BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy709
(508 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1I1G|A Chain A, Crystal Structure Of The Lrp-Like Transcriptional
Regulator From The Archaeon Pyrococcus Furiosus
pdb|1I1G|B Chain B, Crystal Structure Of The Lrp-Like Transcriptional
Regulator From The Archaeon Pyrococcus Furiosus
Length = 141
Score = 30.8 bits (68), Expect = 2.1, Method: Composition-based stats.
Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 6/54 (11%)
Query: 273 EYLFVKETYLAN----VMTVLVAKDITTKLYAMNNKVGRRTGL--ISSEIMTEK 320
EY FVKE YL++ +M V+ AKD ++NK+G+ G+ + I+ EK
Sbjct: 86 EYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEK 139
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.466
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,587,196
Number of Sequences: 62578
Number of extensions: 511410
Number of successful extensions: 1092
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1091
Number of HSP's gapped (non-prelim): 1
length of query: 508
length of database: 14,973,337
effective HSP length: 103
effective length of query: 405
effective length of database: 8,527,803
effective search space: 3453760215
effective search space used: 3453760215
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)