BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy709
         (508 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1I1G|A Chain A, Crystal Structure Of The Lrp-Like Transcriptional
           Regulator From The Archaeon Pyrococcus Furiosus
 pdb|1I1G|B Chain B, Crystal Structure Of The Lrp-Like Transcriptional
           Regulator From The Archaeon Pyrococcus Furiosus
          Length = 141

 Score = 30.8 bits (68), Expect = 2.1,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 273 EYLFVKETYLAN----VMTVLVAKDITTKLYAMNNKVGRRTGL--ISSEIMTEK 320
           EY FVKE YL++    +M V+ AKD       ++NK+G+  G+  +   I+ EK
Sbjct: 86  EYDFVKELYLSSGDHMIMAVIWAKDGEDLAEIISNKIGKIEGVTKVCPAIILEK 139


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.466 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 13,587,196
Number of Sequences: 62578
Number of extensions: 511410
Number of successful extensions: 1092
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1091
Number of HSP's gapped (non-prelim): 1
length of query: 508
length of database: 14,973,337
effective HSP length: 103
effective length of query: 405
effective length of database: 8,527,803
effective search space: 3453760215
effective search space used: 3453760215
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 54 (25.4 bits)