjct: 8 ALFDYKAQREDELTFTKNAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYV 56
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3
domain, ankyrin repeat and PH domain containing protein
2. ASAP2 is also called DDEF2 (Development and
Differentiation Enhancing Factor 2), AMAP2, centaurin
beta-3, or PAG3. It mediates the functions of Arf
GTPases vial dual mechanisms: it exhibits GTPase
activating protein (GAP) activity towards class I
(Arf1) and II (Arf5) Arfs; and it binds class III Arfs
(GTP-Arf6) stably without GAP activity. It binds
paxillin and is implicated in Fcgamma receptor-mediated
phagocytosis in macrophages and in cell migration.
ASAP2 contains an N-terminal BAR domain, followed by a
Pleckstrin homology (PH) domain, an Arf GAP domain,
ankyrin (ANK) repeats, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 36.5 bits (84), Expect = 1e-04
Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 4/51 (7%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTI-GD--RTGLFPSNYV 60
A Y + P +LTF++ E+I V +E+ +WW G I G+ R G FP ++V
Sbjct: 4 ALYNCVADNPDELTFSEGEIIIVDGEEDKEWWIGHIDGEPTRRGAFPVSFV 54
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine
Kinase. Yes (or c-Yes) is a member of the Src
subfamily of proteins, which are cytoplasmic (or
non-receptor) PTKs. c-Yes kinase is the cellular
homolog of the oncogenic protein (v-Yes) encoded by the
Yamaguchi 73 and Esh sarcoma viruses. It displays
functional overlap with other Src subfamily members,
particularly Src. It also shows some unique functions
such as binding to occludins, transmembrane proteins
that regulate extracellular interactions in tight
junctions. Yes also associates with a number of
proteins in different cell types that Src does not
interact with, like JAK2 and gp130 in pre-adipocytes,
and Pyk2 in treated pulmonary vein endothelial cells.
Although the biological function of Yes remains
unclear, it appears to have a role in regulating
cell-cell interactions and vesicle trafficking in
polarized cells. Src kinases contain an N-terminal SH4
domain with a myristoylation site, followed by SH3 and
SH2 domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 36.2 bits (83), Expect = 2e-04
Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 3/55 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVI-YVTKKENDWWTG--TIGDRTGLFPSNYVVP 62
++A Y Y++ DL+F + E + E DWW + G PSNYV P
Sbjct: 2 IFVALYDYEARTTEDLSFKKGERFQIINNTEGDWWEARSIATGKNGYIPSNYVAP 56
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin
(or Nephrocystin-1). Nephrocystin contains an SH3
domain involved in signaling pathways that regulate
cell adhesion and cytoskeletal organization. It is a
protein that in humans is associated with juvenile
nephronophthisis, an inherited kidney disease
characterized by renal fibrosis that lead to chronic
renal failure in children. It is localized in cell-cell
junctions in renal duct cells, and is known to interact
with Ack1, an activated Cdc42-associated kinase. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 35.8 bits (83), Expect = 2e-04
Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 4/53 (7%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTG--TIGDRTGLFPSNYV 60
Y A + + + GDL+F + EV+ + K D WW + G+R GL P Y+
Sbjct: 1 LYEALSDFQAEQEGDLSFKKGEVLRIISKRADGWWLAENSKGNR-GLVPKTYL 52
>gnl|CDD|212938 cd12005, SH3_Lck, Src homology 3 domain of Lck Protein Tyrosine
Kinase. Lck is a member of the Src subfamily of
proteins, which are cytoplasmic (or non-receptor) PTKs.
Lck is expressed in T-cells and natural killer cells.
It plays a critical role in T-cell maturation,
activation, and T-cell receptor (TCR) signaling. Lck
phosphorylates ITAM (immunoreceptor tyr activation
motif) sequences on several subunits of TCRs, leading
to the activation of different second messenger
cascades. Phosphorylated ITAMs serve as binding sites
for other signaling factor such as Syk and ZAP-70,
leading to their activation and propagation of
downstream events. In addition, Lck regulates
drug-induced apoptosis by interfering with the
mitochondrial death pathway. The apototic role of Lck
is independent of its primary function in T-cell
signaling. Src kinases contain an N-terminal SH4 domain
with a myristoylation site, followed by SH3 and SH2
domains, a tyr kinase domain, and a regulatory
C-terminal region containing a conserved tyr. They are
activated by autophosphorylation at the tyr kinase
domain, but are negatively regulated by phosphorylation
at the C-terminal tyr by Csk (C-terminal Src Kinase).
The SH3 domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 36.0 bits (83), Expect = 2e-04
Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 4/51 (7%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTG---TIGDRTGLFPSNYV 60
+A Y Y+ + GDL F + E + + ++ +WW T G G P N+V
Sbjct: 3 VALYSYEPSHDGDLGFEKGEKLRILEQSGEWWKAQSLTTGQE-GFIPFNFV 52
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of
Cbl-interacting protein of 85 kDa. CIN85, also called
SH3 domain-containing kinase-binding protein 1
(SH3KBP1) or CD2-binding protein 3 (CD2BP3) or Ruk, is
an adaptor protein that is involved in the
downregulation of receptor tyrosine kinases by
facilitating endocytosis through interaction with
endophilin-associated ubiquitin ligase Cbl proteins. It
is also important in many other cellular processes
including vesicle-mediated transport, cytoskeletal
remodelling, apoptosis, cell adhesion and migration,
and viral infection, among others. CIN85 exists as
multiple variants from alternative splicing; the main
variant contains three SH3 domains, a proline-rich
region, and a C-terminal coiled-coil domain. All of
these domains enable CIN85 to bind various protein
partners and assemble complexes that have been
implicated in many different functions. This alignment
model represents the second SH3 domain (SH3B) of CIN85.
SH3B has been shown to bind Cbl proline-rich peptides
and ubiquitin. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 35.7 bits (82), Expect = 2e-04
Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A+ Y +L ++I V + E WW G + +TG+FPSN++
Sbjct: 4 VAFSYLPQNEDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFI 51
>gnl|CDD|212915 cd11982, SH3_Shank1, Src homology 3 domain of SH3 and multiple
ankyrin repeat domains protein 1. Shank1, also called
SSTRIP (Somatostatin receptor-interacting protein), is
a brain-specific protein that plays a role in the
construction of postsynaptic density (PSD) and the
maturation of dendritic spines. Mice deficient in
Shank1 show altered PSD composition, thinner PSDs,
smaller dendritic spines, and weaker basal synaptic
transmission, although synaptic plasticity is normal.
They show increased anxiety and impaired fear memory,
but also show better spatial learning. Shank proteins
carry scaffolding functions through multiple sites of
protein-protein interaction in its domain architecture,
including ankyrin (ANK) repeats, a long proline rich
region, as well as SH3, PDZ, and SAM domains. The SH3
domain of Shank binds GRIP, a scaffold protein that
binds AMPA receptors and Eph receptors/ligands. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 35.8 bits (82), Expect = 2e-04
Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNYV 60
++A PY S G+++ ++ E I V + E +W G + R G FPS+ V
Sbjct: 3 FMAVKPYQSQAEGEISLSKGEKIKVLSVGEGGFWEGQVKGRVGWFPSDCV 52
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of
ephexin-1-like SH3 domain containing Rho guanine
nucleotide exchange factors. Members of this family
contain RhoGEF (also called Dbl-homologous or DH),
Pleckstrin Homology (PH), and C-terminal SH3 domains.
They include the Rho guanine nucleotide exchange
factors ARHGEF5, ARHGEF16, ARHGEF19, ARHGEF26, ARHGEF27
(also called ephexin-1), and similar proteins, and are
also called ephexins because they interact directly
with ephrin A receptors. GEFs interact with Rho GTPases
via their DH domains to catalyze nucleotide exchange by
stabilizing the nucleotide-free GTPase intermediate.
They play important roles in neuronal development. The
SH3 domains of ARHGEFs play an autoinhibitory role
through intramolecular interactions with a proline-rich
region N-terminal to the DH domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 35.4 bits (82), Expect = 2e-04
Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGT-IGD-RTGLFPSNYVV 61
+ Y + +P +LT + +V+ V +K D W+ G + D G FPS+Y
Sbjct: 3 QCVHAYTAQQPDELTLEEGDVVNVLRKMPDGWYEGERLRDGERGWFPSSYTE 54
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 1, an E3 ubiquitin-protein
ligase. SH3RF1 is also called POSH (Plenty of SH3s) or
SH3MD2 (SH3 multiple domains protein 2). It is a
scaffold protein that acts as an E3 ubiquitin-protein
ligase. It plays a role in calcium homeostasis through
the control of the ubiquitin domain protein Herp. It
may also have a role in regulating death receptor
mediated and JNK mediated apoptosis. SH3RF1 also
enhances the ubiquitination of ROMK1 potassium channel
resulting in its increased endocytosis. It contains an
N-terminal RING finger domain and four SH3 domains.
This model represents the third SH3 domain, located in
the middle, of SH3RF1. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 35.3 bits (81), Expect = 3e-04
Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW---TGTIGDRTGLFPSNYVVP 62
Y+A YPY + +L + E+ V ++ D W T + G+FP NYV P
Sbjct: 2 YVAIYPYTPRKEDELELRKGEMFLVFERCQDGWFKGTSMHTSKIGVFPGNYVAP 55
>gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain
containing ring finger 3, an E3 ubiquitin-protein
ligase. SH3RF3 is also called POSH2 (Plenty of SH3s 2)
or SH3MD4 (SH3 multiple domains protein 4). It is a
scaffold protein with E3 ubiquitin-protein ligase
activity. It was identified in the screen for
interacting partners of p21-activated kinase 2 (PAK2).
It may play a role in regulating JNK mediated apoptosis
in certain conditions. It also interacts with
GTP-loaded Rac1. SH3RF3 is highly homologous to SH3RF1;
it also contains an N-terminal RING finger domain and
four SH3 domains. This model represents the second SH3
domain, located C-terminal of the first SH3 domain at
the N-terminal half, of SH3RF3. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 35.3 bits (81), Expect = 3e-04
Identities = 15/36 (41%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
Query: 26 LTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
LTF +DE++ V ++ + +W G +GD+ G+FP YV
Sbjct: 20 LTFTKDEILTVIRRVDENWAEGMLGDKIGIFPILYV 55
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 35.5 bits (82), Expect = 3e-04
Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 8/56 (14%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRT-------GLFPSNY 59
Y A Y Y+ +LT +D+++Y+ +K ++DWW + + GL P+ Y
Sbjct: 2 YKALYDYEPQTEDELTIQEDDILYLLEKSDDDWWKVKLKVNSSDDDEPVGLVPATY 57
>gnl|CDD|212907 cd11974, SH3_ASEF2, Src homology 3 domain of APC-Stimulated
guanine nucleotide Exchange Factor 2. ASEF2, also
called Spermatogenesis-associated protein 13 (SPATA13),
is a GEF that localizes with actin at the leading edge
of cells and is important in cell migration and
adhesion dynamics. GEFs activate small GTPases by
exchanging bound GDP for free GTP. ASEF2 can activate
both Rac 1 and Cdc42, but only Rac1 activation is
necessary for increased cell migration and adhesion
turnover. Together with APC (adenomatous polyposis
coli) and Neurabin2, a scaffold protein that binds
F-actin, it is involved in regulating HGF-induced cell
migration. ASEF2 contains a SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 54
Score = 35.0 bits (80), Expect = 3e-04
Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
Y A + + + + +L F +VI V + N DWW G DR FP+++V
Sbjct: 2 YAEALWDHVTMDDQELAFKAGDVIRVLEASNKDWWWGRNEDREAWFPASFV 52
>gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3
domain, ankyrin repeat and PH domain containing protein
1. ASAP1 is also called DDEF1 (Development and
Differentiation Enhancing Factor 1), AMAP1, centaurin
beta-4, or PAG2. an Arf GTPase activating protein (GAP)
with activity towards Arf1 and Arf5 but not Arf6.
However, it has been shown to bind GTP-Arf6 stably
without GAP activity. It has been implicated in cell
growth, migration, and survival, as well as in tumor
invasion and malignancy. It binds paxillin and
cortactin, two components of invadopodia which are
essential for tumor invasiveness. It also binds focal
adhesion kinase (FAK) and the SH2/SH3 adaptor CrkL.
ASAP1 contains an N-terminal BAR domain, followed by a
Pleckstrin homology (PH) domain, an Arf GAP domain,
ankyrin (ANK) repeats, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 35.4 bits (81), Expect = 3e-04
Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 4/40 (10%)
Query: 25 DLTFNQDEVIYVTKKEN-DWWTGTIG---DRTGLFPSNYV 60
+LTF + EVI VT +E+ +WW G I +R G+FP ++V
Sbjct: 15 ELTFVEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFV 54
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk
Protein Tyrosine Kinases. Fyn and Yrk (Yes-related
kinase) are members of the Src subfamily of proteins,
which are cytoplasmic (or non-receptor) PTKs. Fyn,
together with Lck, plays a critical role in T-cell
signal transduction by phosphorylating ITAM
(immunoreceptor tyr activation motif) sequences on
T-cell receptors, ultimately leading to the
proliferation and differentiation of T-cells. In
addition, Fyn is involved in the myelination of
neurons, and is implicated in Alzheimer's and
Parkinson's diseases. Yrk has been detected only in
chickens. It is primarily found in neuronal and
epithelial cells and in macrophages. It may play a role
in inflammation and in response to injury. Src kinases
contain an N-terminal SH4 domain with a myristoylation
site, followed by SH3 and SH2 domains, a tyr kinase
domain, and a regulatory C-terminal region containing a
conserved tyr. They are activated by
autophosphorylation at the tyr kinase domain, but are
negatively regulated by phosphorylation at the
C-terminal tyr by Csk (C-terminal Src Kinase). The SH3
domain of Src kinases contributes to substrate
recruitment by binding adaptor proteins/substrates, and
regulation of kinase activity through an intramolecular
interaction. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 35.4 bits (81), Expect = 3e-04
Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 5/55 (9%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWTG---TIGDRTGLFPSNYVVP 62
++A Y Y++ DL+F++ E + E DWW T G+ TG PSNYV P
Sbjct: 3 FVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGE-TGYIPSNYVAP 56
>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor
protein. Nck1 (also called Nckalpha) plays a crucial
role in connecting signaling pathways of tyrosine
kinase receptors and important effectors in actin
dynamics and cytoskeletal remodeling. It binds and
activates RasGAP, resulting in the downregulation of
Ras. It is also involved in the signaling of
endothilin-mediated inhibition of cell migration. Nck
adaptor proteins regulate actin cytoskeleton dynamics
by linking proline-rich effector molecules to protein
tyrosine kinases and phosphorylated signaling
intermediates. They contain three SH3 domains and a
C-terminal SH2 domain. They function downstream of the
PDGFbeta receptor and are involved in Rho GTPase
signaling and actin dynamics. Vertebrates contain two
Nck adaptor proteins: Nck1 (also called Nckalpha) and
Nck2, which show partly overlapping functions but also
bind distinct targets. The third SH3 domain of Nck
appears to prefer ligands with a PxAPxR motif. SH3
domains are protein interaction domains that usually
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially a PxxP motif. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 35.0 bits (80), Expect = 4e-04
Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 4/51 (7%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-END--WWT-GTIGDRTGLFPSNYV 60
A YP+ S+ +L F + EV+ V +K END WW + GL P NYV
Sbjct: 5 ALYPFSSSNDEELNFEKGEVMDVIEKPENDPEWWKCRKANGQVGLVPKNYV 55
>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and
double SH3 domains protein 1. FCHSD1 has a domain
structure consisting of an N-terminal F-BAR (FES-CIP4
Homology and Bin/Amphiphysin/Rvs), two SH3, and
C-terminal proline-rich domains. It has only been
characterized in silico and its function is unknown.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 34.9 bits (80), Expect = 5e-04
Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 5/49 (10%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND-----WWTGTIGDRTGLFPS 57
A Y Y P +L+F + +I + + D +W G G R G+FPS
Sbjct: 4 ALYSYTGQSPEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGRVGVFPS 52
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase.
CSK is a cytoplasmic (or nonreceptor) tyr kinase
containing the Src homology domains, SH3 and SH2,
N-terminal to the catalytic tyr kinase domain. They
negatively regulate the activity of Src kinases that
are anchored to the plasma membrane. To inhibit Src
kinases, CSK is translocated to the membrane via
binding to specific transmembrane proteins, G-proteins,
or adaptor proteins near the membrane. CSK catalyzes
the tyr phosphorylation of the regulatory C-terminal
tail of Src kinases, resulting in their inactivation.
It is expressed in a wide variety of tissues and plays
a role, as a regulator of Src, in cell proliferation,
survival, and differentiation, and consequently, in
cancer development and progression. In addition, CSK
also shows Src-independent functions. It is a critical
component in G-protein signaling, and plays a role in
cytoskeletal reorganization and cell migration. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 35.0 bits (81), Expect = 5e-04
Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTIGD-RTGLFPSNYV 60
IA Y ++ DL F + +++ + D W+ D R G+ P+NYV
Sbjct: 5 IAKYNFNGASEEDLPFKKGDILTIVAVTKDPNWYKAKNKDGREGMIPANYV 55
>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src
Kinase-Associated Phosphoprotein 1 and similar
proteins. This subfamily is composed of SKAP1, SKAP2,
and similar proteins. SKAP1 and SKAP2 are immune
cell-specific adaptor proteins that play roles in T-
and B-cell adhesion, respectively, and are thus
important in the migration of T- and B-cells to sites
of inflammation and for movement during T-cell
conjugation with antigen-presenting cells. Both SKAP1
and SKAP2 bind to ADAP (adhesion and
degranulation-promoting adaptor protein), among many
other binding partners. They contain a pleckstrin
homology (PH) domain, a C-terminal SH3 domain, and
several tyrosine phosphorylation sites. The SH3 domain
of SKAP1 is necessary for its ability to regulate
T-cell conjugation with antigen-presenting cells and
the formation of LFA-1 clusters. SKAP1 binds primarily
to a proline-rich region of ADAP through its SH3
domain; its degradation is regulated by ADAP. A
secondary interaction occurs via the ADAP SH3 domain
and the RKxxYxxY motif in SKAP1. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 34.7 bits (80), Expect = 5e-04
Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND---WWTGTIGDRTGLFPSNYV 60
+Y+ + EP +L+F + ++IY+ KE D WW G + + GL P +Y+
Sbjct: 1 WYMGLWDCSGNEPDELSFKRGDLIYIISKEYDSFGWWVGELNGKVGLVPKDYL 53
>gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba. DNMBP or
Tuba is a cdc42-specific guanine nucleotide exchange
factor (GEF) that contains four N-terminal SH3 domains,
a central RhoGEF [or Dbl homology (DH)] domain followed
by a Bin/Amphiphysin/Rvs (BAR) domain, and two
C-terminal SH3 domains. It provides a functional link
between dynamin and key regulatory proteins of the
actin cytoskeleton. It plays an important role in
regulating cell junction configuration. The four
N-terminal SH3 domains of DNMBP bind the GTPase
dynamin, which plays an important role in the fission
of endocytic vesicles. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 50
Score = 34.7 bits (80), Expect = 5e-04
Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNY 59
Y +A Y + + EP +L F + I + E+ W G + R G+FP +
Sbjct: 1 YGVALYRFQALEPNELDFEVGDRIRIIATLEDGWLEGELKGRRGIFPHRF 50
>gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain
containing ring finger 3, an E3 ubiquitin-protein
ligase. SH3RF3 is also called POSH2 (Plenty of SH3s 2)
or SH3MD4 (SH3 multiple domains protein 4). It is a
scaffold protein with E3 ubiquitin-protein ligase
activity. It was identified in the screen for
interacting partners of p21-activated kinase 2 (PAK2).
It may play a role in regulating JNK mediated apoptosis
in certain conditions. It also interacts with
GTP-loaded Rac1. SH3RF3 is highly homologous to SH3RF1;
it also contains an N-terminal RING finger domain and
four SH3 domains. This model represents the third SH3
domain, located in the middle, of SH3RF3. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 34.6 bits (79), Expect = 6e-04
Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRT---GLFPSNYVVP 62
Y+A Y Y + +L + E+ V +K D W RT G+FP NYV P
Sbjct: 3 YLALYAYKPQKNDELELRKGEMYRVIEKCQDGWFKGTSLRTGVSGVFPGNYVTP 56
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin,
also called Sorbin and SH3 domain containing 3
(Sorbs3). Vinexin is also called Sorbs3, SH3P3, and
SH3-containing adapter molecule 1 (SCAM-1). It is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. Vinexin was first identified as
a vinculin binding protein; it is co-localized with
vinculin at cell-ECM and cell-cell adhesion sites.
There are several splice variants of vinexin: alpha,
which contains the SoHo and three SH3 domains and
displays tissue-specific expression; and beta, which
contains only the three SH3 domains and is widely
expressed. Vinexin alpha stimulates the accumulation of
F-actin at focal contact sites. Vinexin also promotes
keratinocyte migration and wound healing. The SH3
domains of vinexin have been reported to bind a number
of ligands including vinculin, WAVE2, DLG5, Abl, and
Cbl. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 34.1 bits (78), Expect = 9e-04
Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
Query: 23 PGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
P +LT + +++Y+ K+ + +W G R G+FP+NYV
Sbjct: 14 PKELTLQKGDIVYIHKEVDKNWLEGEHHGRVGIFPANYV 52
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine
nucleotide exchange factor ARHGEF9. ARHGEF9, also
called PEM2 or collybistin, selectively activates Cdc42
by exchanging bound GDP for free GTP. It is highly
expressed in the brain and it interacts with gephyrin,
a postsynaptic protein associated with GABA and glycine
receptors. Mutations in the ARHGEF9 gene cause X-linked
mental retardation with associated features like
seizures, hyper-anxiety, aggressive behavior, and
sensory hyperarousal. ARHGEF9 contains a SH3 domain
followed by RhoGEF (also called Dbl-homologous or DH)
and Pleckstrin Homology (PH) domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 62
Score = 33.9 bits (77), Expect = 0.001
Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
Query: 25 DLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
+L F +VI V N DWW G I D G FP+++V
Sbjct: 20 ELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFV 56
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain
of the Nebulin family of proteins. Nebulin family
proteins contain multiple nebulin repeats, and may
contain an N-terminal LIM domain and/or a C-terminal
SH3 domain. They have molecular weights ranging from 34
to 900 kD, depending on the number of nebulin repeats,
and they all bind actin. They are involved in the
regulation of actin filament architecture and function
as stabilizers and scaffolds for cytoskeletal
structures with which they associate, such as long
actin filaments or focal adhesions. Nebulin family
proteins that contain a C-terminal SH3 domain include
the giant filamentous protein nebulin, nebulette,
Lasp1, and Lasp2. Lasp2, also called LIM-nebulette, is
an alternatively spliced variant of nebulette. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 33.8 bits (78), Expect = 0.001
Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 5/55 (9%)
Query: 12 YIAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGDRT---GLFPSNYVVP 62
Y A Y Y + + +++F + D +I V ++ W GT+ RT G+ P+NYV
Sbjct: 2 YRAMYDYAAADDDEVSFQEGDVIINVEIIDDGWMEGTV-QRTGQSGMLPANYVEL 55
>gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator
Associated with Focal adhesion kinase 2. GRAF2, also
called Rho GTPase activating protein 10 (ARHGAP10) or
PS-GAP, is a GAP with activity towards Cdc42 and RhoA.
It regulates caspase-activated p21-activated protein
kinase-2 (PAK-2p34). GRAF2 interacts with PAK-2p34,
leading to its stabilization and decrease of cell
death. It is highly expressed in skeletal muscle, and
is involved in alpha-catenin recruitment at cell-cell
junctions. GRAF2 contains an N-terminal BAR domain,
followed by a Pleckstrin homology (PH) domain, a Rho
GAP domain, and a C-terminal SH3 domain. The SH3 domain
of GRAF binds PKNbeta, a target of the small GTPase
Rho. SH3 domains bind to proline-rich ligands with
moderate affinity and selectivity, preferentially to
PxxP motifs; they play a role in the regulation of
enzymes by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 54
Score = 33.8 bits (77), Expect = 0.001
Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIY--VTKKENDWWTGTIGDRTGLFPSNYV 60
A YP ++ +L+F + +E W GT+ + GL P NYV
Sbjct: 4 AVYPCEAEHSSELSFEVGAIFEDVTLSREPGWLEGTLNGKRGLIPENYV 52
>gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src
Kinase-Associated Phosphoprotein 2. SKAP2, also called
SKAP55-Related (SKAP55R) or SKAP55 homolog (SKAP-HOM or
SKAP55-HOM), is an immune cell-specific adaptor protein
that plays an important role in adhesion and migration
of B-cells and macrophages. Binding partners include
ADAP (adhesion and degranulation-promoting adaptor
protein), YopH, SHPS1, and HPK1. SKAP2 has also been
identified as a substrate for lymphoid-specific
tyrosine phosphatase (Lyp), which has been implicated
in a wide variety of autoimmune diseases. It contains a
pleckstrin homology (PH) domain, a C-terminal SH3
domain, and several tyrosine phosphorylation sites.
Like SKAP1, SKAP2 is expected to bind primarily to a
proline-rich region of ADAP through its SH3 domain; its
degradation may be regulated by ADAP. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 33.7 bits (77), Expect = 0.001
Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND---WWTGTIGDRTGLFPSNYV 60
+Y + +P +L+F + + IY+ KE + WW G + GL P Y+
Sbjct: 1 FYQGLWDCTGDQPDELSFKRGDTIYILSKEYNRFGWWVGEMKGTIGLVPKAYI 53
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of
Rab3-interacting molecules (RIMs) binding proteins.
RIMs binding proteins (RBPs, RIM-BPs) associate with
calcium channels present in photoreceptors, neurons,
and hair cells; they interact simultaneously with
specific calcium channel subunits, and active zone
proteins, RIM1 and RIM2. RIMs are part of the matrix at
the presynaptic active zone and are associated with
synaptic vesicles through their interaction with the
small GTPase Rab3. RIM-BPs play a role in regulating
synaptic transmission by serving as adaptors and
linking calcium channels with the synaptic vesicle
release machinery. RIM-BPs contain three SH3 domains
and two to three fibronectin III repeats. Invertebrates
contain one, while vertebrates contain at least two
RIM-BPs, RIM-BP1 and RIM-BP2. RIM-BP1 is also called
peripheral-type benzodiazapine receptor associated
protein 1 (PRAX-1). Mammals contain a third protein,
RIM-BP3. RIM-BP1 and RIM-BP2 are predominantly
expressed in the brain where they display overlapping
but distinct expression patterns, while RIM-BP3 is
almost exclusively expressed in the testis and is
essential in spermiogenesis. The SH3 domains of RIM-BPs
bind to the PxxP motifs of RIM1, RIM2, and L-type
(alpha1D) and N-type (alpha1B) calcium channel
subunits. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 61
Score = 33.5 bits (77), Expect = 0.001
Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 9/58 (15%)
Query: 12 YIAAYPYDSTEPG-------DLTFNQDEVIYV--TKKENDWWTGTIGDRTGLFPSNYV 60
+A + YD E +L+F ++I V E+ ++ G + + GL PSN++
Sbjct: 2 MVALFDYDPRESSPNVDAEVELSFRAGDIITVFGEMDEDGFYYGELNGQRGLVPSNFL 59
>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin,
also called Sorbin and SH3 domain containing 3
(Sorbs3). Vinexin is also called Sorbs3, SH3P3, and
SH3-containing adapter molecule 1 (SCAM-1). It is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. Vinexin was first identified as
a vinculin binding protein; it is co-localized with
vinculin at cell-ECM and cell-cell adhesion sites.
There are several splice variants of vinexin: alpha,
which contains the SoHo and three SH3 domains and
displays tissue-specific expression; and beta, which
contains only the three SH3 domains and is widely
expressed. Vinexin alpha stimulates the accumulation of
F-actin at focal contact sites. Vinexin also promotes
keratinocyte migration and wound healing. The SH3
domains of vinexin have been reported to bind a number
of ligands including vinculin, WAVE2, DLG5, Abl, and
Cbl. SH3 domains are protein interaction domains that
bind to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 33.4 bits (76), Expect = 0.001
Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIG--DRTGLFPSNYV 60
+A Y + +L+F + E I + +K N+ W+ G I R G+FP++YV
Sbjct: 4 VAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYV 54
>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha
Spectrin. Spectrin is a major structural component of
the red blood cell membrane skeleton and is important
in erythropoiesis and membrane biogenesis. It is a
flexible, rope-like molecule composed of two subunits,
alpha and beta, which consist of many spectrin-type
repeats. Alpha and beta spectrin associate to form
heterodimers and tetramers; spectrin tetramer formation
is critical for red cell shape and deformability.
Defects in alpha spectrin have been associated with
inherited hemolytic anemias including hereditary
spherocytosis (HSp), hereditary elliptocytosis (HE),
and hereditary pyropoikilocytosis (HPP). Alpha spectrin
contains a middle SH3 domain and a C-terminal EF-hand
binding motif in addition to multiple spectrin repeats.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 33.2 bits (76), Expect = 0.002
Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
+A Y Y P +++ + +++ + N DWW + DR G P+ YV
Sbjct: 1 CVVALYDYQEKSPREVSMKKGDILTLLNSSNKDWWKVEVNDRQGFVPAAYV 51
>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B.
Endophilins play roles in synaptic vesicle formation,
virus budding, mitochondrial morphology maintenance,
receptor-mediated endocytosis inhibition, and endosomal
sorting. They are classified into two types, A and B.
Vertebrates contain two endophilin-B isoforms.
Endophilin-B proteins are cytoplasmic proteins
expressed mainly in the heart, placenta, and skeletal
muscle. Endophilins contain an N-terminal N-BAR domain
(BAR domain with an additional N-terminal amphipathic
helix), followed by a variable region containing
proline clusters, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 33.4 bits (77), Expect = 0.002
Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTK---KENDWWTGTIGDRTGLFPSNY 59
Y YD+ + +L+ DEVI V + + D+ G G + G P Y
Sbjct: 6 YDYDAEDSTELSLLADEVITVYELPGMDEDYMMGERGSQRGKVPVAY 52
>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain
of Sorbin and SH3 domain containing (Sorbs) proteins
and similar domains. This family, also called the
vinexin family, is composed predominantly of adaptor
proteins containing one sorbin homology (SoHo) and
three SH3 domains. Members include the third SH3
domains of Sorbs1 (or ponsin), Sorbs2 (or ArgBP2),
Vinexin (or Sorbs3), and similar domains. They are
involved in the regulation of cytoskeletal
organization, cell adhesion, and growth factor
signaling. Members of this family bind multiple
partners including signaling molecules like c-Abl,
c-Arg, Sos, and c-Cbl, as well as cytoskeletal
molecules such as vinculin and afadin. They may have
overlapping functions. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 33.0 bits (76), Expect = 0.002
Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGL---FPSNYVVP 62
Y A Y Y +L + +++YV +K +D W+ GT RTGL FP NYV
Sbjct: 2 YRALYSYTPQNEDELELREGDIVYVMEKCDDGWFVGTSE-RTGLFGTFPGNYVAR 55
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor
protein. Nck1 (also called Nckalpha) plays a crucial
role in connecting signaling pathways of tyrosine
kinase receptors and important effectors in actin
dynamics and cytoskeletal remodeling. It binds and
activates RasGAP, resulting in the downregulation of
Ras. It is also involved in the signaling of
endothilin-mediated inhibition of cell migration. Nck
adaptor proteins regulate actin cytoskeleton dynamics
by linking proline-rich effector molecules to protein
tyrosine kinases and phosphorylated signaling
intermediates. They contain three SH3 domains and a
C-terminal SH2 domain. They function downstream of the
PDGFbeta receptor and are involved in Rho GTPase
signaling and actin dynamics. Vertebrates contain two
Nck adaptor proteins: Nck1 (also called Nckalpha) and
Nck2, which show partly overlapping functions but also
bind distinct targets. The second SH3 domain of Nck
appears to prefer ligands containing the APxxPxR motif.
SH3 domains are protein interaction domains that
usually bind to proline-rich ligands with moderate
affinity and selectivity, preferentially a PxxP motif.
They play versatile and diverse roles in the cell
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 33.5 bits (76), Expect = 0.002
Identities = 13/29 (44%), Positives = 18/29 (62%)
Query: 32 EVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
+VI + K + WW G+ + G FPSNYV
Sbjct: 25 KVIVMEKCSDGWWRGSYNGQVGWFPSNYV 53
>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3
domain of Dynamin Binding Protein, also called Tuba,
and similar domains. DNMBP or Tuba is a cdc42-specific
guanine nucleotide exchange factor (GEF) that contains
four N-terminal SH3 domains, a central RhoGEF [or Dbl
homology (DH)] domain followed by a Bin/Amphiphysin/Rvs
(BAR) domain, and two C-terminal SH3 domains. It
provides a functional link between dynamin, Rho GTPase
signaling, and actin dynamics. It plays an important
role in regulating cell junction configuration. The
C-terminal SH3 domains of DNMBP bind to N-WASP and
Ena/VASP proteins, which are key regulatory proteins of
the actin cytoskeleton. Also included in this subfamily
is the second C-terminal SH3 domain of Rho guanine
nucleotide exchange factor 37 (ARHGEF37), whose
function is still unknown. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 33.1 bits (76), Expect = 0.002
Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 5/54 (9%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYV-----TKKENDWWTGTIGDRTGLFPSNY 59
YY A Y +++ PG+L+ + +V+ V K +WW + G PSNY
Sbjct: 1 YYYALYTFEARSPGELSVTEGQVVTVLEKHDLKGNPEWWLVEDRGKQGYVPSNY 54
>gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and
tetratricopeptide repeat-containing (SH3TC) proteins
and similar domains. This subfamily is composed of
vertebrate SH3TC proteins and hypothetical fungal
proteins containing BAR and SH3 domains. Mammals
contain two SH3TC proteins, SH3TC1 and SH3TC2. The
function of SH3TC1 is unknown. SH3TC2 is localized in
Schwann cells in the peripheral nervous system, where
it interacts with Rab11 and plays a role in peripheral
nerve myelination. Mutations in SH3TC2 are associated
with Charcot-Marie-Tooth disease type 4C, a severe
hereditary peripheral neuropathy with symptoms that
include progressive scoliosis, delayed age of walking,
muscular atrophy, distal weakness, and reduced nerve
conduction velocity. SH3 domains bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs; they play a role in the
regulation of enzymes by intramolecular interactions,
changing the subcellular localization of signal pathway
components and mediate multiprotein complex assemblies.
Length = 55
Score = 33.1 bits (76), Expect = 0.002
Identities = 15/52 (28%), Positives = 23/52 (44%), Gaps = 5/52 (9%)
Query: 14 AAYPYDSTEPGDLTFNQD---EVIYVTKKENDWWTGTIGD--RTGLFPSNYV 60
A ++ EPG+L+F Q E+I W+ G R G P+N+
Sbjct: 4 AKMDFEGVEPGELSFRQGDSIEIIGDLIPGLQWFVGRSKSSGRVGFVPTNHF 55
>gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and
double SH3 domains protein 2. FCHSD2 has a domain
structure consisting of an N-terminal F-BAR (FES-CIP4
Homology and Bin/Amphiphysin/Rvs), two SH3, and
C-terminal proline-rich domains. It has only been
characterized in silico and its function is unknown.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 33.0 bits (75), Expect = 0.002
Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND----WWTGTIGDRTGLFPS 57
+ A Y Y+ +L+F + +I + KEN +W G R G+FPS
Sbjct: 1 FVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPS 51
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin
and related domains. Amphiphysins function primarily
in endocytosis and other membrane remodeling events.
They exist in several isoforms and mammals possess two
amphiphysin proteins from distinct genes. Amphiphysin I
proteins, enriched in the brain and nervous system,
contain domains that bind clathrin, Adaptor Protein
complex 2 (AP2), dynamin, and synaptojanin. They
function in synaptic vesicle endocytosis. Human
autoantibodies to amphiphysin I hinder GABAergic
signaling and contribute to the pathogenesis of
paraneoplastic stiff-person syndrome. Some amphiphysin
II isoforms, also called Bridging integrator 1 (Bin1),
are localized in many different tissues and may
function in intracellular vesicle trafficking. In
skeletal muscle, Bin1 plays a role in the organization
and maintenance of the T-tubule network. Mutations in
Bin1 are associated with autosomal recessive
centronuclear myopathy. Amphiphysins contain an
N-terminal BAR domain with an additional N-terminal
amphipathic helix (an N-BAR), a variable central
domain, and a C-terminal SH3 domain. The SH3 domain of
amphiphysins bind proline-rich motifs present in
binding partners such as dynamin, synaptojanin, and
nsP3. It also belongs to a subset of SH3 domains that
bind ubiquitin in a site that overlaps with the peptide
binding site. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 64
Score = 33.1 bits (76), Expect = 0.002
Identities = 14/57 (24%), Positives = 24/57 (42%), Gaps = 8/57 (14%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND------WWTGTIGDRT--GLFPSNYVVP 62
A + Y + + +LTF + +VI V ++ W G G+FP N+
Sbjct: 7 ATHDYTAEDTDELTFEKGDVILVIPFDDPEEQDEGWLMGVKESTGCRGVFPENFTER 63
>gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain
containing ring finger protein 1, an E3
ubiquitin-protein ligase. SH3RF1 is also called POSH
(Plenty of SH3s) or SH3MD2 (SH3 multiple domains
protein 2). It is a scaffold protein that acts as an E3
ubiquitin-protein ligase. It plays a role in calcium
homeostasis through the control of the ubiquitin domain
protein Herp. It may also have a role in regulating
death receptor mediated and JNK mediated apoptosis.
SH3RF1 also enhances the ubiquitination of ROMK1
potassium channel resulting in its increased
endocytosis. It contains an N-terminal RING finger
domain and four SH3 domains. This model represents the
second SH3 domain, located C-terminal of the first SH3
domain at the N-terminal half, of SH3RF1. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 33.0 bits (75), Expect = 0.002
Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)
Query: 26 LTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
L F +D+++ V ++ + +W G +GD+ G+FP +YV
Sbjct: 20 LPFAKDDILTVIRRVDENWAEGMLGDKIGIFPISYV 55
>gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho
GTPase-activating proteins 32 and 33, and similar
proteins. Members of this family contain N-terminal PX
and Src Homology 3 (SH3) domains, a central Rho GAP
domain, and C-terminal extensions. RhoGAPs (or ARHGAPs)
bind to Rho proteins and enhance the hydrolysis rates
of bound GTP. ARHGAP32 is also called RICS, PX-RICS,
p250GAP, or p200RhoGAP. It is a Rho GTPase-activating
protein for Cdc42 and Rac1, and is implicated in the
regulation of postsynaptic signaling and neurite
outgrowth. PX-RICS, a variant of RICS that contain PX
and SH3 domains, is the main isoform expressed during
neural development. It is involved in neural functions
including axon and dendrite extension, postnatal
remodeling, and fine-tuning of neural circuits during
early brain development. ARHGAP33, also called sorting
nexin 26 or TCGAP (Tc10/CDC42 GTPase-activating
protein), is widely expressed in the brain where it is
involved in regulating the outgrowth of axons and
dendrites and is regulated by the protein tyrosine
kinase Fyn. It is translocated to the plasma membrane
in adipocytes in response to insulin and may be
involved in the regulation of insulin-stimulated
glucose transport. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 32.8 bits (75), Expect = 0.003
Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
Query: 17 PYDSTEPGDLTFNQDEVIYV----TKKENDWWTGTIGDRTGLFPSNYV 60
Y + P +L+ +++ V +E+ WW G G + G FPS V
Sbjct: 7 RYTAQAPDELSLEVGDIVSVIDMPPPEESTWWRGKKGFQVGFFPSECV 54
>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis
Stimulating of p53 protein 1. ASPP1, like ASPP2,
activates the apoptotic function of the p53 family of
tumor suppressors (p53, p63, and p73). In addition, it
functions in the cytoplasm to regulate the nuclear
localization of the transcriptional cofactors YAP and
TAZ by inihibiting their phosphorylation; YAP and TAZ
are important regulators of cell expansion,
differentiation, migration, and invasion. ASPP1 is
downregulated in breast tumors expressing wild-type
p53. It contains a proline-rich region, four ankyrin
(ANK) repeats, and an SH3 domain at its C-terminal
half. The SH3 domain and the ANK repeats of ASPP1
contribute to the p53 binding site; they bind to the
DNA binding domain of p53. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 32.7 bits (74), Expect = 0.003
Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK----ENDWWTGTIGDRTGLFPSN 58
A + Y++ +L+F + + I + ++ E +WW + D+ G P N
Sbjct: 5 ALWDYEAQNADELSFQEGDAITILRRKDDSETEWWWARLNDKEGYVPKN 53
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain
of VAV2 protein. VAV2 is widely expressed and
functions as a guanine nucleotide exchange factor (GEF)
for RhoA, RhoB and RhoG and also activates Rac1 and
Cdc42. It is implicated in many cellular and
physiological functions including blood pressure
control, eye development, neurite outgrowth and
branching, EGFR endocytosis and degradation, and cell
cluster morphology, among others. It has been reported
to associate with Nek3. VAV proteins contain several
domains that enable their function: N-terminal calponin
homology (CH), acidic, RhoGEF (also called
Dbl-homologous or DH), Pleckstrin Homology (PH), C1
(zinc finger), SH2, and two SH3 domains. The SH3 domain
of VAV is involved in the localization of proteins to
specific sites within the cell, by interacting with
proline-rich sequences within target proteins. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 32.7 bits (74), Expect = 0.003
Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 3/51 (5%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNYV 60
+A Y + + + +L+ + +V+ + + + WW G R G FPS YV
Sbjct: 4 VARYNFAARDMRELSLREGDVVRIYSRIGGDQGWWKGETNGRIGWFPSTYV 54
>gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src
Kinase-Associated Phosphoprotein 1. SKAP1, also called
SKAP55 (Src kinase-associated protein of 55kDa), is an
immune cell-specific adaptor protein that plays an
important role in T-cell adhesion, migration, and
integrin clustering. It is expressed exclusively in
T-lymphocytes, mast cells, and macrophages. Binding
partners include ADAP (adhesion and
degranulation-promoting adaptor protein), Fyn, Riam,
RapL, and RasGRP. It contains a pleckstrin homology
(PH) domain, a C-terminal SH3 domain, and several
tyrosine phosphorylation sites. The SH3 domain of SKAP1
is necessary for its ability to regulate T-cell
conjugation with antigen-presenting cells and the
formation of LFA-1 clusters. SKAP1 binds primarily to a
proline-rich region of ADAP through its SH3 domain; its
degradation is regulated by ADAP. A secondary
interaction occurs via the ADAP SH3 domain and the
RKxxYxxY motif in SKAP1. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 32.5 bits (74), Expect = 0.003
Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND---WWTGTIGDRTGLFPSNYV 60
YY + P +L+F + ++IY+ KE + WW G + G+ P +Y+
Sbjct: 1 YYQGLWDCFGDNPDELSFQRGDLIYILSKEYNMYGWWVGELNGIVGIVPKDYL 53
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine
N-methyltransferase 2. PRMT2, also called HRMT1L1,
belongs to the arginine methyltransferase protein
family. It functions as a coactivator to both estrogen
receptor alpha (ER-alpha) and androgen receptor (AR),
presumably through arginine methylation. The ER-alpha
transcription factor is involved in cell proliferation,
differentiation, morphogenesis, and apoptosis, and is
also implicated in the development and progression of
breast cancer. PRMT2 and its variants are upregulated
in breast cancer cells and may be involved in
modulating the ER-alpha signaling pathway during
formation of breast cancer. PRMT2 also plays a role in
regulating the function of E2F transcription factors,
which are critical cell cycle regulators, by binding to
the retinoblastoma gene product (RB). It contains an
N-terminal SH3 domain and an AdoMet binding domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 32.4 bits (74), Expect = 0.004
Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYVVP 62
Y+A + +T+ L+F + + V +K + DWW G P++++
Sbjct: 2 YVAIADFVATDDSQLSFESGDKLLVLRKPSVDWWWAEHNGCCGYIPASHLHQ 53
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown
subfamily of proteins with similarity to Protein kinase
C and Casein kinase Substrate in Neurons (PACSIN)
proteins. PACSINs, also called Synaptic
dynamin-associated proteins (Syndapins), act as
regulators of cytoskeletal and membrane dynamics. They
bind both dynamin and Wiskott-Aldrich syndrome protein
(WASP), and may provide direct links between the actin
cytoskeletal machinery through WASP and
dynamin-dependent endocytosis. Vetebrates harbor three
isoforms with distinct expression patterns and specific
functions. PACSINs contain an N-terminal F-BAR domain
and a C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 56
Score = 32.6 bits (74), Expect = 0.004
Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND--W-WTGTIGDRTGLFPSNYV 60
A Y Y EP +L+F E + + E++ W T G GL+P+NYV
Sbjct: 6 AVYDYTGQEPDELSFKAGEELLKVEDEDEQGWCKGVTDGGAVGLYPANYV 55
>gnl|CDD|212811 cd11878, SH3_Bem1p_1, First Src Homology 3 domain of Bud
emergence protein 1 and similar domains. Members of
this subfamily bear similarity to Saccharomyces
cerevisiae Bem1p, containing two Src Homology 3 (SH3)
domains at the N-terminus, a central PX domain, and a
C-terminal PB1 domain. Bem1p is a scaffolding protein
that is critical for proper Cdc42p activation during
bud formation in yeast. During budding and mating,
Bem1p migrates to the plasma membrane where it can
serve as an adaptor for Cdc42p and some other proteins.
Bem1p also functions as an effector of the G1 cyclin
Cln3p and the cyclin-dependent kinase Cdc28p in
promoting vacuolar fusion. SH3 domains bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs; they play a
role in the regulation of enzymes by intramolecular
interactions, changing the subcellular localization of
signal pathway components and mediate multiprotein
complex assemblies.
Length = 54
Score = 32.3 bits (74), Expect = 0.004
Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 4/50 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKE--NDWW--TGTIGDRTGLFPSNY 59
A Y Y + PG+L+F++ + +V +E +W+ T + + GL P +Y
Sbjct: 4 ALYDYRAQTPGELSFSKGDFFHVIGEEDQGEWYEATNPVTGKRGLVPKSY 53
>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor
protein. Nck2 (also called Nckbeta or Growth factor
receptor-bound protein 4, Grb4) plays a crucial role in
connecting signaling pathways of tyrosine kinase
receptors and important effectors in actin dynamics and
cytoskeletal remodeling. It binds neuronal signaling
proteins such as ephrinB and Disabled-1 (Dab-1)
exclusively. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2, which show partly
overlapping functions but also bind distinct targets.
The second SH3 domain of Nck appears to prefer ligands
containing the APxxPxR motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially a PxxP motif. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 32.3 bits (73), Expect = 0.004
Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYVV 61
+ Y + +L+ + + V +K +D WW G+ + G FPSNYVV
Sbjct: 4 FVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVV 53
>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18.
SNX18 is localized to peripheral endosomal structures,
and acts in a trafficking pathway that is
clathrin-independent but relies on AP-1 and PACS1. It
binds FIP5 and is required for apical lumen formation.
It may also play a role in axonal elongation. SNXs are
Phox homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNX18 also contains
BAR and SH3 domains. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 32.3 bits (73), Expect = 0.005
Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 5/51 (9%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWW---TGTIGDRTGLFPSNYV 60
A Y + S PG+++ + EV+ + +++ + W + GDR GLFP++YV
Sbjct: 4 ALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDR-GLFPASYV 53
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor
protein. Nck2 (also called Nckbeta or Growth factor
receptor-bound protein 4, Grb4) plays a crucial role in
connecting signaling pathways of tyrosine kinase
receptors and important effectors in actin dynamics and
cytoskeletal remodeling. It binds neuronal signaling
proteins such as ephrinB and Disabled-1 (Dab-1)
exclusively. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2, which show partly
overlapping functions but also bind distinct targets.
The third SH3 domain of Nck appears to prefer ligands
with a PxAPxR motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially a PxxP motif. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 59
Score = 32.0 bits (72), Expect = 0.006
Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 4/50 (8%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKK-END--WWT-GTIGDRTGLFPSNYVV 61
YP+ S +L F + E + V +K END WW + GL P NYVV
Sbjct: 7 YPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNSRGQVGLVPKNYVV 56
>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase
Activating Proteins 1, 2, and 3. srGAP1, also called
Rho GTPase-Activating Protein 13 (ARHGAP13), is a
Cdc42- and RhoA-specific GAP and is expressed later in
the development of central nervous system tissues.
srGAP2 is expressed in zones of neuronal
differentiation. It plays a role in the regeneration of
neurons and axons. srGAP3, also called MEGAP (MEntal
disorder associated GTPase-Activating Protein), is a
Rho GAP with activity towards Rac1 and Cdc42. It
impacts cell migration by regulating actin and
microtubule cytoskeletal dynamics. The association
between srGAP3 haploinsufficiency and mental
retardation is under debate. srGAPs are Rho GAPs that
interact with Robo1, the transmembrane receptor of Slit
proteins. Slit proteins are secreted proteins that
control axon guidance and the migration of neurons and
leukocytes. srGAPs contain an N-terminal F-BAR domain,
a Rho GAP domain, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 31.8 bits (72), Expect = 0.007
Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGDRTGLFPSNYVV 61
IA + Y +L+F + ++ + +DWW G GL P Y+V
Sbjct: 3 IAKFDYVGRSARELSFKKGASLLLYHRASDDWWEGRHNGIDGLVPHQYIV 52
>gnl|CDD|212838 cd11905, SH3_Tec, Src Homology 3 domain of Tec (Tyrosine kinase
expressed in hepatocellular carcinoma). Tec is a
cytoplasmic (or nonreceptor) tyr kinase containing Src
homology protein interaction domains (SH3, SH2)
N-terminal to the catalytic tyr kinase domain. It also
contains an N-terminal pleckstrin homology (PH) domain,
which binds the products of PI3K and allows membrane
recruitment and activation, and the Tec homology (TH)
domain, which contains proline-rich and zinc-binding
regions. It is more widely-expressed than other Tec
subfamily kinases. Tec is found in endothelial cells,
both B- and T-cells, and a variety of myeloid cells
including mast cells, erythroid cells, platelets,
macrophages and neutrophils. Tec is a key component of
T-cell receptor (TCR) signaling, and is important in
TCR-stimulated proliferation, IL-2 production and
phospholipase C-gamma1 activation. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 31.7 bits (72), Expect = 0.007
Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGD-RTGLFPSNYV 60
E +A Y + TEP DL +E + + K + WW + G PSNYV
Sbjct: 1 EIVVAMYDFQPTEPHDLRLETGEEYVILEKNDVHWWKARDKYGKEGYIPSNYV 53
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of
Proline-Serine-Threonine Phosphatase-Interacting
Protein 1. PSTPIP1, also called CD2 Binding Protein 1
(CD2BP1), is mainly expressed in hematopoietic cells.
It is a binding partner of the cell surface receptor
CD2 and PTP-PEST, a tyrosine phosphatase which
functions in cell motility and Rac1 regulation. It also
plays a role in the activation of the Wiskott-Aldrich
syndrome protein (WASP), which couples actin
rearrangement and T cell activation. Mutations in the
gene encoding PSTPIP1 cause the autoinflammatory
disorder known as PAPA (pyogenic sterile arthritis,
pyoderma gangrenosum, and acne) syndrome. PSTPIP1
contains an N-terminal F-BAR domain, PEST motifs, and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 31.6 bits (72), Expect = 0.007
Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
Y Y Y + E +L+ ++ +V+ V +K E+ WWT + GL P Y+
Sbjct: 2 YSVLYDYTAQEDDELSISKGDVVAVIEKGEDGWWTVERNGQKGLVPGTYL 51
>gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3
domain of Vinexin, also called Sorbin and SH3 domain
containing 3 (Sorbs3). Vinexin is also called Sorbs3,
SH3P3, and SH3-containing adapter molecule 1 (SCAM-1).
It is an adaptor protein containing one sorbin homology
(SoHo) and three SH3 domains. Vinexin was first
identified as a vinculin binding protein; it is
co-localized with vinculin at cell-ECM and cell-cell
adhesion sites. There are several splice variants of
vinexin: alpha, which contains the SoHo and three SH3
domains and displays tissue-specific expression; and
beta, which contains only the three SH3 domains and is
widely expressed. Vinexin alpha stimulates the
accumulation of F-actin at focal contact sites. Vinexin
also promotes keratinocyte migration and wound healing.
The SH3 domains of vinexin have been reported to bind a
number of ligands including vinculin, WAVE2, DLG5, Abl,
and Cbl. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 58
Score = 31.9 bits (72), Expect = 0.008
Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRT---GLFPSNYVVP 62
Y A Y Y +L + + + V ++ +D W + RT G FP NYV P
Sbjct: 4 YKAVYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAP 57
>gnl|CDD|212840 cd11907, SH3_TXK, Src Homology 3 domain of TXK, also called
Resting lymphocyte kinase (Rlk). TXK is a cytoplasmic
(or nonreceptor) tyr kinase containing Src homology
protein interaction domains (SH3, SH2) N-terminal to
the catalytic tyr kinase domain. It also contains an
N-terminal cysteine-rich region. Rlk is expressed in
T-cells and mast cell lines, and is a key component of
T-cell receptor (TCR) signaling. It is important in
TCR-stimulated proliferation, IL-2 production and
phospholipase C-gamma1 activation. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 55
Score = 31.5 bits (71), Expect = 0.008
Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 6/52 (11%)
Query: 13 IAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGDR---TGLFPSNYV 60
A Y + EP +L + +E + + + + WW DR GL PSNYV
Sbjct: 4 KALYDFLPREPSNLALKRAEEYLILEQYDPHWWKAR--DRYGNEGLIPSNYV 53
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth
factor receptor-bound protein 2. GRB2 is a critical
signaling molecule that regulates the Ras pathway by
linking tyrosine kinases to the Ras guanine nucleotide
releasing protein Sos (son of sevenless), which
converts Ras to the active GTP-bound state. It is
ubiquitously expressed in all tissues throughout
development and is important in cell cycle progression,
motility, morphogenesis, and angiogenesis. In
lymphocytes, GRB2 is associated with antigen receptor
signaling components. GRB2 contains an N-terminal SH3
domain, a central SH2 domain, and a C-terminal SH3
domain. Its N-terminal SH3 domain binds to Sos and
Sos-derived proline-rich peptides. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 31.5 bits (71), Expect = 0.009
Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTIGDRTGLFPSNYV 60
IA Y + +T +L+F + +++ V +E D W+ + + G P NY+
Sbjct: 4 IAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYI 53
>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3
domain-containing proteins 1 and 2. RUSC1 and RUSC2,
that were originally characterized in silico. They are
adaptor proteins consisting of RUN, leucine zipper, and
SH3 domains. RUSC1, also called NESCA (New molecule
containing SH3 at the carboxy-terminus), is highly
expressed in the brain and is translocated to the
nuclear membrane from the cytoplasm upon stimulation
with neurotrophin. It plays a role in facilitating
neurotrophin-dependent neurite outgrowth. It also
interacts with NEMO (or IKKgamma) and may function in
NEMO-mediated activation of NF-kB. RUSC2, also called
Iporin, is expressed ubiquitously with highest amounts
in the brain and testis. It interacts with the small
GTPase Rab1 and the Golgi matrix protein GM130, and may
function in linking GTPases to certain intracellular
signaling pathways. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 50
Score = 31.3 bits (71), Expect = 0.009
Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
Query: 21 TEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNY 59
T+ G L+F + +++ V + ++DW T G GL P +Y
Sbjct: 11 TDSGQLSFRKGDILRVIARVDDDWLLCTRGSTKGLVPLSY 50
>gnl|CDD|212782 cd11848, SH3_SLAP-like, Src homology 3 domain of Src-Like Adaptor
Proteins. SLAPs are adaptor proteins with limited
similarity to Src family tyrosine kinases. They contain
an N-terminal SH3 domain followed by an SH2 domain, and
a unique C-terminal sequence. They function in
regulating the signaling, ubiquitination, and
trafficking of T-cell receptor (TCR) and B-cell
receptor (BCR) components. Vertebrates contain two
SLAPs, named SLAP (or SLA1) and SLAP2 (or SLA2). SLAP
has been shown to interact with the EphA receptor,
EpoR, Lck, PDGFR, Syk, CD79a, among others, while SLAP2
interacts with CSF1R. Both SLAPs interact with c-Cbl,
LAT, CD247, and Zap70. SLAP modulates TCR surface
expression levels as well as surface and total BCR
levels. As an adaptor to c-Cbl, SLAP increases the
ubiquitination, intracellular retention, and targeted
degradation of the BCR complex components. SLAP2 plays
a role in c-Cbl-dependent regulation of CSF1R, a
tyrosine kinase important for myeloid cell growth and
differentiation. The SH3 domain of SLAP forms a complex
with v-Abl. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 31.4 bits (71), Expect = 0.010
Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWT--GTIGDRTGLFPSNYV 60
+A Y S P +L+ E + + E DWW + R PS +V
Sbjct: 3 VALGDYPSGGPAELSLRLGEPLTIVSDEGDWWKVLSEVTGRESYIPSVHV 52
>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of
ASPP protein (iASPP). iASPP, also called
RelA-associated inhibitor (RAI), is an oncoprotein that
inhibits the apoptotic transactivation potential of
p53. It is upregulated in human breast cancers
expressing wild-type p53, in acute leukemias regardless
of the p53 mutation status, as well as in ovarian
cancer where it is associated with poor patient outcome
and chemoresistance. iASPP is also a binding partner
and negative regulator of p65RelA, which promotes cell
proliferation and inhibits apoptosis; p65RelA has the
opposite effect on cell growth compared to the p53
family. It contains a proline-rich region, four ankyrin
(ANK) repeats, and an SH3 domain at its C-terminal
half. The SH3 domain and the ANK repeats of iASPP
contribute to the p53 binding site; they bind to the
DNA binding domain of p53. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 56
Score = 31.4 bits (71), Expect = 0.010
Identities = 15/49 (30%), Positives = 26/49 (53%), Gaps = 3/49 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK---ENDWWTGTIGDRTGLFPSNY 59
A + Y + P +L+F + +++ V +K DWW ++ R G P NY
Sbjct: 5 ALWDYSAEFPDELSFKEGDMVTVLRKDGEGTDWWWASLCGREGYVPRNY 53
>gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3
domain of the p47phox subunit of NADPH oxidase, also
called Neutrophil Cytosolic Factor 1. p47phox, or
NCF1, is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox), which
plays a key role in the ability of phagocytes to defend
against bacterial infections. NADPH oxidase catalyzes
the transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p47phox is required for activation of NADH
oxidase and plays a role in translocation. It contains
an N-terminal Phox homology (PX) domain, tandem SH3
domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
region, and a C-terminal proline-rich region (PRR).
This model characterizes the second SH3 domain (or
C-SH3) of p47phox. In its inactive state, the tandem
SH3 domains interact intramolecularly with the
autoinhibitory region; upon activation, the tandem SH3
domains are exposed through a conformational change,
resulting in their binding to the PRR of p22phox and
the activation of NADPH oxidase. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 31.3 bits (71), Expect = 0.010
Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
YI Y + E +LT + E I V K D WW G+ TG FPS Y+
Sbjct: 2 YITIKAYTAVEEDELTLLEGEAIEVIHKLLDGWWVVRKGEVTGYFPSMYL 51
>gnl|CDD|213001 cd12068, SH3_MYO15B, Src Homology 3 domain of Myosin XVb. Myosin
XVb, also called KIAA1783, was named based on its
similarity with myosin XVa. It is a transcribed and
unprocessed pseudogene whose predicted amino acid
sequence contains mutated or deleted amino acid
residues that are normally conserved and important for
myosin function. The related myosin XVa is important
for normal growth of mechanosensory stereocilia of
inner ear hair cells. Myosin XVa contains a unique
N-terminal extension followed by a motor domain, light
chain-binding IQ motifs, and a tail consisting of a
pair of MyTH4-FERM tandems separated by a SH3 domain,
and a PDZ domain. SH3 domains bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs; they play a role in the
regulation of enzymes by intramolecular interactions,
changing the subcellular localization of signal pathway
components and mediate multiprotein complex assemblies.
Length = 55
Score = 31.4 bits (71), Expect = 0.010
Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIY---VTKKENDWWTGTIGDRTGLFPSNYVVP 62
Y +A Y + + L+F++ ++I + E W G+ G R+GLFP++ V P
Sbjct: 1 YVVALRSYITDDKSLLSFHRGDLIKLLPMAGLEPGWQFGSTGGRSGLFPADIVQP 55
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated
guanine nucleotide Exchange Factor. ASEF, also called
ARHGEF4, exists in an autoinhibited form and is
activated upon binding of the tumor suppressor APC
(adenomatous polyposis coli). GEFs activate small
GTPases by exchanging bound GDP for free GTP. ASEF can
activate Rac1 or Cdc42. Truncated ASEF, which is found
in colorectal cancers, is constitutively active and has
been shown to promote angiogenesis and cancer cell
migration. ASEF contains a SH3 domain followed by
RhoGEF (also called Dbl-homologous or DH) and
Pleckstrin Homology (PH) domains. In its autoinhibited
form, the SH3 domain of ASEF forms an extensive
interface with the DH and PH domains, blocking the Rac
binding site. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 73
Score = 31.5 bits (71), Expect = 0.012
Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGDRTGLFPSNYV 60
A + + + + +L F +VI V N +WW G + D G FP+++V
Sbjct: 22 ALWDHVTMDDQELGFKAGDVIEVMDATNKEWWWGRVLDSEGWFPASFV 69
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of
GRB2-related adaptor protein 2. GRAP2 is also called
GADS (GRB2-related adapter downstream of Shc), GrpL,
GRB2L, Mona, or GRID (Grb2-related protein with insert
domain). It is expressed specifically in the
hematopoietic system. It plays an important role in T
cell receptor (TCR) signaling by promoting the
formation of the SLP-76:LAT complex, which couples the
TCR to the Ras pathway. It also have roles in
antigen-receptor and tyrosine kinase mediated
signaling. GRAP2 is unique from other GRB2-like adaptor
proteins in that it can be regulated by caspase
cleavage. It contains an N-terminal SH3 domain, a
central SH2 domain, and a C-terminal SH3 domain. The
N-terminal SH3 domain of the related protein GRB2 binds
to Sos and Sos-derived proline-rich peptides. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 52
Score = 30.9 bits (70), Expect = 0.013
Identities = 8/47 (17%), Positives = 23/47 (48%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
+ + ++ +L+F + +V+ + ++ W+ + G P N+V
Sbjct: 4 GKFDFTASGEDELSFKKGDVLKILSSDDIWFKAELNGEEGYVPKNFV 50
>gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding
Protein 1-Like. FormiN Binding Protein 1-Like
(FNBP1L), also known as Toca-1 (Transducer of
Cdc42-dependent actin assembly), forms a complex with
neural Wiskott-Aldrich syndrome protein (N-WASP). The
FNBP1L/N-WASP complex induces the formation of
filopodia and endocytic vesicles. FNBP1L is required
for Cdc42-induced actin assembly and is essential for
autophagy of intracellular pathogens. It contains an
N-terminal F-BAR domain, a central Cdc42-binding HR1
domain, and a C-terminal SH3 domain. The SH3 domain of
the related protein, CIP4, associates with Gapex-5, a
Rab31 GEF. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 30.7 bits (69), Expect = 0.017
Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGTIGD--RTGLFPSNYV 60
A YP+D + G L + EV+Y+ +++ D WT G P++Y+
Sbjct: 5 ALYPFDGSNEGTLAMKEGEVLYIIEEDKGDGWTRARKQNGEEGYVPTSYI 54
>gnl|CDD|212825 cd11892, SH3_MIA2, Src Homology 3 domain of Melanoma Inhibitory
Activity 2 protein. MIA2 is expressed specifically in
hepatocytes and its expression is controlled by
hepatocyte nuclear factor 1 binding sites in the MIA2
promoter. It inhibits the growth and invasion of
hepatocellular carcinomas (HCC) and may act as a tumor
suppressor. A mutation in MIA2 in mice resulted in
reduced cholesterol and triglycerides. Since MIA2
localizes to ER exit sites, it may function as an
ER-to-Golgi trafficking protein that regulates lipid
metabolism. MIA2 contains an N-terminal SH3-like
domain, similar to MIA. It is a member of the recently
identified family that also includes MIA, MIAL, and
MIA3 (also called TANGO). MIA is a single domain
protein that adopts a SH3 domain-like fold; it contains
an additional antiparallel beta sheet and two disulfide
bonds compared to classical SH3 domains. Unlike
classical SH3 domains, MIA does not bind proline-rich
ligands.
Length = 73
Score = 31.0 bits (70), Expect = 0.017
Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 4/39 (10%)
Query: 26 LTFNQDEVIYV----TKKENDWWTGTIGDRTGLFPSNYV 60
L+F + + I V + K D W G+ G G FP + V
Sbjct: 28 LSFKKGDEIIVYYKLSGKREDLWAGSTGKEFGYFPKDAV 66
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C
and Casein kinase Substrate in Neurons 1 (PACSIN1) and
PACSIN 2. PACSIN 1 or Syndapin I (Synaptic
dynamin-associated protein I) is expressed specifically
in the brain and is localized in neurites and synaptic
boutons. It binds the brain-specific proteins dynamin
I, synaptojanin, synapsin I, and neural Wiskott-Aldrich
syndrome protein (nWASP), and functions as a link
between the cytoskeletal machinery and synaptic vesicle
endocytosis. PACSIN 1 interacts with huntingtin and may
be implicated in the neuropathology of Huntington's
disease. PACSIN 2 or Syndapin II is expressed
ubiquitously and is involved in the regulation of
tubulin polymerization. It associates with Golgi
membranes and forms a complex with dynamin II which is
crucial in promoting vesicle formation from the
trans-Golgi network. PACSINs act as regulators of
cytoskeletal and membrane dynamics. Vetebrates harbor
three isoforms with distinct expression patterns and
specific functions. PACSINs contain an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 30.7 bits (69), Expect = 0.018
Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTI-GDRTGLFPSNYVVP 62
A Y YD E +L+F + + + E++ W G + + GL+P+NYV P
Sbjct: 5 ALYDYDGQEQDELSFKAGDELTKLEDEDEQGWCKGRLDSGQVGLYPANYVEP 56
>gnl|CDD|212944 cd12011, SH3_SLAP2, Src homology 3 domain of Src-Like Adaptor
Protein 2. SLAP2 plays a role in c-Cbl-dependent
regulation of CSF1R, a tyrosine kinase important for
myeloid cell growth and differentiation. It has been
shown to interact with CSF1R, c-Cbl, LAT, CD247, and
Zap70. SLAPs are adaptor proteins with limited
similarity to Src family tyrosine kinases. They contain
an N-terminal SH3 domain followed by an SH2 domain, and
a unique C-terminal sequence. They function in
regulating the signaling, ubiquitination, and
trafficking of T-cell receptor (TCR) and B-cell
receptor (BCR) components. The SH3 domain of SLAP forms
a complex with v-Abl. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 30.5 bits (69), Expect = 0.020
Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 2/50 (4%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWT--GTIGDRTGLFPSNYV 60
+A + S P +L+ E + + ++ DWW + R PSNYV
Sbjct: 3 VALCNFPSGGPTELSIRMGEQLTILSEDGDWWKVSSAVTGRECYIPSNYV 52
>gnl|CDD|212708 cd11774, SH3_Sla1p_2, Second Src Homology 3 domain of the fungal
endocytic adaptor protein Sla1p. Sla1p facilitates
endocytosis by playing a role as an adaptor protein in
coupling components of the actin cytoskeleton to the
endocytic machinery. It interacts with Abp1p, Las17p
and Pan1p, which are activator proteins of
actin-related protein 2/3 (Arp2/3). Sla1p contains
multiple domains including three SH3 domains, a SAM
(sterile alpha motif) domain, and a Sla1 homology
domain 1 (SHD1), which binds to the NPFXD motif that is
found in many integral membrane proteins such as the
Golgi-localized Arf-binding protein Lsb5p and the
P4-ATPases, Drs2p and Dnf1p. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 30.5 bits (69), Expect = 0.022
Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKENDWWT--GTIGDRTGLFPSNYV 60
A Y YD +L+FN+ + + V + W G G + G P+NY+
Sbjct: 4 ALYDYDKQTEEELSFNEGDTLDVYDDSDSDWILVGFNGTQFGFVPANYI 52
>gnl|CDD|212826 cd11893, SH3_MIA3, Src Homology 3 domain of Melanoma Inhibitory
Activity 3 protein. MIA3, also called TANGO or TANGO1,
acts as a tumor suppressor of malignant melanoma. It is
downregulated or lost in melanoma cells lines. Unlike
other MIA family members, MIA3 is widely expressed
except in hematopoietic cells. MIA3 is an ER resident
transmembrane protein that is required for the loading
of collagen VII into transport vesicles. SNPs in the
MIA3 gene have been associated with coronary arterial
disease and myocardial infarction. MIA3 contains an
N-terminal SH3-like domain, similar to MIA. It is a
member of the recently identified family that also
includes MIA, MIAL, and MIA2. MIA is a single domain
protein that adopts a SH3 domain-like fold; it contains
an additional antiparallel beta sheet and two disulfide
bonds compared to classical SH3 domains. Unlike
classical SH3 domains, MIA does not bind proline-rich
ligands.
Length = 73
Score = 30.6 bits (69), Expect = 0.027
Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 4/39 (10%)
Query: 26 LTFNQDEVIYVTKK----ENDWWTGTIGDRTGLFPSNYV 60
L+F + E IYV K D W G++G G FP + +
Sbjct: 28 LSFKKGETIYVYYKLSGRRTDLWAGSVGFDFGYFPKDLL 66
>gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator
Associated with Focal adhesion kinase. GRAF, also
called Rho GTPase activating protein 26 (ARHGAP26),
Oligophrenin-1-like (OPHN1L) or GRAF1, is a GAP with
activity towards RhoA and Cdc42 and is only weakly
active towards Rac1. It influences Rho-mediated
cytoskeletal rearrangements and binds focal adhesion
kinase (FAK), which is a critical component of integrin
signaling. It is essential for the major
clathrin-independent endocytic pathway mediated by
pleiomorphic membranes. GRAF contains an N-terminal BAR
domain, followed by a Pleckstrin homology (PH) domain,
a Rho GAP domain, and a C-terminal SH3 domain. The SH3
domain of GRAF binds PKNbeta, a target of the small
GTPase Rho. SH3 domains bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs; they play a role in the regulation of
enzymes by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 56
Score = 30.1 bits (67), Expect = 0.035
Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%)
Query: 14 AAYPYDSTEPGDLTFNQDEVI--YVTKKENDWWTGTIGDRTGLFPSNYV 60
A Y + +L+F V +E W GT+ +TGL P NYV
Sbjct: 5 ALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYV 53
>gnl|CDD|212878 cd11945, SH3_Endophilin_B1, Src homology 3 domain of
Endophilin-B1. Endophilin-B1, also called
Bax-interacting factor 1 (Bif-1) or SH3GLB1 (SH3-domain
GRB2-like endophilin B1), is localized mainly to the
Golgi apparatus. It is involved in the regulation of
many biological events including autophagy,
tumorigenesis, nerve growth factor (NGF) trafficking,
neurite outgrowth, mitochondrial outer membrane
dynamics, and cell death. Endophilins play roles in
synaptic vesicle formation, virus budding,
mitochondrial morphology maintenance, receptor-mediated
endocytosis inhibition, and endosomal sorting. They
contain an N-terminal N-BAR domain (BAR domain with an
additional N-terminal amphipathic helix), followed by a
variable region containing proline clusters, and a
C-terminal SH3 domain. Endophilin-B1 forms homo- and
heterodimers (with endophilin-B2) through its BAR
domain. It interacts with amphiphysin 1 and dynamin 1
through its SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 61
Score = 30.0 bits (67), Expect = 0.035
Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTK---KENDWWTGTIGDRTGLFPSNYV 60
Y YD+ +L+ DEVI V ++DW G G++ G P Y+
Sbjct: 10 YDYDAANSTELSLLADEVITVYSVPGMDSDWLMGERGNQKGKVPITYL 57
>gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine
kinase substrate (Tks) proteins. Tks proteins are Src
substrates and scaffolding proteins that play important
roles in the formation of podosomes and invadopodia,
the dynamic actin-rich structures that are related to
cell migration and cancer cell invasion. Vertebrates
contain two Tks proteins, Tks4 (Tyr kinase substrate
with four SH3 domains) and Tks5 (Tyr kinase substrate
with five SH3 domains), which display partially
overlapping but non-redundant functions. Both associate
with the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. Tks5
interacts with N-WASP and Nck, while Tks4 is essential
for the localization of MT1-MMP (membrane-type 1 matrix
metalloproteinase) to invadopodia. Tks proteins contain
an N-terminal Phox homology (PX) domain and four or
five SH3 domains. This model characterizes the first
SH3 domain of Tks proteins. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 29.7 bits (67), Expect = 0.043
Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYVVP 62
Y+ Y +P +++ +V+ V +K EN WW ++ D G P+ Y+ P
Sbjct: 2 YVVVADYKKQQPNEISLRAGDVVDVIEKNENGWWFVSLEDEQGWVPATYLEP 53
>gnl|CDD|212699 cd11765, SH3_Nck_1, First Src Homology 3 domain of Nck adaptor
proteins. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2 (also called Nckbeta or
Growth factor receptor-bound protein 4, Grb4), which
show partly overlapping functions but also bind
distinct targets. Their SH3 domains are involved in
recruiting downstream effector molecules, such as the
N-WASP/Arp2/3 complex, which when activated induces
actin polymerization that results in the production of
pedestals, or protrusions of the plasma membrane. The
first SH3 domain of Nck proteins preferentially binds
the PxxDY sequence, which is present in the CD3e
cytoplasmic tail. This binding inhibits phosphorylation
by Src kinases, resulting in the downregulation of TCR
surface expression. SH3 domains are protein interaction
domains that usually bind to proline-rich ligands with
moderate affinity and selectivity, preferentially a
PxxP motif. They play versatile and diverse roles in
the cell including the regulation of enzymes, changing
the subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 51
Score = 29.7 bits (67), Expect = 0.043
Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW-TGTIGDRTGLFPSNYV 60
Y +A Y Y + +L+ ++E + + WW ++TG PSNYV
Sbjct: 1 YVVAKYDYTAQGDQELSIKKNEKLTLLDDSKHWWKVQNSSNQTGYVPSNYV 51
>gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine
kinase substrate (Tks) proteins. Tks proteins are Src
substrates and scaffolding proteins that play important
roles in the formation of podosomes and invadopodia,
the dynamic actin-rich structures that are related to
cell migration and cancer cell invasion. Vertebrates
contain two Tks proteins, Tks4 (Tyr kinase substrate
with four SH3 domains) and Tks5 (Tyr kinase substrate
with five SH3 domains), which display partially
overlapping but non-redundant functions. Both associate
with the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. Tks5
interacts with N-WASP and Nck, while Tks4 is essential
for the localization of MT1-MMP (membrane-type 1 matrix
metalloproteinase) to invadopodia. Tks proteins contain
an N-terminal Phox homology (PX) domain and four or
five SH3 domains. This model characterizes the third
SH3 domain of Tks proteins. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 53
Score = 29.3 bits (66), Expect = 0.050
Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 2/52 (3%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
EY+ + +T ++F + +V + K + WW I + G PS+Y+
Sbjct: 1 EYFTIG-EFQATIQDGISFQKGQKVEVIDKNPSGWWYVKIDGKEGWAPSSYI 51
>gnl|CDD|212832 cd11899, SH3_Nck2_1, First Src Homology 3 domain of Nck2 adaptor
protein. Nck2 (also called Nckbeta or Growth factor
receptor-bound protein 4, Grb4) plays a crucial role in
connecting signaling pathways of tyrosine kinase
receptors and important effectors in actin dynamics and
cytoskeletal remodeling. It binds neuronal signaling
proteins such as ephrinB and Disabled-1 (Dab-1)
exclusively. Nck adaptor proteins regulate actin
cytoskeleton dynamics by linking proline-rich effector
molecules to protein tyrosine kinases and
phosphorylated signaling intermediates. They contain
three SH3 domains and a C-terminal SH2 domain. They
function downstream of the PDGFbeta receptor and are
involved in Rho GTPase signaling and actin dynamics.
Vertebrates contain two Nck adaptor proteins: Nck1
(also called Nckalpha) and Nck2, which show partly
overlapping functions but also bind distinct targets.
The first SH3 domain of Nck2 binds the PxxDY sequence
in the CD3e cytoplasmic tail; this binding inhibits
phosphorylation by Src kinases, resulting in the
downregulation of TCR surface expression. SH3 domains
are protein interaction domains that usually bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially a PxxP motif. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 29.7 bits (66), Expect = 0.052
Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW-TGTIGDRTGLFPSNYV 60
IA + Y + + +L ++E +++ WW +RTG PSNYV
Sbjct: 7 IAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYV 55
>gnl|CDD|212839 cd11906, SH3_BTK, Src Homology 3 domain of Bruton's tyrosine
kinase. BTK is a cytoplasmic (or nonreceptor) tyr
kinase containing Src homology protein interaction
domains (SH3, SH2) N-terminal to the catalytic tyr
kinase domain. It also contains an N-terminal
pleckstrin homology (PH) domain, which binds the
products of PI3K and allows membrane recruitment and
activation, and the Tec homology (TH) domain with
proline-rich and zinc-binding regions. Btk is expressed
in B-cells, and a variety of myeloid cells including
mast cells, platelets, neutrophils, and dendrictic
cells. It interacts with a variety of partners, from
cytosolic proteins to nuclear transcription factors,
suggesting a diversity of functions. Stimulation of a
diverse array of cell surface receptors, including
antigen engagement of the B-cell receptor (BCR), leads
to PH-mediated membrane translocation of Btk and
subsequent phosphorylation by Src kinase and
activation. Btk plays an important role in the life
cycle of B-cells including their development,
differentiation, proliferation, survival, and
apoptosis. Mutations in Btk cause the primary
immunodeficiency disease, X-linked agammaglobulinaemia
(XLA) in humans. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 29.4 bits (66), Expect = 0.058
Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 2/51 (3%)
Query: 13 IAAYPYDSTEPGDLTFNQD-EVIYVTKKENDWWTGTIGD-RTGLFPSNYVV 61
+A Y Y DL + E + + + WW + R G PSNYV
Sbjct: 4 VALYDYTPMNAQDLQLRKGEEYVILEESNLPWWRARDKNGREGYIPSNYVT 54
>gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3
domain of Sorbin and SH3 domain containing 2 (Sorbs2),
also called Arg-binding protein 2 (ArgBP2). Sorbs2 or
ArgBP2 is an adaptor protein containing one sorbin
homology (SoHo) and three SH3 domains. It regulates
actin-dependent processes including cell adhesion,
morphology, and migration. It is expressed in many
tissues and is abundant in the heart. Like vinexin, it
is found in focal adhesion where it interacts with
vinculin and afadin. It also localizes in epithelial
cell stress fibers and in cardiac muscle cell Z-discs.
Sorbs2 has been implicated to play roles in the
signaling of c-Arg, Akt, and Pyk2. Other interaction
partners of Sorbs2 include c-Abl, flotillin, spectrin,
dynamin 1/2, synaptojanin, PTP-PEST, among others. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 61
Score = 29.6 bits (66), Expect = 0.064
Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRT---GLFPSNYV 60
E + A Y Y +L + +VI V +K +D W RT G FP NYV
Sbjct: 5 EPFQALYNYMPRNEDELELREGDVIDVMEKCDDGWFVGTSRRTKFFGTFPGNYV 58
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and
SH3 domain protein 1. Lasp1 is a cytoplasmic protein
that binds focal adhesion proteins and is involved in
cell signaling, migration, and proliferation. It is
overexpressed in several cancer cells including breast,
ovarian, bladder, and liver. In cancer cells, it can be
found in the nucleus; its degree of nuclear
localization correlates with tumor size and poor
prognosis. Lasp1 is a 36kD protein containing an
N-terminal LIM domain, two nebulin repeats, and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 59
Score = 29.2 bits (65), Expect = 0.066
Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
Query: 12 YIAAYPYDSTEPGDLTF-NQDEVIYVTKKENDWWTGTI---GDRTGLFPSNYV 60
Y A Y Y++ + +++F + D ++ V + ++ W GT+ GD TG+ P+NYV
Sbjct: 5 YRAVYDYNAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGD-TGMLPANYV 56
>gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting
molecules (RIMs) binding proteins. RIMs binding
proteins (RBPs, RIM-BPs) associate with calcium
channels present in photoreceptors, neurons, and hair
cells; they interact simultaneously with specific
calcium channel subunits, and active zone proteins,
RIM1 and RIM2. RIMs are part of the matrix at the
presynaptic active zone and are associated with
synaptic vesicles through their interaction with the
small GTPase Rab3. RIM-BPs play a role in regulating
synaptic transmission by serving as adaptors and
linking calcium channels with the synaptic vesicle
release machinery. RIM-BPs contain three SH3 domains
and two to three fibronectin III repeats. Invertebrates
contain one, while vertebrates contain at least two
RIM-BPs, RIM-BP1 and RIM-BP2. RIM-BP1 is also called
peripheral-type benzodiazapine receptor associated
protein 1 (PRAX-1). Mammals contain a third protein,
RIM-BP3. RIM-BP1 and RIM-BP2 are predominantly
expressed in the brain where they display overlapping
but distinct expression patterns, while RIM-BP3 is
almost exclusively expressed in the testis and is
essential in spermiogenesis. The SH3 domains of RIM-BPs
bind to the PxxP motifs of RIM1, RIM2, and L-type
(alpha1D) and N-type (alpha1B) calcium channel
subunits. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 62
Score = 28.8 bits (65), Expect = 0.095
Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 10/59 (16%)
Query: 12 YIAAYPYDSTE--PGD-----LTFNQDEVIYV--TKKENDWWTG-TIGDRTGLFPSNYV 60
+A Y Y+ P D L+F+ +V+ V E+ ++ G G R GL PSN+V
Sbjct: 2 MVALYDYNPETMSPNDDPEEELSFHAGDVVRVYGPMDEDGFYYGELEGGRKGLVPSNFV 60
>gnl|CDD|212833 cd11900, SH3_Nck1_1, First Src Homology 3 domain of Nck1 adaptor
protein. Nck1 (also called Nckalpha) plays a crucial
role in connecting signaling pathways of tyrosine
kinase receptors and important effectors in actin
dynamics and cytoskeletal remodeling. It binds and
activates RasGAP, resulting in the downregulation of
Ras. It is also involved in the signaling of
endothilin-mediated inhibition of cell migration. Nck
adaptor proteins regulate actin cytoskeleton dynamics
by linking proline-rich effector molecules to protein
tyrosine kinases and phosphorylated signaling
intermediates. They contain three SH3 domains and a
C-terminal SH2 domain. They function downstream of the
PDGFbeta receptor and are involved in Rho GTPase
signaling and actin dynamics. Vertebrates contain two
Nck adaptor proteins: Nck1 (also called Nckalpha) and
Nck2, which show partly overlapping functions but also
bind distinct targets. The first SH3 domain of Nck1
binds the PxxDY sequence in the CD3e cytoplasmic tail;
this binding inhibits phosphorylation by Src kinases,
resulting in the downregulation of TCR surface
expression. SH3 domains are protein interaction domains
that usually bind to proline-rich ligands with moderate
affinity and selectivity, preferentially a PxxP motif.
They play versatile and diverse roles in the cell
including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 59
Score = 28.9 bits (64), Expect = 0.10
Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW-TGTIGDRTGLFPSNYV 60
+A + Y + + +L ++E +++ WW ++TG PSNYV
Sbjct: 6 VAKFDYVAQQDQELDIKKNERLWLLDDSKSWWRVRNAMNKTGFVPSNYV 54
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of
Nebulin. Nebulin is a giant filamentous protein
(600-900 kD) that is expressed abundantly in skeletal
muscle. It binds to actin thin filaments and regulates
its assembly and function. Nebulin was thought to be
part of a molecular ruler complex that is critical in
determining the lengths of actin thin filaments in
skeletal muscle since its length, which varies due to
alternative splicing, correlates with the length of
thin filaments in various muscle types. Recent studies
indicate that nebulin regulates thin filament length by
stabilizing the filaments and preventing
depolymerization. Mutations in nebulin can cause
nemaline myopathy, characterized by muscle weakness
which can be severe and can lead to neonatal lethality.
Nebulin contains an N-terminal LIM domain, many nebulin
repeats/super repeats, and a C-terminal SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 58
Score = 28.8 bits (64), Expect = 0.10
Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTI--GDRTGLFPSNYV 60
A Y Y + + +++F D ++ V + W GT+ +TG+ P+NYV
Sbjct: 6 AMYDYRAADDDEVSFKDGDTIVNVQTIDEGWMYGTVQRTGKTGMLPANYV 55
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain
of NADPH oxidase (Nox) Organizing protein 1. Nox
Organizing protein 1 (NoxO1) is a critical regulator of
enzyme kinetics of the nonphagocytic NADPH oxidase
Nox1, which catalyzes the transfer of electrons from
NADPH to molecular oxygen to form superoxide. Nox1 is
expressed in colon, stomach, uterus, prostate, and
vascular smooth muscle cells. NoxO1 is involved in
targeting activator subunits (such as NoxA1) to Nox1.
It is co-localized with Nox1 in the membranes of
resting cells and directs the subcellular localization
of Nox1. NoxO1 contains an N-terminal Phox homology
(PX) domain, tandem SH3 domains (N-SH3 and C-SH3), and
a C-terminal proline-rich region (PRR). This model
characterizes the second SH3 domain (or C-SH3) of
NoxO1. The tandem SH3 domains of NoxO1 interact with
the PRR of p22phox, which also complexes with Nox1. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 53
Score = 28.5 bits (64), Expect = 0.10
Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYVVP 62
Y A Y++ + +L+ V+ V +K ++ WW R G PS Y+ P
Sbjct: 2 YYATRAYEAQKEDELSVPAGVVVEVLQKSDNGWWLIRYNGRAGYVPSMYLQP 53
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C
and Casein kinase Substrate in Neurons 3 (PACSIN3).
PACSIN 3 or Syndapin III (Synaptic dynamin-associated
protein III) is expressed ubiquitously and regulates
glucose uptake in adipocytes through its role in GLUT1
trafficking. It also modulates the subcellular
localization and stimulus-specific function of the
cation channel TRPV4. PACSINs act as regulators of
cytoskeletal and membrane dynamics. Vetebrates harbor
three isoforms with distinct expression patterns and
specific functions. PACSINs contain an N-terminal F-BAR
domain and a C-terminal SH3 domain. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 28.8 bits (64), Expect = 0.11
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEND--WWTGTI-GDRTGLFPSNYV 60
A Y Y E +L+F E + +E++ W G + R GL+P+NYV
Sbjct: 6 ALYDYTGQEADELSFKAGEELLKIGEEDEQGWCKGRLLSGRIGLYPANYV 55
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of
Rab3-interacting molecules (RIMs) binding proteins.
RIMs binding proteins (RBPs, RIM-BPs) associate with
calcium channels present in photoreceptors, neurons,
and hair cells; they interact simultaneously with
specific calcium channel subunits, and active zone
proteins, RIM1 and RIM2. RIMs are part of the matrix at
the presynaptic active zone and are associated with
synaptic vesicles through their interaction with the
small GTPase Rab3. RIM-BPs play a role in regulating
synaptic transmission by serving as adaptors and
linking calcium channels with the synaptic vesicle
release machinery. RIM-BPs contain three SH3 domains
and two to three fibronectin III repeats. Invertebrates
contain one, while vertebrates contain at least two
RIM-BPs, RIM-BP1 and RIM-BP2. RIM-BP1 is also called
peripheral-type benzodiazapine receptor associated
protein 1 (PRAX-1). Mammals contain a third protein,
RIM-BP3. RIM-BP1 and RIM-BP2 are predominantly
expressed in the brain where they display overlapping
but distinct expression patterns, while RIM-BP3 is
almost exclusively expressed in the testis and is
essential in spermiogenesis. The SH3 domains of RIM-BPs
bind to the PxxP motifs of RIM1, RIM2, and L-type
(alpha1D) and N-type (alpha1B) calcium channel
subunits. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 62
Score = 28.4 bits (64), Expect = 0.14
Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 10/61 (16%)
Query: 11 YYIAAYPYD--STEPGD------LTFNQDEVIYV--TKKENDWWTGTIGDRTGLFPSNYV 60
++A + YD + P L F + ++I V K + ++ G I R GL P N V
Sbjct: 1 LFVALFDYDPLTMSPNPDAAEEELPFKEGQLIKVYGDKDADGFYLGEINGRRGLVPCNMV 60
Query: 61 V 61
Sbjct: 61 S 61
>gnl|CDD|212797 cd11863, SH3_CACNB, Src Homology 3 domain of Voltage-dependent
L-type calcium channel subunit beta. Voltage-dependent
calcium channels (Ca(V)s) are multi-protein complexes
that regulate the entry of calcium into cells. They
impact muscle contraction, neuronal migration, hormone
and neurotransmitter release, and the activation of
calcium-dependent signaling pathways. They are composed
of four subunits: alpha1, alpha2delta, beta, and gamma.
The beta subunit is a soluble and intracellular protein
that interacts with the transmembrane alpha1 subunit.
It facilitates the trafficking and proper localization
of the alpha1 subunit to the cellular plasma membrane.
Vertebrates contain four different beta subunits from
distinct genes (beta1-4); each exists as multiple
splice variants. All are expressed in the brain while
other tissues show more specific expression patterns.
The beta subunits show similarity to MAGUK
(membrane-associated guanylate kinase) proteins in that
they contain SH3 and inactive guanylate kinase (GuK)
domains; however, they do not appear to contain a PDZ
domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 62
Score = 28.4 bits (64), Expect = 0.14
Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
Query: 12 YIAAYPYDSTEPG-DLTFNQDEVIYVTKK-ENDWWTGTI---GDRTGLFPS 57
Y + DS PG ++F + +++ +K NDWW G + G G PS
Sbjct: 9 YDGSLDDDSPVPGYAVSFEAKDFLHIKEKYNNDWWIGRLVKEGCDIGFIPS 59
>gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3
domain of the p67phox subunit of NADPH oxidase.
p67phox, also called Neutrophil cytosol factor 2
(NCF-2), is a cytosolic subunit of the phagocytic NADPH
oxidase complex (also called Nox2 or gp91phox) which
plays a crucial role in the cellular response to
bacterial infection. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p67phox plays a regulatory role and contains
N-terminal TPR, first SH3 (or N-terminal or central
SH3), PB1, and C-terminal SH3 domains. It binds, via
its C-terminal SH3 domain, to a proline-rich region of
p47phox and upon activation, this complex assembles
with flavocytochrome b558, the Nox2-p22phox
heterodimer. Concurrently, RacGTP translocates to the
membrane and interacts with the TPR domain of p67phox,
which leads to the activation of NADPH oxidase. The PB1
domain of p67phox binds to its partner PB1 domain in
p40phox, and this facilitates the assembly of
p47phox-p67phox at the membrane. The N-terminal SH3
domain increases the affinity of p67phox for the
oxidase complex. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 28.3 bits (63), Expect = 0.15
Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%)
Query: 33 VIYVTKKEND-WWTGTIGDRTGLFPSNYVVP 62
+++V KK D W T + GL P N++ P
Sbjct: 23 IVFVLKKGTDNWATVVFNGKKGLVPCNFLEP 53
>gnl|CDD|212973 cd12040, SH3_CACNB2, Src Homology 3 domain of Voltage-dependent
L-type calcium channel subunit beta2. The beta2
subunit of voltage-dependent calcium channels (Ca(V)s)
is one of four beta subunits present in vertebrates. It
is expressed in the heart and is present in specific
neuronal cells including cerebellar Purkinje cells,
hippocampal pyramidal neurons, and photoreceptors.
Knockout of the beta2 gene in mice results in embryonic
lethality, demonstrating its importance in development.
Ca(V)s are multi-protein complexes that regulate the
entry of calcium into cells. They impact muscle
contraction, neuronal migration, hormone and
neurotransmitter release, and the activation of
calcium-dependent signaling pathways. They are composed
of four subunits: alpha1, alpha2delta, beta, and gamma.
The beta subunit is a soluble and intracellular protein
that interacts with the transmembrane alpha1 subunit.
It facilitates the trafficking and proper localization
of the alpha1 subunit to the cellular plasma membrane.
Vertebrates contain four different beta subunits from
distinct genes (beta1-4); each exists as multiple
splice variants. All are expressed in the brain while
other tissues show more specific expression patterns.
The beta subunits show similarity to MAGUK
(membrane-associated guanylate kinase) proteins in that
they contain SH3 and inactive guanylate kinase (GuK)
domains; however, they do not appear to contain a PDZ
domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 69
Score = 28.5 bits (63), Expect = 0.15
Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%)
Query: 12 YIAAYPYDSTEPGD-LTFNQDEVIYVTKK-ENDWWTGTI---GDRTGLFPS 57
Y AA+ D PG ++F + ++V +K NDWW G + G G PS
Sbjct: 14 YSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPS 64
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding
protein Eve-1. Eve-1, also called SH3
domain-containing protein 19 (SH3D19) or EEN-binding
protein (EBP), exists in multiple alternatively spliced
isoforms. The longest isoform contains five SH3 domain
in the C-terminal region and seven proline-rich motifs
in the N-terminal region. It is abundantly expressed in
skeletal muscle and heart, and may be involved in
regulating the activity of ADAMs (A disintegrin and
metalloproteases). Eve-1 interacts with EEN, an
endophilin involved in endocytosis and may be the
target of the MLL-EEN fusion protein that is implicated
in leukemogenesis. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 50
Score = 28.2 bits (63), Expect = 0.15
Identities = 9/40 (22%), Positives = 21/40 (52%), Gaps = 6/40 (15%)
Query: 20 STEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNY 59
S + GD+ + + + +W +G + ++G+FP N+
Sbjct: 17 SFKAGDIITELESI------DEEWMSGELRGKSGIFPKNF 50
>gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of
Ubiquitin-associated and SH3 domain-containing
proteins, also called TULA (T cell Ubiquitin LigAnd)
family of proteins. UBASH3 or TULA proteins are also
referred to as Suppressor of T cell receptor Signaling
(STS) proteins. They contain an N-terminal UBA domain,
a central SH3 domain, and a C-terminal histidine
phosphatase domain. They bind c-Cbl through the SH3
domain and to ubiquitin via UBA. In some vertebrates,
there are two TULA family proteins, called UBASH3A
(also called TULA or STS-2) and UBASH3B (also called
TULA-2 or STS-1), which show partly overlapping as well
as distinct functions. UBASH3B is widely expressed
while UBASH3A is only found in lymphoid cells. UBASH3A
facilitates apoptosis induced in T cells through its
interaction with the apoptosis-inducing factor AIF.
UBASH3B is an active phosphatase while UBASH3A is not.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 59
Score = 28.4 bits (64), Expect = 0.16
Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 15/56 (26%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKKEND-----------WWTGTIGDRTGLFPSNYV 60
YPY E +L + IYV+ +E D W TG +GL P NY
Sbjct: 6 YPYTPQEEDELELVPGDYIYVSPEELDSSSDGWVEGTSWLTGC----SGLLPENYT 57
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated
Substrate) scaffolding proteins. CAS proteins function
as molecular scaffolds to regulate protein complexes
that are involved in many cellular processes including
migration, chemotaxis, apoptosis, differentiation, and
progenitor cell function. They mediate the signaling of
integrins at focal adhesions where they localize, and
thus, regulate cell invasion and survival.
Over-expression of these proteins is implicated in poor
prognosis, increased metastasis, and resistance to
chemotherapeutics in many cancers such as breast, lung,
melanoma, and glioblastoma. CAS proteins have also been
linked to the pathogenesis of inflammatory disorders,
Alzheimer's, Parkinson's, and developmental defects.
They share a common domain structure that includes an
N-terminal SH3 domain, an unstructured substrate domain
that contains many YxxP motifs, a serine-rich
four-helix bundle, and a FAT-like C-terminal domain.
Vertebrates contain four CAS proteins: BCAR1 (or
p130Cas), NEDD9 (or HEF1), EFS (or SIN), and CASS4 (or
HEPL). The SH3 domain of CAS proteins binds to diverse
partners including FAK, FRNK, Pyk2, PTP-PEST, DOCK180,
among others. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 56
Score = 28.1 bits (63), Expect = 0.16
Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 6/47 (12%)
Query: 18 YDSTE--PGDLTFNQDEVIYVTKKE----NDWWTGTIGDRTGLFPSN 58
YD+ P +L F + +++ V ++ WW ++ R G+ P N
Sbjct: 6 YDNVAESPDELAFRRGDILTVLEQNTAGLEGWWLCSLRGRQGIAPGN 52
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein
Signaling Modulator 3. SGSM3 is also called
Merlin-associated protein (MAP), RUN and SH3
domain-containing protein (RUSC3), RUN and TBC1
domain-containing protein 3 (RUTBC3), Rab
GTPase-activating protein 5 (RabGAP5), or Rab GAP-like
protein (RabGAPLP). It is expressed ubiquitously and
functions as a regulator of small G protein RAP- and
RAB-mediated neuronal signaling. It is involved in
modulating NGF-mediated neurite outgrowth and
differentiation. It also interacts with the tumor
suppressor merlin and may play a role in the
merlin-associated suppression of cell growth. SGSM3
contains TBC, SH3, and RUN domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 28.2 bits (63), Expect = 0.16
Identities = 10/44 (22%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Query: 18 YDSTEPGDLTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNYV 60
++ + +L F ++++I + ++K+ W G + G FP+ +V
Sbjct: 8 FERHDDDELGFRKNDIITIISQKDEHCWVGELNGLRGWFPAKFV 51
>gnl|CDD|212805 cd11872, SH3_DOCK_AB, Src Homology 3 domain of Class A and B
Dedicator of Cytokinesis proteins. DOCK proteins are
atypical guanine nucleotide exchange factors (GEFs)
that lack the conventional Dbl homology (DH) domain.
They are divided into four classes (A-D) based on
sequence similarity and domain architecture: class A
includes Dock1, 2 and 5; class B includes Dock3 and 4;
class C includes Dock6, 7, and 8; and class D includes
Dock9, 10 and 11. All DOCKs contain two homology
domains: the DHR-1 (Dock homology region-1), also
called CZH1 (CED-5, Dock180, and MBC-zizimin homology
1), and DHR-2 (also called CZH2 or Docker). The DHR-1
domain binds phosphatidylinositol-3,4,5-triphosphate
while DHR-2 contains the catalytic activity for Rac
and/or Cdc42. This subfamily includes only Class A and
B DOCKs, which also contain an SH3 domain at the
N-terminal region and a PxxP motif at the C-terminus.
Class A/B DOCKs are mostly specific GEFs for Rac,
except Dock4 which activates the Ras family GTPase
Rap1, probably indirectly through interaction with Rap
regulatory proteins. The SH3 domain of class A/B DOCKs
have been shown to bind Elmo, a scaffold protein that
promotes GEF activity of DOCKs by releasing DHR-2
autoinhibition by the intramolecular SH3 domain. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 56
Score = 27.9 bits (63), Expect = 0.17
Identities = 11/54 (20%), Positives = 27/54 (50%), Gaps = 3/54 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTG-TIGDRT--GLFPSNYVV 61
Y +A Y + L+ + + + ++ W+ G ++ +++ G+FP +YV
Sbjct: 1 YGVAIYNFQGDGEHQLSLQVGDTVQILEECEGWYRGFSLRNKSLKGIFPKSYVH 54
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest
Specific protein 7. GAS7 is mainly expressed in the
brain and is required for neurite outgrowth. It may
also play a role in the protection and migration of
embryonic stem cells. Treatment-related acute myeloid
leukemia (AML) has been reported resulting from
mixed-lineage leukemia (MLL)-GAS7 translocations as a
complication of primary cancer treatment. GAS7 contains
an N-terminal SH3 domain, followed by a WW domain, and
a central F-BAR domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 52
Score = 27.9 bits (62), Expect = 0.19
Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
Query: 26 LTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
L+F E+I V + + WW G G FP++YV
Sbjct: 17 LSFEAGELIRVLQAPDGGWWEGEKDGLRGWFPASYV 52
>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain
of the p47phox subunit of NADPH oxidase, also called
Neutrophil Cytosolic Factor 1. p47phox, or NCF1, is a
cytosolic subunit of the phagocytic NADPH oxidase
complex (also called Nox2 or gp91phox), which plays a
key role in the ability of phagocytes to defend against
bacterial infections. NADPH oxidase catalyzes the
transfer of electrons from NADPH to oxygen during
phagocytosis forming superoxide and reactive oxygen
species. p47phox is required for activation of NADH
oxidase and plays a role in translocation. It contains
an N-terminal Phox homology (PX) domain, tandem SH3
domains (N-SH3 and C-SH3), a polybasic/autoinhibitory
region, and a C-terminal proline-rich region (PRR).
This model characterizes the first SH3 domain (or
N-SH3) of p47phox. In its inactive state, the tandem
SH3 domains interact intramolecularly with the
autoinhibitory region; upon activation, the tandem SH3
domains are exposed through a conformational change,
resulting in their binding to the PRR of p22phox and
the activation of NADPH oxidase. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 53
Score = 28.0 bits (62), Expect = 0.20
Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
Query: 12 YIAAYPYDSTEPGDLTF-NQDEVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
Y A Y+ + ++ D V V K EN WW + + G P++Y+ P
Sbjct: 2 YRAIADYEKSSKSEMALKTGDVVEVVEKSENGWWFCQLKAKRGWVPASYLEP 53
>gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan
Peroxisomal biogenesis factor 13. PEX13 is a peroxin
and is required for protein import into the peroxisomal
matrix and membrane. It is an integral membrane protein
that is essential for the localization of PEX14 and the
import of proteins containing the peroxisome matrix
targeting signals, PTS1 and PTS2. Mutations of the
PEX13 gene in humans lead to a wide range of peroxisome
biogenesis disorders (PBDs), the most severe of which
is known as Zellweger syndrome (ZS), a severe
multisystem disorder characterized by hypotonia,
psychomotor retardation, and neuronal migration
defects. PEX13 contains two transmembrane regions and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 58
Score = 28.0 bits (63), Expect = 0.20
Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 6/54 (11%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKKE-----NDWWTGTIGD-RTGLFPSNYV 60
A Y + + +L+F + + + KE W T+ + GL P+NYV
Sbjct: 3 RAEYDFVAESEDELSFRAGDKLRLAPKELQPRVRGWLLATVDGQKIGLVPANYV 56
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS
(Crk-Associated Substrate) scaffolding protein family
member, Breast Cancer Anti-estrogen Resistance 1.
BCAR1, also called p130cas or CASS1, is the founding
member of the CAS family of scaffolding proteins and
was originally identified through its ability to
associate with Crk. The name BCAR1 was designated
because the human gene was identified in a screen for
genes that promote resistance to tamoxifen. It is
widely expressed and its deletion is lethal in mice. It
plays a role in regulating cell motility, survival,
proliferation, transformation, cancer progression, and
bacterial pathogenesis. CAS proteins function as
molecular scaffolds to regulate protein complexes that
are involved in many cellular processes. They share a
common domain structure that includes an N-terminal SH3
domain, an unstructured substrate domain that contains
many YxxP motifs, a serine-rich four-helix bundle, and
a FAT-like C-terminal domain. The SH3 domain of CAS
proteins binds to diverse partners including FAK, FRNK,
Pyk2, PTP-PEST, DOCK180, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 68
Score = 28.1 bits (62), Expect = 0.28
Identities = 12/49 (24%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKE----NDWWTGTIGDRTGLFPSN 58
A Y + P +L+F + +++ V +++ + WW ++ R G+ P N
Sbjct: 7 ALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGN 55
>gnl|CDD|212877 cd11944, SH3_Endophilin_B2, Src homology 3 domain of
Endophilin-B2. Endophilin-B2, also called SH3GLB2
(SH3-domain GRB2-like endophilin B2), is a cytoplasmic
protein that interacts with the apoptosis inducer Bax.
It is overexpressed in prostate cancer metastasis and
has been identified as a cancer antigen with potential
utility in immunotherapy. Endophilins play roles in
synaptic vesicle formation, virus budding,
mitochondrial morphology maintenance, receptor-mediated
endocytosis inhibition, and endosomal sorting. They
contain an N-terminal N-BAR domain (BAR domain with an
additional N-terminal amphipathic helix), followed by a
variable region containing proline clusters, and a
C-terminal SH3 domain. Endophilin-B2 forms homo- and
heterodimers (with endophilin-B1) through its BAR
domain. The related protein endophilin-B1 interacts
with amphiphysin 1 and dynamin 1 through its SH3
domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 27.7 bits (61), Expect = 0.28
Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTK---KENDWWTGTIGDRTGLFPSNYV 60
Y Y++ + +L DE+I V + DW G G++ G P Y+
Sbjct: 4 VLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNQKGKVPVTYL 53
>gnl|CDD|213000 cd12067, SH3_MYO15A, Src Homology 3 domain of Myosin XVa. Myosin
XVa is an unconventional myosin that is critical for
the normal growth of mechanosensory stereocilia of
inner ear hair cells. Mutations in the myosin XVa gene
are associated with nonsyndromic hearing loss. Myosin
XVa contains a unique N-terminal extension followed by
a motor domain, light chain-binding IQ motifs, and a
tail consisting of a pair of MyTH4-FERM tandems
separated by a SH3 domain, and a PDZ domain. SH3
domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 80
Score = 27.8 bits (62), Expect = 0.30
Identities = 9/20 (45%), Positives = 12/20 (60%)
Query: 43 WWTGTIGDRTGLFPSNYVVP 62
W G I R+G+FP+ V P
Sbjct: 61 WKFGAIHGRSGVFPAELVQP 80
>gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3
domain of Sorbin and SH3 domain containing 1 (Sorbs1),
also called ponsin. Sorbs1 is also called ponsin,
SH3P12, or CAP (c-Cbl associated protein). It is an
adaptor protein containing one sorbin homology (SoHo)
and three SH3 domains. It binds Cbl and plays a major
role in regulating the insulin signaling pathway by
enhancing insulin-induced phosphorylation of Cbl.
Sorbs1, like vinexin, localizes at cell-ECM and
cell-cell adhesion sites where it binds vinculin,
paxillin, and afadin. It may function in the control of
cell motility. Other interaction partners of Sorbs1
include c-Abl, Sos, flotillin, Grb4, ataxin-7, filamin
C, among others. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 59
Score = 27.6 bits (61), Expect = 0.32
Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 3/54 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRT---GLFPSNYVVP 62
Y A Y Y +L +++ V +K +D W RT G FP NYV
Sbjct: 4 YQALYSYAPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKL 57
>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis
Stimulating of p53 protein 2. ASPP2 is the full length
form of the previously-identified tumor supressor,
p53-binding protein 2 (p53BP2). ASPP2 activates the
apoptotic function of the p53 family of tumor
suppressors (p53, p63, and p73). It plays a central
role in regulating apoptosis and cell growth;
ASPP2-deficient mice show postnatal death.
Downregulated expression of ASPP2 is frequently found
in breast tumors, lung cancer, and diffuse large B-cell
lymphoma where it is correlated with a poor clinical
outcome. ASPP2 contains a proline-rich region, four
ankyrin (ANK) repeats, and an SH3 domain at its
C-terminal half. The SH3 domain and the ANK repeats of
ASPP2 contribute to the p53 binding site; they bind to
the DNA binding domain of p53. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 27.6 bits (61), Expect = 0.32
Identities = 11/49 (22%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN----DWWTGTIGDRTGLFPSN 58
A + Y+ +L+F + + + + ++E+ +WW + D+ G P N
Sbjct: 5 ALWDYEGESDDELSFKEGDCMTILRREDEDETEWWWARLNDKEGYVPRN 53
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and
SH3 domain containing 1 (Sorbs1), also called ponsin.
Sorbs1 is also called ponsin, SH3P12, or CAP (c-Cbl
associated protein). It is an adaptor protein
containing one sorbin homology (SoHo) and three SH3
domains. It binds Cbl and plays a major role in
regulating the insulin signaling pathway by enhancing
insulin-induced phosphorylation of Cbl. Sorbs1, like
vinexin, localizes at cell-ECM and cell-cell adhesion
sites where it binds vinculin, paxillin, and afadin. It
may function in the control of cell motility. Other
interaction partners of Sorbs1 include c-Abl, Sos,
flotillin, Grb4, ataxin-7, filamin C, among others. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 27.2 bits (60), Expect = 0.39
Identities = 11/48 (22%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
A + + + +L + +++Y+ K+ + +W+ G R G+FP +Y+
Sbjct: 5 AKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRSYI 52
>gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba, and similar
domains. DNMBP or Tuba is a cdc42-specific guanine
nucleotide exchange factor (GEF) that contains four
N-terminal SH3 domains, a central RhoGEF [or Dbl
homology (DH)] domain followed by a Bin/Amphiphysin/Rvs
(BAR) domain, and two C-terminal SH3 domains. It
provides a functional link between dynamin, Rho GTPase
signaling, and actin dynamics. It plays an important
role in regulating cell junction configuration. The
C-terminal SH3 domains of DNMBP bind to N-WASP and
Ena/VASP proteins, which are key regulatory proteins of
the actin cytoskeleton. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 57
Score = 27.1 bits (60), Expect = 0.45
Identities = 12/54 (22%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKKEN-----DWWTGTIGDRTGLFPSNYV 60
Y A Y + + P +L+ + ++ + + + + +WW + G PSNY+
Sbjct: 2 YYAVYTFKARSPNELSVSANQRVRILEFSDLTGNKEWWLAEANGQKGYVPSNYI 55
>gnl|CDD|212872 cd11939, SH3_ephexin1, Src homology 3 domain of the Rho guanine
nucleotide exchange factor, ephexin-1 (also called NGEF
or ARHGEF27). Ephexin-1, also called NGEF (neuronal
GEF) or ARHGEF27, activates RhoA, Tac1, and Cdc42 by
exchanging bound GDP for free GTP. It is expressed
mainly in the brain in a region associated with
movement control. It regulates the stability of
postsynaptic acetylcholine receptor (AChR) clusters and
thus, plays a critical role in the maturation and
neurotransmission of neuromuscular junctions. Ephexin-1
directly interacts with the ephrin receptor EphA4 and
their coexpression enhances the ability of ephexin-1 to
activate RhoA. It is required for normal axon growth
and EphA-induced growth cone collapse. Ephexin-1
contains RhoGEF (also called Dbl-homologous or DH),
Pleckstrin Homology (PH), and SH3 domains. The SH3
domains of ARHGEFs play an autoinhibitory role through
intramolecular interactions with a proline-rich region
N-terminal to the DH domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 26.8 bits (59), Expect = 0.51
Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 7/50 (14%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDR-----TGLFPSNYV 60
+PY S EP +L+ +V+ + K +D W G+R G FPS+ V
Sbjct: 6 HPYVSQEPDELSLELADVLNILDKTDDGW--IFGERLHDQERGWFPSSVV 53
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine
kinase substrate with four SH3 domains. Tks4, also
called SH3 and PX domain-containing protein 2B
(SH3PXD2B) or HOFI, is a Src substrate and scaffolding
protein that plays an important role in the formation
of podosomes and invadopodia, the dynamic actin-rich
structures that are related to cell migration and
cancer cell invasion. It is required in the formation
of functional podosomes, EGF-induced membrane ruffling,
and lamellipodia generation. It plays an important role
in cellular attachment and cell spreading. Tks4 is
essential for the localization of MT1-MMP
(membrane-type 1 matrix metalloproteinase) to
invadopodia. It contains an N-terminal Phox homology
(PX) domain and four SH3 domains. This model
characterizes the second SH3 domain of Tks4. SH3
domains are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 26.9 bits (59), Expect = 0.54
Identities = 13/52 (25%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDRTGLFPSNYV 60
E Y YPY + + ++ + V+ V +K WW + G P++Y+
Sbjct: 1 EKYTVIYPYTARDQDEINLEKGAVVEVIQKNLEGWWKIRYQGKEGWAPASYL 52
>gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine
nucleotide exchange factors ARHGEF5 and ARHGEF19.
ARHGEF5, also called ephexin-3 or TIM (Transforming
immortalized mammary oncogene), is a potent activator
of RhoA and it plays roles in regulating cell shape,
adhesion, and migration. It binds to the SH3 domain of
Src and is involved in regulating Src-induced podosome
formation. ARHGEF19, also called ephexin-2 or WGEF
(weak-similarity GEF), is highly expressed in the
intestine, liver, heart and kidney. It activates RhoA,
Cdc42, and Rac 1, and has been shown to activate RhoA
in the Wnt-PCP (planar cell polarity) pathway. It is
involved in the regulation of cell polarity and
cytoskeletal reorganization. ARHGEF5 and ARHGEF19
contain RhoGEF (also called Dbl-homologous or DH),
Pleckstrin Homology (PH), and SH3 domains. The SH3
domains of ARHGEFs play an autoinhibitory role through
intramolecular interactions with a proline-rich region
N-terminal to the DH domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 26.7 bits (59), Expect = 0.56
Identities = 14/46 (30%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
Query: 18 YDSTEPGDLTFNQDEVIYVTKKEND-WWTGT-IGDR-TGLFPSNYV 60
Y + E +LT + ++I V ++ +D W G + D G FP ++V
Sbjct: 8 YKAQENDELTLEKADIIMVRQQSSDGWLEGVRLSDGERGWFPQSHV 53
>gnl|CDD|212999 cd12066, SH3_GRAF3, Src Homology 3 domain of GTPase Regulator
Associated with Focal adhesion kinase 3. GRAF3 is also
called Rho GTPase activating protein 42 (ARHGAP42) or
ARHGAP10-like. Though its function has not been
characterized, it may be a GAP with activity towards
RhoA and Cdc42, based on its similarity to GRAF and
GRAF2. It contains an N-terminal BAR domain, followed
by a Pleckstrin homology (PH) domain, a Rho GAP domain,
and a C-terminal SH3 domain. The SH3 domain of GRAF and
GRAF2 binds PKNbeta, a target of the small GTPase Rho.
SH3 domains bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs; they play a role in the regulation of enzymes
by intramolecular interactions, changing the
subcellular localization of signal pathway components
and mediate multiprotein complex assemblies.
Length = 55
Score = 26.6 bits (58), Expect = 0.62
Identities = 11/22 (50%), Positives = 12/22 (54%)
Query: 40 ENDWWTGTIGDRTGLFPSNYVV 61
E W T +TGL P NYVV
Sbjct: 32 EPGWLKATYEGKTGLVPENYVV 53
>gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated
Substrate) scaffolding protein family member 4. CASS4,
also called HEPL (HEF1-EFS-p130Cas-like), localizes to
focal adhesions and plays a role in regulating FAK
activity, focal adhesion integrity, and cell spreading.
It is most abundant in blood cells and lung tissue, and
is also found in high levels in leukemia and ovarian
cell lines. CAS proteins function as molecular
scaffolds to regulate protein complexes that are
involved in many cellular processes. They share a
common domain structure that includes an N-terminal SH3
domain, an unstructured substrate domain that contains
many YxxP motifs, a serine-rich four-helix bundle, and
a FAT-like C-terminal domain. The SH3 domain of CAS
proteins binds to diverse partners including FAK, FRNK,
Pyk2, PTP-PEST, DOCK180, among others. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 57
Score = 26.8 bits (59), Expect = 0.66
Identities = 12/51 (23%), Positives = 23/51 (45%), Gaps = 6/51 (11%)
Query: 18 YDSTE--PGDLTFNQDEVIYVTKK----ENDWWTGTIGDRTGLFPSNYVVP 62
YD+ +L F + +++ V ++ WW + R GL P+N +
Sbjct: 7 YDNKADCSDELAFRRGDILTVLEQNVPGSEGWWKCLLHGRQGLAPANRLQL 57
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of
Nebulette and LIM-nebulette (or Lasp2). Nebulette is a
cardiac-specific protein that localizes to the Z-disc.
It interacts with tropomyosin and is important in
stabilizing actin thin filaments in cardiac muscles.
Polymorphisms in the nebulette gene are associated with
dilated cardiomyopathy, with some mutations resulting
in severe heart failure. Nebulette is a 107kD protein
that contains an N-terminal acidic region, multiple
nebulin repeats, and a C-terminal SH3 domain.
LIM-nebulette, also called Lasp2 (LIM and SH3 domain
protein 2), is an alternatively spliced variant of
nebulette. Although it shares a gene with nebulette,
Lasp2 is not transcribed from a muscle-specific
promoter, giving rise to its multiple tissue expression
pattern with highest amounts in the brain. It can
crosslink actin filaments and it affects cell
spreading. Lasp2 is a 34kD protein containing an
N-terminal LIM domain, three nebulin repeats, and a
C-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 58
Score = 26.5 bits (58), Expect = 0.68
Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 3/52 (5%)
Query: 12 YIAAYPYDSTEPGDLTFNQ-DEVIYVTKKENDWWTGTI--GDRTGLFPSNYV 60
Y A Y Y + + +++F D ++ V + W GT+ RTG+ P+NY+
Sbjct: 3 YRAMYDYSAQDEDEVSFRDGDYIVNVQPIDEGWMYGTVQRTGRTGMLPANYI 54
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and
similar domains. Bzz1 (or Bzz1p) is a
WASP/Las17-interacting protein involved in endocytosis
and trafficking to the vacuole. It physically interacts
with type I myosins and functions in the early steps of
endocytosis. Together with other proteins, it induces
membrane scission in yeast. Bzz1 contains an N-terminal
F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
central coiled-coil, and two C-terminal SH3 domains.
This model represents the second C-terminal SH3 domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 51
Score = 26.3 bits (58), Expect = 0.69
Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 2/51 (3%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKE--NDWWTGTIGDRTGLFPSNY 59
Y A Y Y++ +++ + I V + + + W G I GLFP++Y
Sbjct: 1 YVEALYDYEAQGDDEISIRVGDRIAVIRGDDGSGWTYGEINGVKGLFPTSY 51
>gnl|CDD|212976 cd12043, SH3_CACNB4, Src Homology 3 domain of Voltage-dependent
L-type calcium channel subunit beta4. The beta4
subunit of voltage-dependent calcium channels (Ca(V)s)
is one of four beta subunits present in vertebrates. It
is the only beta subunit expressed in the cochlea and
is highly expressed in the brain, predominantly in the
cerebellum. Ca(V)s are multi-protein complexes that
regulate the entry of calcium into cells. They impact
muscle contraction, neuronal migration, hormone and
neurotransmitter release, and the activation of
calcium-dependent signaling pathways. They are composed
of four subunits: alpha1, alpha2delta, beta, and gamma.
The beta subunit is a soluble and intracellular protein
that interacts with the transmembrane alpha1 subunit.
It facilitates the trafficking and proper localization
of the alpha1 subunit to the cellular plasma membrane.
Vertebrates contain four different beta subunits from
distinct genes (beta1-4); each exists as multiple
splice variants. All are expressed in the brain while
other tissues show more specific expression patterns.
The beta subunits show similarity to MAGUK
(membrane-associated guanylate kinase) proteins in that
they contain SH3 and inactive guanylate kinase (GuK)
domains; however, they do not appear to contain a PDZ
domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 68
Score = 26.9 bits (59), Expect = 0.74
Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
Query: 12 YIAAYPYDSTEPGD-LTFNQDEVIYVTKK-ENDWWTGTI---GDRTGLFPS 57
Y A D PG ++F+ + +++ +K NDWW G + G G PS
Sbjct: 13 YCGALDEDVPVPGTAISFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPS 63
>gnl|CDD|212952 cd12019, SH3_Tks5_4, Fourth Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the fourth
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 26.5 bits (58), Expect = 0.79
Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQD-EVIYVTKKENDWWTGTIGDRTGLFPSNYVVP 62
Y+ Y + +++F EV + K+E+ WW G+ G PS+Y+
Sbjct: 1 SYMTTSAYQKVQDSEISFPAGVEVEVLEKQESGWWYVRFGELEGWAPSHYLEL 53
>gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine
kinase substrate (Tks) proteins. Tks proteins are Src
substrates and scaffolding proteins that play important
roles in the formation of podosomes and invadopodia,
the dynamic actin-rich structures that are related to
cell migration and cancer cell invasion. Vertebrates
contain two Tks proteins, Tks4 (Tyr kinase substrate
with four SH3 domains) and Tks5 (Tyr kinase substrate
with five SH3 domains), which display partially
overlapping but non-redundant functions. Both associate
with the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. Tks5
interacts with N-WASP and Nck, while Tks4 is essential
for the localization of MT1-MMP (membrane-type 1 matrix
metalloproteinase) to invadopodia. Tks proteins contain
an N-terminal Phox homology (PX) domain and four or
five SH3 domains. This model characterizes the second
SH3 domain of Tks proteins. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 54
Score = 26.3 bits (58), Expect = 0.90
Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 1/52 (1%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKEND-WWTGTIGDRTGLFPSNYV 60
E YI Y + ++ F V+ V +K D WW + G P+ Y+
Sbjct: 1 EKYITTQAYKAENEDEIGFETGVVVEVIQKNLDGWWKIRYQGKEGWAPATYL 52
>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of
Cdc42-Interacting Protein 4. This subfamily is
composed of Cdc42-Interacting Protein 4 (CIP4), Formin
Binding Protein 17 (FBP17), FormiN Binding Protein
1-Like (FNBP1L), and similar proteins. CIP4 and FNBP1L
are Cdc42 effectors that bind Wiskott-Aldrich syndrome
protein (WASP) and function in endocytosis. CIP4 and
FBP17 bind to the Fas ligand and may be implicated in
the inflammatory response. CIP4 may also play a role in
phagocytosis. It functions downstream of Cdc42 in
PDGF-dependent actin reorganization and cell migration,
and also regulates the activity of PDGFRbeta. It uses
Src as a substrate in regulating the invasiveness of
breast tumor cells. CIP4 may also play a role in the
pathogenesis of Huntington's disease. Members of this
subfamily typically contain an N-terminal F-BAR
(FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain, a
central Cdc42-binding HR1 domain, and a C-terminal SH3
domain. The SH3 domain of CIP4 associates with Gapex-5,
a Rab31 GEF. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 26.1 bits (58), Expect = 1.0
Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
Query: 13 IAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGT--IGDRTGLFPSNYV 60
A Y +D T G L+ + E++ V ++ D WT G P++Y+
Sbjct: 3 TALYDFDGTSEGTLSMEEGEILLVLEEDGGDGWTRVRKNNGDEGYVPTSYI 53
>gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3
domain-containing protein 1. RUSC1, also called NESCA
(New molecule containing SH3 at the carboxy-terminus),
is highly expressed in the brain and is translocated to
the nuclear membrane from the cytoplasm upon
stimulation with neurotrophin. It plays a role in
facilitating neurotrophin-dependent neurite outgrowth.
It also interacts with NEMO (or IKKgamma) and may
function in NEMO-mediated activation of NF-kB. RUSC
proteins are adaptor proteins consisting of RUN,
leucine zipper, and SH3 domains. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 51
Score = 25.9 bits (57), Expect = 1.0
Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
Query: 26 LTFNQDEVIYV-TKKENDWWTGTIGDRTGLFPSNY 59
L+F + E + V + DW GDR GL P Y
Sbjct: 15 LSFRKGEELQVLGTVDEDWIRCRRGDREGLVPVGY 49
>gnl|CDD|213007 cd12074, SH3_Tks5_1, First Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the first
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 53
Score = 26.2 bits (57), Expect = 1.0
Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Query: 12 YIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPSNYV 60
Y+ Y+ E +++ EV+ V +K E+ WW + + G P+ Y+
Sbjct: 2 YVVVSNYEKQENSEISLQAGEVVDVIEKNESGWWFVSTAEEQGWVPATYL 51
>gnl|CDD|213012 cd12079, SH3_Tks5_3, Third Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the third
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 25.8 bits (56), Expect = 1.2
Identities = 14/51 (27%), Positives = 20/51 (39%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFPSNYV 60
EYY A G + + K WW IG++ G PS+Y+
Sbjct: 2 EYYTIAEFQSCISDGISFRGGQKAEVIEKNSGGWWYVQIGEKEGWAPSSYI 52
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth
factor receptor kinase substrate 8 and similar
proteins. This group is composed of Eps8 and Eps8-like
proteins including Eps8-like 1-3, among others. These
proteins contain N-terminal Phosphotyrosine-binding
(PTB), central SH3, and C-terminal effector domains.
Eps8 binds either Abi1 (also called E3b1) or Rab5
GTPase activating protein RN-tre through its SH3
domain. With Abi1 and Sos1, it becomes part of a
trimeric complex that is required to activate Rac.
Together with RN-tre, it inhibits the internalization
of EGFR. The SH3 domains of Eps8 and similar proteins
recognize peptides containing a PxxDY motif, instead of
the classical PxxP motif. SH3 domains are protein
interaction domains that usually bind to proline-rich
ligands with moderate affinity and selectivity. They
play versatile and diverse roles in the cell including
the regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 54
Score = 25.7 bits (57), Expect = 1.3
Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWW-TGTIGDRTGLFPSNYVVPY 63
Y Y + + +L+ + E + V WW + G P N + PY
Sbjct: 1 YVRVLYDFTARNSKELSVLKGEYLEVLDDSRQWWKVRNSRGQVGYVPHNILEPY 54
>gnl|CDD|213008 cd12075, SH3_Tks4_1, First Src homology 3 domain of Tyrosine
kinase substrate with four SH3 domains. Tks4, also
called SH3 and PX domain-containing protein 2B
(SH3PXD2B) or HOFI, is a Src substrate and scaffolding
protein that plays an important role in the formation
of podosomes and invadopodia, the dynamic actin-rich
structures that are related to cell migration and
cancer cell invasion. It is required in the formation
of functional podosomes, EGF-induced membrane ruffling,
and lamellipodia generation. It plays an important role
in cellular attachment and cell spreading. Tks4 is
essential for the localization of MT1-MMP
(membrane-type 1 matrix metalloproteinase) to
invadopodia. It contains an N-terminal Phox homology
(PX) domain and four SH3 domains. This model
characterizes the first SH3 domain of Tks4. SH3 domains
are protein interaction domains that bind to
proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 25.8 bits (56), Expect = 1.5
Identities = 11/49 (22%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKK-ENDWWTGTIGDRTGLFPS 57
+ Y+ Y E +++ +V+ + +K E+ WW + D G P+
Sbjct: 1 DQYVVVANYQKQESSEISLYVGQVVDIIEKNESGWWFVSTADEQGWVPA 49
>gnl|CDD|212693 cd11759, SH3_CRK_C, C-terminal Src Homology 3 domain of Ct10
Regulator of Kinase adaptor proteins. CRK adaptor
proteins consists of SH2 and SH3 domains, which bind
tyrosine-phosphorylated peptides and proline-rich
motifs, respectively. They function downstream of
protein tyrosine kinases in many signaling pathways
started by various extracellular signals, including
growth and differentiation factors. Cellular CRK
(c-CRK) contains a single SH2 domain, followed by
N-terminal and C-terminal SH3 domains. It is involved
in the regulation of many cellular processes including
cell growth, motility, adhesion, and apoptosis. CRK has
been implicated in the malignancy of various human
cancers. The C-terminal SH3 domain of CRK has not been
shown to bind any target protein; it acts as a negative
regulator of CRK function by stabilizing a structure
that inhibits the access by target proteins to the
N-terminal SH3 domain. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes by
intramolecular interactions, changing the subcellular
localization of signal pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 25.5 bits (56), Expect = 1.5
Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 4/44 (9%)
Query: 18 YDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDRTGLFPSNYV 60
YD T L +++ VTK + W G + + G FP +V
Sbjct: 15 YDKTA---LALEVGDLVKVTKINVSGQWEGELNGKVGHFPFTHV 55
>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting
protein 2. JNK-interacting protein 2 (JIP2) is also
called Mitogen-activated protein kinase 8-interacting
protein 2 (MAPK8IP2) or Islet-brain-2 (IB2). It is
widely expressed in the brain, where it forms complexes
with fibroblast growth factor homologous factors
(FHFs), which facilitates activation of the p38delta
MAPK. JIP2 is enriched in postsynaptic densities and
may play a role in motor and cognitive function. In
addition to a JNK binding domain, JIP2 also contains
SH3 and Phosphotyrosine-binding (PTB) domains. The SH3
domain of the related protein JIP1 homodimerizes at the
interface usually involved in proline-rich ligand
recognition, despite the lack of this motif in the
domain itself. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 55
Score = 25.7 bits (56), Expect = 1.5
Identities = 13/49 (26%), Positives = 24/49 (48%), Gaps = 3/49 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRT---GLFPSNY 59
A + + +L + D+ + V +E+D+W RT G+FP+ Y
Sbjct: 4 AVFRFIPRHEDELELDVDDPLLVEAEEDDYWYRGYNMRTGERGIFPAFY 52
>gnl|CDD|212984 cd12051, SH3_DOCK1_5_A, Src Homology 3 domain of Class A
Dedicator of Cytokinesis proteins 1 and 5. Dock1, also
called Dock180, and Dock5 are class A DOCKs and are
atypical guanine nucleotide exchange factors (GEFs)
that lack the conventional Dbl homology (DH) domain.
Dock1 interacts with the scaffold protein Elmo and the
resulting complex functions upstream of Rac in many
biological events including phagocytosis of apoptotic
cells, cell migration and invasion. Dock5 functions
upstream of Rac1 to regulate osteoclast function. All
DOCKs contain two homology domains: the DHR-1 (Dock
homology region-1), also called CZH1 (CED-5, Dock180,
and MBC-zizimin homology 1), and DHR-2 (also called
CZH2 or Docker). The DHR-1 domain binds
phosphatidylinositol-3,4,5-triphosphate while DHR-2
contains the catalytic activity for Rac and/or Cdc42.
Class A DOCKs also contain an SH3 domain at the
N-terminal region and a PxxP motif at the C-terminus;
they are specific GEFs for Rac. The SH3 domain of Dock1
binds to DHR-2 in an autoinhibitory manner; binding of
Elmo to the SH3 domain of Dock1 exposes the DHR-2
domain and promotes GEF activity. SH3 domains are
protein interaction domains that bind to proline-rich
ligands with moderate affinity and selectivity,
preferentially to PxxP motifs. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 56
Score = 25.5 bits (56), Expect = 1.6
Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 3/53 (5%)
Query: 11 YYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTG-TIGDRT--GLFPSNYV 60
Y +A Y YD+ P +L+ + +++ + W+ G T+ ++ G+FP++Y+
Sbjct: 1 YGVAIYNYDARGPDELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYI 53
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and
similar domains. Bzz1 (or Bzz1p) is a
WASP/Las17-interacting protein involved in endocytosis
and trafficking to the vacuole. It physically interacts
with type I myosins and functions in the early steps of
endocytosis. Together with other proteins, it induces
membrane scission in yeast. Bzz1 contains an N-terminal
F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs), a
central coiled-coil, and two C-terminal SH3 domains.
This model represents the first C-terminal SH3 domain.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 55
Score = 25.3 bits (56), Expect = 1.7
Identities = 10/50 (20%), Positives = 22/50 (44%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYV-TKKENDWWT--GTIGDRTGLFPSNYV 60
Y Y ++ +++ ++ E + V + WT GL P++Y+
Sbjct: 4 VLYDYTASGDDEVSISEGEEVTVLEPDDGSGWTKVRNGSGEEGLVPTSYI 53
>gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding
Protein 17. Formin Binding Protein 17 (FBP17), also
called FormiN Binding Protein 1 (FNBP1), is involved in
dynamin-mediated endocytosis. It is recruited to
clathrin-coated pits late in the endocytosis process
and may play a role in the invagination and scission
steps. FBP17 binds in vivo to tankyrase, a protein
involved in telomere maintenance and mitogen activated
protein kinase (MAPK) signaling. It contains an
N-terminal F-BAR (FES-CIP4 Homology and
Bin/Amphiphysin/Rvs) domain, a Cdc42-binding HR1
domain, and a C-terminal SH3 domain. The SH3 domain of
the related protein, CIP4, associates with Gapex-5, a
Rab31 GEF. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 57
Score = 25.3 bits (55), Expect = 2.0
Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Query: 14 AAYPYDSTEPGDLTFNQDEVIYVTKKEN-DWWTGT--IGDRTGLFPSNYVVPY 63
A YP++ G ++ + E++YV +++ D WT D G P++Y+ Y
Sbjct: 5 ALYPFEGQNEGTISVAEGEMLYVIEEDKGDGWTRIRRNEDEEGYVPTSYIEVY 57
>gnl|CDD|212974 cd12041, SH3_CACNB1, Src Homology 3 domain of Voltage-dependent
L-type calcium channel subunit beta-1. The beta1
subunit of voltage-dependent calcium channels (Ca(V)s)
is one of four beta subunits present in vertebrates. It
is the only beta subunit, as the beta1a variant,
expressed in skeletal muscle; the beta1b variant is
also widely expressed in other tissues including the
heart and brain. Knockout of the beta1 gene in mice
results in embryonic lethality, demonstrating its
importance in development. Ca(V)s are multi-protein
complexes that regulate the entry of calcium into
cells. They impact muscle contraction, neuronal
migration, hormone and neurotransmitter release, and
the activation of calcium-dependent signaling pathways.
They are composed of four subunits: alpha1,
alpha2delta, beta, and gamma. The beta subunit is a
soluble and intracellular protein that interacts with
the transmembrane alpha1 subunit. It facilitates the
trafficking and proper localization of the alpha1
subunit to the cellular plasma membrane. Vertebrates
contain four different beta subunits from distinct
genes (beta1-4); each exists as multiple splice
variants. All are expressed in the brain while other
tissues show more specific expression patterns. The
beta subunits show similarity to MAGUK
(membrane-associated guanylate kinase) proteins in that
they contain SH3 and inactive guanylate kinase (GuK)
domains; however, they do not appear to contain a PDZ
domain. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 68
Score = 25.3 bits (55), Expect = 2.2
Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 12/50 (24%)
Query: 20 STEPGD--------LTFNQDEVIYVTKK-ENDWWTGTI---GDRTGLFPS 57
+ PGD ++F + +++ +K NDWW G + G G PS
Sbjct: 14 NPSPGDDVPVQGMAISFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPS 63
>gnl|CDD|114046 pfam05298, Bombinin, Bombinin. This family consists of Bombinin
and Maximin proteins from Bombina maxima (Chinese red
belly toad). Two groups of antimicrobial peptides have
been isolated from skin secretions of Bombina maxima.
Peptides in the first group, named maximins 1, 2, 3, 4
and 5, are structurally related to bombinin-like
peptides (BLPs). Unlike BLPs, sequence variations in
maximins occurred all through the molecules. In addition
to the potent antimicrobial activity, cytotoxicity
against tumour cells and spermicidal action of maximins,
maximin 3 possessed a significant anti-HIV activity.
Maximins 1 and 3 have been found to be toxic to mice.
Peptides in the second group, termed maximins H1, H2, H3
and H4, are homologous with bombinin H peptides.
Length = 141
Score = 26.1 bits (57), Expect = 2.5
Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
Query: 1 MKSLQELSQEYYIAAYPYDSTEPGDLTFNQDEVIYV-TKKE 40
MK L+ + ++ +P +++E FNQ+E+ + TKKE
Sbjct: 81 MKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTKKE 121
>gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33.
SNX33 interacts with Wiskott-Aldrich syndrome protein
(WASP) and plays a role in the maintenance of cell
shape and cell cycle progression. It modulates the
shedding and endocytosis of cellular prion protein
(PrP(c)) and amyloid precursor protein (APP). SNXs are
Phox homology (PX) domain containing proteins that are
involved in regulating membrane traffic and protein
sorting in the endosomal system. SNX33 also contains
BAR and SH3 domains. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 55
Score = 24.9 bits (54), Expect = 2.7
Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
Query: 14 AAYPYDSTEPGDLTFNQDE--VIYVTKKENDWWTGTIG-DRTGLFPSNYV 60
A Y + S ++ ++E VI+ + W G TGLFP++YV
Sbjct: 4 ALYSFQSENKEEINIQENEELVIFSENSLDGWLQGQNSRGETGLFPASYV 53
>gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and
double SH3 domains proteins. This group is composed of
FCH and double SH3 domains protein 1 (FCHSD1) and
FCHSD2. These proteins have a common domain structure
consisting of an N-terminal F-BAR (FES-CIP4 Homology
and Bin/Amphiphysin/Rvs), two SH3, and C-terminal
proline-rich domains. They have only been characterized
in silico and their functions remain unknown. This
group also includes the insect protein, nervous wreck,
which acts as a regulator of synaptic growth signaling.
SH3 domains are protein interaction domains that bind
to proline-rich ligands with moderate affinity and
selectivity, preferentially to PxxP motifs. They play
versatile and diverse roles in the cell including the
regulation of enzymes, changing the subcellular
localization of signaling pathway components, and
mediating the formation of multiprotein complex
assemblies.
Length = 57
Score = 24.6 bits (54), Expect = 3.4
Identities = 12/48 (25%), Positives = 20/48 (41%), Gaps = 3/48 (6%)
Query: 16 YPYDSTEPGDLTFNQDEVIYVTKK--ENDWWTG-TIGDRTGLFPSNYV 60
Y Y++ P +LT + E + V + + W G P NY+
Sbjct: 8 YSYEAQRPDELTITEGEELEVIEDGDGDGWVKARNKSGEVGYVPENYL 55
>gnl|CDD|212947 cd12014, SH3_RIM-BP_1, First Src homology 3 domain of
Rab3-interacting molecules (RIMs) binding proteins.
RIMs binding proteins (RBPs, RIM-BPs) associate with
calcium channels present in photoreceptors, neurons,
and hair cells; they interact simultaneously with
specific calcium channel subunits, and active zone
proteins, RIM1 and RIM2. RIMs are part of the matrix at
the presynaptic active zone and are associated with
synaptic vesicles through their interaction with the
small GTPase Rab3. RIM-BPs play a role in regulating
synaptic transmission by serving as adaptors and
linking calcium channels with the synaptic vesicle
release machinery. RIM-BPs contain three SH3 domains
and two to three fibronectin III repeats. Invertebrates
contain one, while vertebrates contain at least two
RIM-BPs, RIM-BP1 and RIM-BP2. RIM-BP1 is also called
peripheral-type benzodiazapine receptor associated
protein 1 (PRAX-1). Mammals contain a third protein,
RIM-BP3. RIM-BP1 and RIM-BP2 are predominantly
expressed in the brain where they display overlapping
but distinct expression patterns, while RIM-BP3 is
almost exclusively expressed in the testis and is
essential in spermiogenesis. The SH3 domains of RIM-BPs
bind to the PxxP motifs of RIM1, RIM2, and L-type
(alpha1D) and N-type (alpha1B) calcium channel
subunits. SH3 domains are protein interaction domains
that bind to proline-rich ligands with moderate
affinity and selectivity. They play versatile and
diverse roles in the cell including the regulation of
enzymes, changing the subcellular localization of
signaling pathway components, and mediating the
formation of multiprotein complex assemblies.
Length = 62
Score = 24.6 bits (54), Expect = 3.9
Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 10/59 (16%)
Query: 12 YIAAYPYDSTEPG-------DLTFNQDEVIYV--TKKENDWWTGTIGD-RTGLFPSNYV 60
++A Y Y+ +L N + +YV E+ ++ G + D R GL PSN+V
Sbjct: 2 FVARYSYNPLRDSPNENPEAELPLNAGDYVYVYGDMDEDGFYEGELLDGRRGLVPSNFV 60
>gnl|CDD|212728 cd11794, SH3_DNMBP_N1, First N-terminal Src homology 3 domain of
Dynamin Binding Protein, also called Tuba. DNMBP or
Tuba is a cdc42-specific guanine nucleotide exchange
factor (GEF) that contains four N-terminal SH3 domains,
a central RhoGEF [or Dbl homology (DH)] domain followed
by a Bin/Amphiphysin/Rvs (BAR) domain, and two
C-terminal SH3 domains. It provides a functional link
between dynamin and key regulatory proteins of the
actin cytoskeleton. It plays an important role in
regulating cell junction configuration. The four
N-terminal SH3 domains of DNMBP binds the GTPase
dynamin, which plays an important role in the fission
of endocytic vesicles. SH3 domains are protein
interaction domains that bind to proline-rich ligands
with moderate affinity and selectivity, preferentially
to PxxP motifs. They play versatile and diverse roles
in the cell including the regulation of enzymes,
changing the subcellular localization of signaling
pathway components, and mediating the formation of
multiprotein complex assemblies.
Length = 51
Score = 24.4 bits (53), Expect = 4.7
Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
Query: 23 PGDLTFNQDEVIYVTKKENDWWT-GTIGDRTGLFPSNYV 60
+L +VI V K +++W GT TG FPS++V
Sbjct: 13 SEELPLFAGDVIEVLKVVDEFWLLGTKEGVTGQFPSSFV 51
>gnl|CDD|176546 cd08604, GDPD_SHV3_repeat_2, Glycerophosphodiester
phosphodiesterase domain repeat 2 of
glycerophosphodiester phosphodiesterase-like protein
SHV3 and SHV3-like proteins. This subfamily
corresponds to the glycerophosphodiester
phosphodiesterase domain (GDPD) repeat 2 present in
glycerophosphodiester phosphodiesterase (GP-GDE)-like
protein SHV3 and SHV3-like proteins (SVLs), which may
play important an role in cell wall organization. The
prototype of this family is a
glycosylphosphatidylinositol (GPI) anchored protein
SHV3 encoded by shaven3 (shv3) gene from Arabidopsis
thaliana. Members in this family show sequence homology
to bacterial GP-GDEs (EC 3.1.4.46) that catalyze the
hydrolysis of various glycerophosphodiesters, and
produce sn-glycerol-3-phosphate (G3P) and the
corresponding alcohols. Both, SHV3 and SVLs, have two
tandemly repeated GDPD domains whose biochemical
functions remain unclear. The residues essential for
interactions with the substrates and calcium ions in
bacterial GP-GDEs are not conserved in SHV3 and SVLs,
which suggests that the function of GDPD domains in
these proteins might be distinct from those in typical
bacterial GP-GDEs. In addition, the two tandem repeats
show low sequence similarity to each other, suggesting
they have different biochemical function. Most of the
members of this family are Arabidopsis-specific gene
products. To date, SHV3 orthologues are only found in
Physcomitrella patens. This CD includes domain II (the
second GDPD domain of SHV3 and SVLs), which is
necessary for SHV3 function.
Length = 300
Score = 25.0 bits (55), Expect = 6.3
Identities = 9/27 (33%), Positives = 14/27 (51%)
Query: 53 GLFPSNYVVPYEAQVDQQADLIRCTCQ 79
G +P + Y+ V AD+I C+ Q
Sbjct: 11 GDYPGCTDLAYQKAVKDGADVIDCSVQ 37
>gnl|CDD|188526 TIGR04011, poly_gGlu_PgsC, poly-gamma-glutamate biosynthesis
protein PgsC/CapC. Of four genes commonly found to be
involved in biosynthesis and export of
poly-gamma-glutamate, pgsB(capB) and pgsC(capC) are
found to be involved in the synthesis per se. Members
of this family are designated PgsC, covering both cases
in which the poly-gamma-glutamate is secreted and those
in which it is retained to form capsular material. PgsC
binds tightly to PgsB, which has been shown to have
poly-gamma-glutamate activity [Cell envelope, Other].
Length = 132
Score = 24.6 bits (54), Expect = 8.3
Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 7/47 (14%)
Query: 50 DRTGLFPSNYVVP-YEAQVDQQADLIRCTCQVYLIFLISLMIYKRVR 95
+ TG+ P VVP Y A Q LI + LIS++ Y V
Sbjct: 13 EITGISPGGLVVPGYLALFLDQPVLI------IVTILISILTYLIVY 53
>gnl|CDD|226796 COG4346, COG4346, Predicted membrane-bound
dolichyl-phosphate-mannose-protein mannosyltransferase
[Posttranslational modification, protein turnover,
chaperones].
Length = 438
Score = 24.9 bits (54), Expect = 8.6
Identities = 18/64 (28%), Positives = 22/64 (34%), Gaps = 11/64 (17%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKENDWWTGTIGDRTGLFP---------SNYV 60
E + YP L + DEV YVT N W +R L NY
Sbjct: 38 EKSVREYPTIPEFSPKLGYISDEVWYVTYARNIIW--EFAERNMLKEYFTVTPFPGVNYT 95
Query: 61 VPYE 64
+P E
Sbjct: 96 IPVE 99
>gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine
kinase substrate with five SH3 domains. Tks5, also
called SH3 and PX domain-containing protein 2A
(SH3PXD2A) or Five SH (FISH), is a scaffolding protein
and Src substrate that is localized in podosomes, which
are electron-dense structures found in Src-transformed
fibroblasts, osteoclasts, macrophages, and some
invasive cancer cells. It binds and regulates some
members of the ADAMs family of transmembrane
metalloproteases, which function as sheddases and
mediators of cell and matrix interactions. It is
required for podosome formation, degradation of the
extracellular matrix, and cancer cell invasion. Tks5
contains an N-terminal Phox homology (PX) domain and
five SH3 domains. This model characterizes the second
SH3 domain of Tks5. SH3 domains are protein interaction
domains that bind to proline-rich ligands with moderate
affinity and selectivity, preferentially to PxxP
motifs. They play versatile and diverse roles in the
cell including the regulation of enzymes, changing the
subcellular localization of signaling pathway
components, and mediating the formation of multiprotein
complex assemblies.
Length = 54
Score = 23.8 bits (51), Expect = 8.6
Identities = 13/52 (25%), Positives = 23/52 (44%), Gaps = 1/52 (1%)
Query: 10 EYYIAAYPYDSTEPGDLTFNQDEVIYVTKKE-NDWWTGTIGDRTGLFPSNYV 60
E Y+ PY S ++ F + + V +K WW + G P++Y+
Sbjct: 1 EKYVTVQPYTSQGKDEIGFEKGVTVEVIQKNLEGWWYIRYLGKEGWAPASYL 52
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.321 0.137 0.422
Gapped
Lambda K H
0.267 0.0656 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 4,762,461
Number of extensions: 375729
Number of successful extensions: 650
Number of sequences better than 10.0: 1
Number of HSP's gapped: 524
Number of HSP's successfully gapped: 252
Length of query: 95
Length of database: 10,937,602
Length adjustment: 62
Effective length of query: 33
Effective length of database: 8,187,654
Effective search space: 270192582
Effective search space used: 270192582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (24.3 bits)