Query         psy7097
Match_columns 63
No_of_seqs    86 out of 88
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:05:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7097.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7097hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3961|consensus              100.0 3.8E-31 8.2E-36  194.5   4.2   57    1-59    206-262 (262)
  2 PF10274 ParcG:  Parkin co-regu 100.0 6.9E-31 1.5E-35  183.7   1.3   53    1-55    131-183 (183)
  3 PF14501 HATPase_c_5:  GHKL dom  56.3      20 0.00044   21.2   3.2   27   23-50     10-36  (100)
  4 cd08048 TAF11 TATA Binding Pro  53.0      13 0.00029   23.2   2.1   17   23-39     50-66  (85)
  5 PF13958 ToxN_toxin:  Toxin Tox  48.7     3.4 7.4E-05   28.2  -1.1   25   36-60     73-97  (161)
  6 TIGR00370 conserved hypothetic  43.4      28  0.0006   24.5   2.8   43   13-61      8-50  (202)
  7 PF04719 TAFII28:  hTAFII28-lik  43.3      26 0.00056   22.3   2.4   17   23-39     58-74  (90)
  8 PF04405 ScdA_N:  Domain of Unk  41.5      36 0.00077   19.7   2.6   20   19-38      1-23  (56)
  9 PF04426 Bul1_C:  Bul1 C termin  40.1      12 0.00026   27.8   0.5   12   47-58    231-242 (272)
 10 cd06410 PB1_UP2 Uncharacterize  40.0      58  0.0013   20.7   3.6   37   19-59     31-67  (97)
 11 PF07541 EIF_2_alpha:  Eukaryot  39.6      56  0.0012   20.9   3.5   30   25-54     76-106 (114)
 12 PF10258 RNA_GG_bind:  PHAX RNA  39.5      27  0.0006   21.9   2.0   17   23-40     30-46  (87)
 13 PRK02615 thiamine-phosphate py  38.5      25 0.00055   26.8   2.1   24   16-39     77-107 (347)
 14 COG1393 ArsC Arsenate reductas  38.4      45 0.00097   21.6   3.0   29   26-54     13-41  (117)
 15 PF12651 RHH_3:  Ribbon-helix-h  38.3      25 0.00055   19.2   1.6   20   15-34     20-39  (44)
 16 PF00367 PTS_EIIB:  phosphotran  37.5      47   0.001   17.6   2.5   21   31-58      2-22  (35)
 17 PF04639 Baculo_E56:  Baculovir  36.7      35 0.00076   26.5   2.6   38   22-59    128-171 (305)
 18 PF10209 DUF2340:  Uncharacteri  35.2      52  0.0011   22.4   3.0   29   20-48     26-54  (122)
 19 PF01910 DUF77:  Domain of unkn  35.2      53  0.0012   20.4   2.8   27   22-48     48-74  (92)
 20 PF12692 Methyltransf_17:  S-ad  33.2      38 0.00082   24.1   2.1   24   23-47     77-100 (160)
 21 PF04009 DUF356:  Protein of un  32.3      40 0.00087   22.6   2.0   29   25-53     10-38  (107)
 22 cd04385 RhoGAP_ARAP RhoGAP_ARA  32.2      54  0.0012   22.0   2.7   32    9-40      1-32  (184)
 23 COG5256 TEF1 Translation elong  31.7      50  0.0011   26.6   2.8   37    7-48    152-188 (428)
 24 PRK15463 cold shock-like prote  31.5      22 0.00048   21.1   0.7   15   37-51     25-39  (70)
 25 PF13348 Y_phosphatase3C:  Tyro  30.5      32  0.0007   19.3   1.2   21   24-44     28-49  (68)
 26 PF00755 Carn_acyltransf:  Chol  30.0     9.1  0.0002   30.1  -1.5   33   19-60    400-434 (591)
 27 PF14208 DUF4320:  Domain of un  29.8      49  0.0011   21.7   2.1   21   21-41     23-43  (116)
 28 PRK15464 cold shock-like prote  28.6      28  0.0006   20.8   0.7   15   37-51     25-39  (70)
 29 KOG4603|consensus               28.1      29 0.00063   25.6   0.9   32    5-38     21-53  (201)
 30 KOG3719|consensus               27.9      19 0.00042   30.3  -0.0   28   23-59    443-472 (638)
 31 cd00447 NusB_Sun RNA binding d  27.4      48   0.001   20.3   1.7   24   22-45     94-119 (129)
 32 cd01479 Sec24-like Sec24-like:  27.0      66  0.0014   22.6   2.5   24   17-40    111-134 (244)
 33 cd00620 Methyltransferase_Sun   26.1      48   0.001   20.7   1.5   24   22-45     91-116 (126)
 34 COG0626 MetC Cystathionine bet  25.8      82  0.0018   24.6   3.0   31   11-44     53-83  (396)
 35 PF04230 PS_pyruv_trans:  Polys  25.6   1E+02  0.0022   19.4   2.9   28   22-50      1-30  (286)
 36 KOG0699|consensus               25.2      54  0.0012   27.1   2.0   40    8-53    123-166 (542)
 37 COG2345 Predicted transcriptio  25.1      33 0.00072   24.9   0.7   25   20-44     82-106 (218)
 38 PF13730 HTH_36:  Helix-turn-he  25.1      66  0.0014   17.0   1.8   14   25-38     40-53  (55)
 39 TIGR01951 nusB transcription a  24.6      54  0.0012   20.2   1.5   24   22-45     95-120 (129)
 40 PF06751 EutB:  Ethanolamine am  23.7      33 0.00071   27.9   0.5   13   46-59    204-216 (444)
 41 KOG3219|consensus               23.7      69  0.0015   23.4   2.1   19   21-39    144-162 (195)
 42 PF07045 DUF1330:  Protein of u  23.6      89  0.0019   17.6   2.2   16   25-40      6-21  (65)
 43 COG4718 Phage-related protein   23.6      65  0.0014   21.8   1.8   21   24-44     54-74  (111)
 44 PF09651 Cas_APE2256:  CRISPR-a  23.4      73  0.0016   20.8   2.1   25   22-46     72-98  (136)
 45 PF14066 DUF4256:  Protein of u  23.4      52  0.0011   23.8   1.4   14   29-42     36-49  (173)
 46 KOG2449|consensus               23.3      31 0.00067   24.6   0.3   42    6-57     23-65  (157)
 47 PF11573 Med23:  Mediator compl  23.0      40 0.00086   30.6   0.9   34   16-49   1292-1338(1341)
 48 COG0694 Thioredoxin-like prote  22.8      63  0.0014   20.7   1.6   26   23-48     10-40  (93)
 49 smart00796 AHS1 Allophanate hy  22.3 1.4E+02   0.003   20.8   3.4   45   13-61     13-57  (201)
 50 PRK12419 riboflavin synthase s  22.2 1.2E+02  0.0026   21.1   3.0   28   23-51     25-52  (158)
 51 PF03511 Fanconi_A:  Fanconi an  22.1      89  0.0019   19.4   2.1   15   24-38     33-47  (64)
 52 PRK09507 cspE cold shock prote  22.0      47   0.001   19.5   0.8   15   37-51     24-38  (69)
 53 PRK13689 hypothetical protein;  22.0   1E+02  0.0022   19.5   2.4   20   21-40     10-29  (75)
 54 PF09290 AcetDehyd-dimer:  Prok  22.0 2.1E+02  0.0045   19.9   4.1   24   19-42     37-60  (137)
 55 PF03235 DUF262:  Protein of un  21.9      29 0.00063   22.2  -0.1   14   42-55      4-19  (221)
 56 PRK11190 Fe/S biogenesis prote  21.5 1.3E+02  0.0028   21.1   3.1   25   23-47    107-136 (192)
 57 PRK09937 stationary phase/star  21.2      53  0.0011   19.8   1.0   15   37-51     22-36  (74)
 58 TIGR03341 YhgI_GntY IscR-regul  20.7 1.3E+02  0.0029   20.9   3.0   25   23-47    106-135 (190)
 59 PF14028 SpaB_C:  SpaB C-termin  20.6      39 0.00084   23.2   0.3    9   34-42    101-109 (283)
 60 PRK10943 cold shock-like prote  20.2      42 0.00092   19.7   0.4   15   37-51     24-38  (69)

No 1  
>KOG3961|consensus
Probab=99.96  E-value=3.8e-31  Score=194.53  Aligned_cols=57  Identities=60%  Similarity=0.994  Sum_probs=54.2

Q ss_pred             CCccccCCCCCcccccccccCChhHHHHHHHHHHHHcCCccceeeeeecccCcceeeee
Q psy7097           1 MYKDLNKNTGDAIDYSQMKRENIGDLVQETLQILERHGGEDACIYIKYMIPTYESCILR   59 (63)
Q Consensus         1 ~fk~~n~n~gD~idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeScv~~   59 (63)
                      +||+.|.|+||+|||  .|++||||||+|||+.||++|||+|||||||||||||||.++
T Consensus       206 ~~k~~n~n~gd~idy--dk~~~igdlI~dTL~~LE~~GGpnAfINIKY~vPtYESC~~~  262 (262)
T KOG3961|consen  206 TFKNSNVNRGDGIDY--DKNRNIGDLINDTLKHLERSGGPNAFINIKYMVPTYESCCLN  262 (262)
T ss_pred             hhcccccccccccCc--cccccHHHHHHHHHHHHHHcCCccceeeEeeccCcchhhcCC
Confidence            599999999999999  578999999999999999999999999999999999999764


No 2  
>PF10274 ParcG:  Parkin co-regulated protein;  InterPro: IPR019399  This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter. The protein has predicted alpha-helical and beta-sheet domains which suggest its function is in the ubiquitin/proteasome system []. Mutations in parkin are the genetic cause of early-onset and autosomal recessive juvenile parkinsonism. 
Probab=99.96  E-value=6.9e-31  Score=183.69  Aligned_cols=53  Identities=68%  Similarity=1.105  Sum_probs=51.5

Q ss_pred             CCccccCCCCCcccccccccCChhHHHHHHHHHHHHcCCccceeeeeecccCcce
Q psy7097           1 MYKDLNKNTGDAIDYSQMKRENIGDLVQETLQILERHGGEDACIYIKYMIPTYES   55 (63)
Q Consensus         1 ~fk~~n~n~gD~idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeS   55 (63)
                      +||++|.|+||+|||  ++++++||+|+|||++|||+||+|||+|||||||||||
T Consensus       131 ~f~~k~~n~gd~i~y--~~~~~~~dlI~etL~~lE~~GG~dA~~nIKy~IPTYeS  183 (183)
T PF10274_consen  131 LFKNKNVNLGDGIDY--RKRKNLGDLIQETLELLERNGGPDAFINIKYMIPTYES  183 (183)
T ss_pred             HHHhcccCCCccccc--ccccchhHHHHHHHHHHHHhcChhHHHHHHHhCCCCCC
Confidence            589999999999999  78899999999999999999999999999999999998


No 3  
>PF14501 HATPase_c_5:  GHKL domain
Probab=56.27  E-value=20  Score=21.23  Aligned_cols=27  Identities=15%  Similarity=0.288  Sum_probs=24.5

Q ss_pred             hhHHHHHHHHHHHHcCCccceeeeeecc
Q psy7097          23 IGDLVQETLQILERHGGEDACIYIKYMI   50 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG~dAfinIKymV   50 (63)
                      ||.|++-+++..++..+ +.+|.|+...
T Consensus        10 l~nlldNAiea~~~~~~-~~~I~i~~~~   36 (100)
T PF14501_consen   10 LGNLLDNAIEACKKYED-KRFISISIRE   36 (100)
T ss_pred             HHHHHHHHHHHHHhcCC-CcEEEEEEEe
Confidence            78999999999999988 9999998765


No 4  
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex. The TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and are involved in forming the Transcription Factor IID (TFIID) complex. TFIID is one of seven General Transcription Factors (GTF) (TFIIA, TFIIB, TFIID, TFIIE, TFIIF, and TFIID) that are involved in accurate initiation of transcription by RNA polymerase II in eukaryotes. TFIID plays an important role in the recognition of promoter DNA and assembly of the pre-initiation complex. TFIID complex is composed of the TBP and at least 13 TAFs. TAFs from various species were originally named by their predicted molecular weight or their electrophoretic mobility in polyacrylamide gels. A new, unified nomenclature for the pol II TAFs has been suggested to show the relationship between TAF orthologs and paralogs. Several hypothes
Probab=52.99  E-value=13  Score=23.20  Aligned_cols=17  Identities=29%  Similarity=0.661  Sum_probs=15.5

Q ss_pred             hhHHHHHHHHHHHHcCC
Q psy7097          23 IGDLVQETLQILERHGG   39 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG   39 (63)
                      +||||++++++-|+.|-
T Consensus        50 VGeivE~A~~V~~~~~~   66 (85)
T cd08048          50 VGEIVEEARDVQEEWGE   66 (85)
T ss_pred             HHHHHHHHHHHHHHhcc
Confidence            79999999999999775


No 5  
>PF13958 ToxN_toxin:  Toxin ToxN, type III toxin-antitoxin system; PDB: 2XD0_X 2XDD_E 2XDB_A.
Probab=48.73  E-value=3.4  Score=28.24  Aligned_cols=25  Identities=28%  Similarity=0.428  Sum_probs=18.0

Q ss_pred             HcCCccceeeeeecccCcceeeeee
Q psy7097          36 RHGGEDACIYIKYMIPTYESCILRY   60 (63)
Q Consensus        36 r~GG~dAfinIKymVPTYeScv~~~   60 (63)
                      ..+|.-+-+||.+|||.-++|+...
T Consensus        73 ~~~~~lgvi~lnnMiPVp~~~~~~i   97 (161)
T PF13958_consen   73 EKNKILGVINLNNMIPVPDSCIKKI   97 (161)
T ss_dssp             EEEEEEEEEEGGG-EEE-GGGEEE-
T ss_pred             CccceEEEEeeccceeCCHHHeeEe
Confidence            3446778899999999999998654


No 6  
>TIGR00370 conserved hypothetical protein TIGR00370.
Probab=43.37  E-value=28  Score=24.54  Aligned_cols=43  Identities=19%  Similarity=0.179  Sum_probs=28.9

Q ss_pred             ccccccccCChhHHHHHHHHHHHHcCCccceeeeeecccCcceeeeeee
Q psy7097          13 IDYSQMKRENIGDLVQETLQILERHGGEDACIYIKYMIPTYESCILRYT   61 (63)
Q Consensus        13 idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeScv~~~~   61 (63)
                      ++|++.-...+-..|+..-+.|++.      --|.-+||+|.|....|.
T Consensus         8 v~fg~~~~~~~~~~v~~l~~~l~~~------~gi~e~vP~~~sllv~fd   50 (202)
T TIGR00370         8 IRLGPPINEQVQGIVWAAAAYLEEQ------PGFVECIPGMNNLTVFYD   50 (202)
T ss_pred             EEECCcCCHHHHHHHHHHHHHHhcC------CCcEEeecccEEEEEEEC
Confidence            4555443344555666666777765      248899999999987763


No 7  
>PF04719 TAFII28:  hTAFII28-like protein conserved region;  InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. The conserved region is found at the C terminus of most member proteins. The crystal structure of hTAFII28 with hTAFII18 shows that this region is involved in the binding of these two subunits. The conserved region contains four alpha helices and three loops arranged as in histone H3 [, ].; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005634 nucleus; PDB: 1BH9_B 1BH8_B.
Probab=43.34  E-value=26  Score=22.33  Aligned_cols=17  Identities=29%  Similarity=0.661  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHcCC
Q psy7097          23 IGDLVQETLQILERHGG   39 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG   39 (63)
                      +||||++++++-++.|.
T Consensus        58 VGEiVE~A~~Vq~~~~~   74 (90)
T PF04719_consen   58 VGEIVEEARDVQEEWGE   74 (90)
T ss_dssp             HHHHHHHHHHHHHHTT-
T ss_pred             HHHHHHHHHHHHHHhcC
Confidence            79999999999997663


No 8  
>PF04405 ScdA_N:  Domain of Unknown function (DUF542)  ;  InterPro: IPR007500 This is a domain of unknown function found at the N terminus of genes involved in cell wall development and nitrous oxide protection. ScdA is required for normal cell growth and development; mutants have an increased level of peptidoglycan cross-linking and aberrant cellular morphology suggesting a role for ScdA in cell wall metabolism []. NorA1, NorA2, and YtfE are involved in the nitrous oxide response. NorA1 and NorA2, which are similar to YtfE, are co-transcribed with the membrane-bound nitrous oxide (NO) reductases. The genes appear to be involved in NO protection but their function is unknown [, ]. 
Probab=41.50  E-value=36  Score=19.70  Aligned_cols=20  Identities=25%  Similarity=0.677  Sum_probs=15.3

Q ss_pred             ccCChhHHHHH---HHHHHHHcC
Q psy7097          19 KRENIGDLVQE---TLQILERHG   38 (63)
Q Consensus        19 k~~nlGdLI~e---TL~~lEr~G   38 (63)
                      |.+.|||++.+   |-.+|+++|
T Consensus         1 k~~tVgeiv~~~p~~a~vf~~~g   23 (56)
T PF04405_consen    1 KDQTVGEIVAEDPRAARVFRKYG   23 (56)
T ss_pred             CcCCHHHHHHHChHHHHHHHHcC
Confidence            45678898875   788888875


No 9  
>PF04426 Bul1_C:  Bul1 C terminus;  InterPro: IPR022794  This domain contains the C terminus of Saccharomyces cerevisiae Bul1. Bul1 binds the ubiquitin ligase Rsp5, via an N-terminal PPSY motif (157-160 in P48524 from SWISSPROT) []. The complex containing Bul1 and Rsp5 is involved in intracellular trafficking of the general amino acid permease Gap1 [], degradation of Rog1 in cooperation with Bul2 and GSK-3 [], and mitochondrial inheritance []. Bul1 may contain HEAT repeats. This domain is found C-terminal to PF04425 from PFAM. This signature also matches the C terminus of some bacterial Methyl-accepting chemotaxis proteins.
Probab=40.09  E-value=12  Score=27.76  Aligned_cols=12  Identities=33%  Similarity=1.057  Sum_probs=10.0

Q ss_pred             eecccCcceeee
Q psy7097          47 KYMIPTYESCIL   58 (63)
Q Consensus        47 KymVPTYeScv~   58 (63)
                      +-.||++|||.+
T Consensus       231 ~tLVPsFqSCl~  242 (272)
T PF04426_consen  231 KTLVPSFQSCLC  242 (272)
T ss_pred             cccCCCchheee
Confidence            448999999984


No 10 
>cd06410 PB1_UP2 Uncharacterized protein 2. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=40.01  E-value=58  Score=20.65  Aligned_cols=37  Identities=19%  Similarity=0.349  Sum_probs=27.3

Q ss_pred             ccCChhHHHHHHHHHHHHcCCccceeeeeecccCcceeeee
Q psy7097          19 KRENIGDLVQETLQILERHGGEDACIYIKYMIPTYESCILR   59 (63)
Q Consensus        19 k~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeScv~~   59 (63)
                      +..++.||++...+++   +.... +-|||.+|.-+...+.
T Consensus        31 r~~s~~el~~kl~~~~---~~~~~-~~lky~Lp~edld~Li   67 (97)
T cd06410          31 RSISFKELVSKLSELF---GAGVV-VTLKYQLPDEDLDALI   67 (97)
T ss_pred             CCCCHHHHHHHHHHHh---CCCCc-eEEEEEcCCCCcceeE
Confidence            4578999999887775   44444 6799999988766443


No 11 
>PF07541 EIF_2_alpha:  Eukaryotic translation initiation factor 2 alpha subunit;  InterPro: IPR011488 In Eukaryota and Archaea, translation initiation factor 2 (eIF2/aIF2), which contains three subunits (alpha, beta and gamma), is pivotal for binding of charged initiator tRNA to the small ribosomal subunit. This entry represents the alpha subunit of both eukaryota and archaeal translation initiator factor 2.; GO: 0003723 RNA binding, 0003743 translation initiation factor activity, 0005850 eukaryotic translation initiation factor 2 complex; PDB: 2QN6_B 3CW2_C 2AHO_B 3QSY_B 3V11_B 2QMU_B 1YZ7_A 1YZ6_A 3AEV_A 1KL9_A ....
Probab=39.64  E-value=56  Score=20.94  Aligned_cols=30  Identities=27%  Similarity=0.456  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHcCCccceeeeeecc-cCcc
Q psy7097          25 DLVQETLQILERHGGEDACIYIKYMI-PTYE   54 (63)
Q Consensus        25 dLI~eTL~~lEr~GG~dAfinIKymV-PTYe   54 (63)
                      |.|-++|..-|..+.+|+=+.|+|.- |.|-
T Consensus        76 e~IK~aL~~~~~~~~~~~~v~I~~igaP~Y~  106 (114)
T PF07541_consen   76 EAIKKALRAAEEASTEDVPVKIKLIGAPRYR  106 (114)
T ss_dssp             HHHHHHHHHHHHCCCTTCCEEEEEECTTEEE
T ss_pred             HHHHHHHHHHHhcCCCCCeEEEEEECCCeEE
Confidence            57899999999999999999999987 4553


No 12 
>PF10258 RNA_GG_bind:  PHAX RNA-binding domain;  InterPro: IPR019385 The phosphorylated adaptor for RNA export (PHAX) protein transports U3 snoRNA from the nucleus after transcription []. This entry represents the highly conserved U3 snoRNA-binding domain of PHAX, which is characterised by having two pairs of adjacent glycines with the sequence motif GGx12GG.; PDB: 2XC7_A 2W4S_B.
Probab=39.49  E-value=27  Score=21.93  Aligned_cols=17  Identities=35%  Similarity=0.704  Sum_probs=12.8

Q ss_pred             hhHHHHHHHHHHHHcCCc
Q psy7097          23 IGDLVQETLQILERHGGE   40 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG~   40 (63)
                      .-+|.+||.+ .|+.||-
T Consensus        30 ~~~l~~et~~-Ie~~GG~   46 (87)
T PF10258_consen   30 ALELLNETMK-IEKNGGM   46 (87)
T ss_dssp             HHHHHHHHHH-HHHCT-E
T ss_pred             HHHHHHHHHH-HHHcCCe
Confidence            3578899988 8999993


No 13 
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional
Probab=38.53  E-value=25  Score=26.79  Aligned_cols=24  Identities=33%  Similarity=0.580  Sum_probs=20.5

Q ss_pred             cccccCChhHHH-------HHHHHHHHHcCC
Q psy7097          16 SQMKRENIGDLV-------QETLQILERHGG   39 (63)
Q Consensus        16 ~qrk~~nlGdLI-------~eTL~~lEr~GG   39 (63)
                      .|..|.++.+++       ||.|.+||-+|.
T Consensus        77 ~e~~r~~~~~~~~an~~r~qea~rvlee~~k  107 (347)
T PRK02615         77 QEEQRSTLEQVVSANAARVQEALRVLEEYGK  107 (347)
T ss_pred             hhhcccCHHHHHHHHHHHHHHHHHHHHHHHc
Confidence            456778999997       899999999885


No 14 
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]
Probab=38.41  E-value=45  Score=21.59  Aligned_cols=29  Identities=31%  Similarity=0.285  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHcCCccceeeeeecccCcc
Q psy7097          26 LVQETLQILERHGGEDACIYIKYMIPTYE   54 (63)
Q Consensus        26 LI~eTL~~lEr~GG~dAfinIKymVPTYe   54 (63)
                      -...|+..||.||-+=.|++++-.-||=+
T Consensus        13 t~rka~~~L~~~gi~~~~~~y~~~~~s~~   41 (117)
T COG1393          13 TCRKALAWLEEHGIEYTFIDYLKTPPSRE   41 (117)
T ss_pred             HHHHHHHHHHHcCCCcEEEEeecCCCCHH
Confidence            46789999999999999999998888743


No 15 
>PF12651 RHH_3:  Ribbon-helix-helix domain
Probab=38.32  E-value=25  Score=19.20  Aligned_cols=20  Identities=20%  Similarity=0.162  Sum_probs=16.4

Q ss_pred             ccccccCChhHHHHHHHHHH
Q psy7097          15 YSQMKRENIGDLVQETLQIL   34 (63)
Q Consensus        15 y~qrk~~nlGdLI~eTL~~l   34 (63)
                      ++...+.+..+||.|+|+.+
T Consensus        20 ls~~t~i~~S~Ll~eAle~~   39 (44)
T PF12651_consen   20 LSEETGIPKSKLLREALEDY   39 (44)
T ss_pred             HHHHHCCCHHHHHHHHHHHH
Confidence            45677788999999999865


No 16 
>PF00367 PTS_EIIB:  phosphotransferase system, EIIB;  InterPro: IPR018113 The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) [, ] is a major carbohydrate transport system in bacteria. The PTS catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. The general mechanism of the PTS is the following: a phosphoryl group from phosphoenolpyruvate (PEP) is transferred to enzyme-I (EI) of PTS which in turn transfers it to a phosphoryl carrier protein (HPr). Phospho-HPr then transfers the phosphoryl group to a sugar-specific permease which consists of at least three structurally distinct domains (IIA, IIB, and IIC) [] which can either be fused together in a single polypeptide chain or exist as two or three interactive chains, formerly called enzymes II (EII) and III (EIII). The first domain (IIA) carries the first permease-specific phoshorylation site, a histidine, which is phosphorylated by phospho-HPr. The second domain (IIB) is phosphorylated by phospho-IIA on a cysteinyl or histidyl residue, depending on the permease. Finally, the phosphoryl group is transferred from the IIB domain to the sugar substrate in a process catalyzed by the IIC domain; this process is coupled to the transmembrane transport of the sugar. This entry covers the phosphorylation site of EIIB domains. ; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity; PDB: 3IPJ_B 3BP3_A 1O2F_B 3BP8_C 1IBA_A.
Probab=37.46  E-value=47  Score=17.62  Aligned_cols=21  Identities=43%  Similarity=0.675  Sum_probs=13.9

Q ss_pred             HHHHHHcCCccceeeeeecccCcceeee
Q psy7097          31 LQILERHGGEDACIYIKYMIPTYESCIL   58 (63)
Q Consensus        31 L~~lEr~GG~dAfinIKymVPTYeScv~   58 (63)
                      -+++|-.||.+   ||+-+    ..|+.
T Consensus         2 ~~il~~lGG~~---NI~~v----~~C~T   22 (35)
T PF00367_consen    2 KQILEALGGKE---NIKSV----TNCAT   22 (35)
T ss_dssp             HHHHHHCTTCC---CEEEE----EE-SS
T ss_pred             hHHHHHhCCHH---HHHHH----hcCcc
Confidence            36889999998   56644    35663


No 17 
>PF04639 Baculo_E56:  Baculoviral E56 protein, specific to ODV envelope;  InterPro: IPR006733 This family represents the E56 protein, which is localized to the occlusion derived virus (ODV) envelope, but not to the budded virus (BV) envelope []. Signals necessary for transport and/or retention into this structure are believed to be found within the C-terminal portion of ODV-E56.; GO: 0019031 viral envelope
Probab=36.70  E-value=35  Score=26.52  Aligned_cols=38  Identities=26%  Similarity=0.436  Sum_probs=25.8

Q ss_pred             ChhHHHHHHHHHHHHcCCccce------eeeeecccCcceeeee
Q psy7097          22 NIGDLVQETLQILERHGGEDAC------IYIKYMIPTYESCILR   59 (63)
Q Consensus        22 nlGdLI~eTL~~lEr~GG~dAf------inIKymVPTYeScv~~   59 (63)
                      +.++|||+-.+.|-|+||.=-+      -+|.-.+=.|.||-+.
T Consensus       128 ~~a~LvqdIi~AlNrTGGSyy~~G~nggd~ie~ClL~~RtC~~~  171 (305)
T PF04639_consen  128 SAATLVQDIIDALNRTGGSYYYRGNNGGDNIESCLLRYRTCGMD  171 (305)
T ss_pred             EHHHHHHHHHHHHHhCCCeeEEEccCCCceeeeeeEeccccCCC
Confidence            5689999999999999985221      1455555555555443


No 18 
>PF10209 DUF2340:  Uncharacterized conserved protein (DUF2340);  InterPro: IPR018794  This entry consists of small proteins of approximately 150 amino acids whose function is unknown. 
Probab=35.22  E-value=52  Score=22.36  Aligned_cols=29  Identities=21%  Similarity=0.289  Sum_probs=26.5

Q ss_pred             cCChhHHHHHHHHHHHHcCCccceeeeee
Q psy7097          20 RENIGDLVQETLQILERHGGEDACIYIKY   48 (63)
Q Consensus        20 ~~nlGdLI~eTL~~lEr~GG~dAfinIKy   48 (63)
                      ...++||++...+.....||--+|.|.+|
T Consensus        26 ~~Tv~~l~~~v~~~I~t~~~~~Pfrn~~y   54 (122)
T PF10209_consen   26 DTTVKDLKEQVKQDIKTRPGLPPFRNVKY   54 (122)
T ss_pred             cCcHHHHHHHHHHHHhcCCCCCCceeeec
Confidence            46789999999999999999999999865


No 19 
>PF01910 DUF77:  Domain of unknown function DUF77;  InterPro: IPR002767 This entry contains several hypothetical proteins of unknown function found in archaebacteria, eukaryotes and eubacteria. The structures of YBL001c from Saccharomyces cerevisiae and its homologue MTH1187 from the archaea Methanobacterium thermoautotrophicum have been determined []. These proteins have a ferredoxin-like alpha/beta sandwich structure with anti-parallel beta-sheets. Generally, they have two domains that form a single beta-sheet dimer, where two dimers pack sheet-to-sheet into a tetramer, some proteins having an extra C-terminal helix. ; PDB: 1LXJ_A 1YQH_A 2EKY_G 2EPI_A 1VK8_D 2IBO_C 1LXN_B.
Probab=35.19  E-value=53  Score=20.38  Aligned_cols=27  Identities=22%  Similarity=0.305  Sum_probs=23.8

Q ss_pred             ChhHHHHHHHHHHHHcCCccceeeeee
Q psy7097          22 NIGDLVQETLQILERHGGEDACIYIKY   48 (63)
Q Consensus        22 nlGdLI~eTL~~lEr~GG~dAfinIKy   48 (63)
                      .+.++|.+..+.+.+.|.+..+.+||.
T Consensus        48 ev~~~i~~~~e~~~~~G~~Rv~t~ikI   74 (92)
T PF01910_consen   48 EVMALIKEAHEALFEAGAKRVVTVIKI   74 (92)
T ss_dssp             HHHHHHHHHHHHHHCTTSSEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHcCCCeEEEEEEE
Confidence            377889999999999999999999986


No 20 
>PF12692 Methyltransf_17:  S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B.
Probab=33.17  E-value=38  Score=24.14  Aligned_cols=24  Identities=38%  Similarity=0.556  Sum_probs=17.3

Q ss_pred             hhHHHHHHHHHHHHcCCccceeeee
Q psy7097          23 IGDLVQETLQILERHGGEDACIYIK   47 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG~dAfinIK   47 (63)
                      +|| |.|||..+++.|..-|+++.-
T Consensus        77 lGd-i~~tl~~~~~~g~~a~laHaD  100 (160)
T PF12692_consen   77 LGD-IRETLPALARFGAGAALAHAD  100 (160)
T ss_dssp             ES--HHHHHHHHHHH-S-EEEEEE-
T ss_pred             ecc-HHHHhHHHHhcCCceEEEEee
Confidence            344 689999999999999998753


No 21 
>PF04009 DUF356:  Protein of unknown function (DUF356);  InterPro: IPR007154 Members of this family are around 120 amino acids in length and are found in some archaebacteria. The function of this family is unknown. However it contains a conserved motif IHPPAH that may be involved in its function.
Probab=32.26  E-value=40  Score=22.58  Aligned_cols=29  Identities=34%  Similarity=0.458  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHcCCccceeeeeecccCc
Q psy7097          25 DLVQETLQILERHGGEDACIYIKYMIPTY   53 (63)
Q Consensus        25 dLI~eTL~~lEr~GG~dAfinIKymVPTY   53 (63)
                      +-+.-+|.-||||||-.--..=|.|.|.+
T Consensus        10 ~K~~~ALaDleRh~~l~i~gkPrii~p~~   38 (107)
T PF04009_consen   10 DKILNALADLERHGGLKIRGKPRIIPPEY   38 (107)
T ss_pred             HHHHHHHHHHHHhcCCeEecCCcccChHH
Confidence            44667899999999987777777777755


No 22 
>cd04385 RhoGAP_ARAP RhoGAP_ARAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in ARAPs. ARAPs (also known as centaurin deltas) contain, besides the RhoGAP domain, an Arf GAP, ankyrin repeat ras-associating, and PH domains. Since their ArfGAP activity is PIP3-dependent, ARAPs are considered integration points for phosphoinositide, Arf and Rho signaling. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=32.16  E-value=54  Score=21.98  Aligned_cols=32  Identities=22%  Similarity=0.439  Sum_probs=27.7

Q ss_pred             CCCcccccccccCChhHHHHHHHHHHHHcCCc
Q psy7097           9 TGDAIDYSQMKRENIGDLVQETLQILERHGGE   40 (63)
Q Consensus         9 ~gD~idy~qrk~~nlGdLI~eTL~~lEr~GG~   40 (63)
                      .|+.+++-|..+..+--.|...++.||++|..
T Consensus         1 ~~~~l~~~~~~~~~iP~~v~~~i~~l~~~g~~   32 (184)
T cd04385           1 DGPALEDQQLTDNDIPVIVDKCIDFITQHGLM   32 (184)
T ss_pred             CCccHHHhhhCCCCCChHHHHHHHHHHHhCCC
Confidence            37788888888899999999999999999864


No 23 
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=31.73  E-value=50  Score=26.64  Aligned_cols=37  Identities=16%  Similarity=0.331  Sum_probs=28.9

Q ss_pred             CCCCCcccccccccCChhHHHHHHHHHHHHcCCccceeeeee
Q psy7097           7 KNTGDAIDYSQMKRENIGDLVQETLQILERHGGEDACIYIKY   48 (63)
Q Consensus         7 ~n~gD~idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfinIKy   48 (63)
                      .|-+|.++|+|.|   ..++..+...+++..|=..+  |+++
T Consensus       152 vNKMD~v~wde~r---f~ei~~~v~~l~k~~G~~~~--~v~F  188 (428)
T COG5256         152 VNKMDLVSWDEER---FEEIVSEVSKLLKMVGYNPK--DVPF  188 (428)
T ss_pred             EEcccccccCHHH---HHHHHHHHHHHHHHcCCCcc--CCeE
Confidence            3778999999866   77888888888888887766  4444


No 24 
>PRK15463 cold shock-like protein CspF; Provisional
Probab=31.55  E-value=22  Score=21.12  Aligned_cols=15  Identities=20%  Similarity=0.226  Sum_probs=12.0

Q ss_pred             cCCccceeeeeeccc
Q psy7097          37 HGGEDACIYIKYMIP   51 (63)
Q Consensus        37 ~GG~dAfinIKymVP   51 (63)
                      .||+|+|++|+-.-.
T Consensus        25 ~g~~DvFvH~sal~~   39 (70)
T PRK15463         25 DGRKDVQVHISALNL   39 (70)
T ss_pred             CCCccEEEEehhhhh
Confidence            478999999987653


No 25 
>PF13348 Y_phosphatase3C:  Tyrosine phosphatase family C-terminal region; PDB: 1YWF_A 2OZ5_B.
Probab=30.46  E-value=32  Score=19.30  Aligned_cols=21  Identities=14%  Similarity=0.431  Sum_probs=16.6

Q ss_pred             hHHHHHHHHHHH-HcCCcccee
Q psy7097          24 GDLVQETLQILE-RHGGEDACI   44 (63)
Q Consensus        24 GdLI~eTL~~lE-r~GG~dAfi   44 (63)
                      .+-+..+|+.++ ++||.++|.
T Consensus        28 ~e~l~~~l~~i~~~yGs~e~Yl   49 (68)
T PF13348_consen   28 PEYLEAALDAIDERYGSVENYL   49 (68)
T ss_dssp             HHHHHHHHHHHHHHHSSHHHHH
T ss_pred             HHHHHHHHHHHHHHcCCHHHHH
Confidence            456778888887 699999886


No 26 
>PF00755 Carn_acyltransf:  Choline/Carnitine o-acyltransferase;  InterPro: IPR000542 A number of eukaryotic acetyltransferases can, on the basis of sequence similarities, be grouped together into a family. These enzymes include:   Choline o-acetyltransferase 2.3.1.6 from EC, an enzyme that catalyses the biosynthesis of the neurotransmitter acetylcholine []. Carnitine o-acetyltransferase 2.3.1.7 from EC []. Peroxisomal carnitine octanoyltransferase 2.3.1.137 from EC, a fatty acid beta-oxidation pathway enzyme which is involved in the transport of medium-chain acyl-coenzyme A's from peroxisome to mitochondria []. Mitochondrial carnitine palmitoyltransferases I and II 2.3.1.21 from EC (CPT), enzymes involved in fatty acid metabolism and transport [].  Mycoplasma pneumoniae putative acetyltransferase C09_orf600.  ; GO: 0016746 transferase activity, transferring acyl groups; PDB: 2DEB_B 2H4T_A 2FW3_A 2RCU_B 2FYO_A 1S5O_A 1NM8_A 1T7Q_B 2H3W_B 1NDI_B ....
Probab=29.96  E-value=9.1  Score=30.14  Aligned_cols=33  Identities=33%  Similarity=0.421  Sum_probs=17.2

Q ss_pred             ccCChhHHHHHHHHHH--HHcCCccceeeeeecccCcceeeeee
Q psy7097          19 KRENIGDLVQETLQIL--ERHGGEDACIYIKYMIPTYESCILRY   60 (63)
Q Consensus        19 k~~nlGdLI~eTL~~l--Er~GG~dAfinIKymVPTYeScv~~~   60 (63)
                      .+.+--..||=+||+-  .-||         ..+||||||.++.
T Consensus       400 ~~~spDa~iQ~alQLA~~r~~g---------~~~~tyEs~stR~  434 (591)
T PF00755_consen  400 FKVSPDAFIQMALQLAYYRLHG---------KFPPTYESASTRH  434 (591)
T ss_dssp             TTS-HHHHHHHHHHHHHHHHHS---------S---EEEEEE-TT
T ss_pred             CCCCccHHHHHHHHHHHHHHcC---------CcchhhhhhhHHH
Confidence            3445556677666652  2333         4579999998763


No 27 
>PF14208 DUF4320:  Domain of unknown function (DUF4320)
Probab=29.77  E-value=49  Score=21.65  Aligned_cols=21  Identities=29%  Similarity=0.523  Sum_probs=17.9

Q ss_pred             CChhHHHHHHHHHHHHcCCcc
Q psy7097          21 ENIGDLVQETLQILERHGGED   41 (63)
Q Consensus        21 ~nlGdLI~eTL~~lEr~GG~d   41 (63)
                      ..+-+.-+|++...|++||-.
T Consensus        23 ~ql~~~a~e~v~~aE~~Gg~~   43 (116)
T PF14208_consen   23 QQLNTFAQELVRQAEREGGVT   43 (116)
T ss_pred             HHHHHHHHHHHHHHHHhCCCc
Confidence            347788899999999999975


No 28 
>PRK15464 cold shock-like protein CspH; Provisional
Probab=28.63  E-value=28  Score=20.84  Aligned_cols=15  Identities=20%  Similarity=0.423  Sum_probs=12.0

Q ss_pred             cCCccceeeeeeccc
Q psy7097          37 HGGEDACIYIKYMIP   51 (63)
Q Consensus        37 ~GG~dAfinIKymVP   51 (63)
                      -||+|+|++|+-.-+
T Consensus        25 ~g~~DvFvH~s~l~~   39 (70)
T PRK15464         25 DGRKEVQVHISAFTP   39 (70)
T ss_pred             CCCccEEEEehhehh
Confidence            478999999987753


No 29 
>KOG4603|consensus
Probab=28.09  E-value=29  Score=25.55  Aligned_cols=32  Identities=28%  Similarity=0.324  Sum_probs=23.7

Q ss_pred             ccCCCCCcccccccccCCh-hHHHHHHHHHHHHcC
Q psy7097           5 LNKNTGDAIDYSQMKRENI-GDLVQETLQILERHG   38 (63)
Q Consensus         5 ~n~n~gD~idy~qrk~~nl-GdLI~eTL~~lEr~G   38 (63)
                      +--|+-|..+|=|+  .+| +..|++||+.|+..|
T Consensus        21 rP~ssq~v~~~lq~--e~lgktavqk~Ld~La~~G   53 (201)
T KOG4603|consen   21 RPYSSQDVFGNLQR--EHLGKTAVQKTLDQLAQQG   53 (201)
T ss_pred             CCCchHHHHHHHHH--HhccchHHHHHHHHHHHcC
Confidence            34466677777765  444 478999999999988


No 30 
>KOG3719|consensus
Probab=27.94  E-value=19  Score=30.31  Aligned_cols=28  Identities=32%  Similarity=0.431  Sum_probs=17.8

Q ss_pred             hhHHHHHHHHH--HHHcCCccceeeeeecccCcceeeee
Q psy7097          23 IGDLVQETLQI--LERHGGEDACIYIKYMIPTYESCILR   59 (63)
Q Consensus        23 lGdLI~eTL~~--lEr~GG~dAfinIKymVPTYeScv~~   59 (63)
                      -..+||-.+|+  +-.+|         -||+|||||...
T Consensus       443 PDs~vQlafQ~A~~alYg---------~~v~~yEscsT~  472 (638)
T KOG3719|consen  443 PDSVVQLAFQMAYYALYG---------RFVFTYESCSTA  472 (638)
T ss_pred             cHHHHHHHHHHHHHHHhc---------ccccccchhhHH
Confidence            34566666665  23333         489999999853


No 31 
>cd00447 NusB_Sun RNA binding domain of NusB (N protein-Utilization Substance B) and Sun (also known as RrmB or Fmu) proteins. This family includes two orthologous groups exemplified by the transcription termination factor NusB and the N-terminal domain of the rRNA-specific 5-methylcytidine transferase (m5C-methyltransferase) Sun. The NusB protein plays a key role in the regulation of ribosomal RNA biosynthesis in eubacteria by modulating the efficiency of transcriptional antitermination. NusB along with other Nus factors (NusA, NusE/S10 and NusG) forms the core complex with the boxA element of the nut site of the rRNA operons. These interactions help RNA polymerase to counteract polarity during transcription of rRNA operons and allow stable antitermination. The transcription antitermination system can be appropriated by some bacteriophages such as lambda, which use the system to switch between the lysogenic and lytic modes of phage propagation. The m5C-methyltransferase Sun shares the 
Probab=27.44  E-value=48  Score=20.34  Aligned_cols=24  Identities=17%  Similarity=0.360  Sum_probs=18.5

Q ss_pred             ChhHHHHHHHHHHHHcCCccc--eee
Q psy7097          22 NIGDLVQETLQILERHGGEDA--CIY   45 (63)
Q Consensus        22 nlGdLI~eTL~~lEr~GG~dA--fin   45 (63)
                      .---.|.|+.++-.+.+++.+  |+|
T Consensus        94 p~~~vineaVelak~~~~~~~~~fVN  119 (129)
T cd00447          94 PPPVAINEAVELAKRFGDDDSAKFVN  119 (129)
T ss_pred             CchhHHHHHHHHHHHHCCCCcchhHH
Confidence            456789999999998887765  554


No 32 
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles. The two main classes of vesicular carriers within the endocytic and the biosynthetic pathways are COP- and clathrin-coated vesicles. Formation of COPII vesicles requires the ordered assembly of the coat built from several cytosolic components GTPase Sar1, complexes of Sec23-Sec24 and Sec13-Sec31. The process is initiated by the conversion of GDP to GTP by the GTPase Sar1 which then recruits the heterodimeric complex of Sec23 and Sec24. This heterodimeric complex generates the pre-budding complex. The final step leading to membrane deformation and budding of COPII-coated vesicles is carried by the heterodimeric complex Sec13-Sec31. The members of this CD belong to the Sec23-like family. Sec 24 is very similar to Sec23. The Sec23 and Sec24 
Probab=27.03  E-value=66  Score=22.58  Aligned_cols=24  Identities=21%  Similarity=0.493  Sum_probs=20.7

Q ss_pred             ccccCChhHHHHHHHHHHHHcCCc
Q psy7097          17 QMKRENIGDLVQETLQILERHGGE   40 (63)
Q Consensus        17 qrk~~nlGdLI~eTL~~lEr~GG~   40 (63)
                      ++....+|..++-++.+|+..||.
T Consensus       111 ~~~~~c~G~Al~~A~~lL~~~GGk  134 (244)
T cd01479         111 KETESALGPALQAAFLLLKETGGK  134 (244)
T ss_pred             CCCcccHHHHHHHHHHHHHhcCCE
Confidence            345688999999999999999984


No 33 
>cd00620 Methyltransferase_Sun N-terminal RNA binding domain of the methyltransferase Sun. The rRNA-specific 5-methylcytidine transferase Sun, also known as RrmB or Fmu shares the RNA-binding non-catalytic domain with the transcription termination factor NusB. The precise biological role of this domain in Sun is unknown, although it is likely to be involved in sequence-specific RNA binding. The C-terminal methyltransferase domain of Sun has been shown to catalyze formation of m5C at position 967 of 16S rRNA in Escherichia coli.
Probab=26.07  E-value=48  Score=20.65  Aligned_cols=24  Identities=17%  Similarity=0.080  Sum_probs=18.3

Q ss_pred             ChhHHHHHHHHHHHHcCCccc--eee
Q psy7097          22 NIGDLVQETLQILERHGGEDA--CIY   45 (63)
Q Consensus        22 nlGdLI~eTL~~lEr~GG~dA--fin   45 (63)
                      .-...|+|+.++-.+.|++.+  |+|
T Consensus        91 p~~avvneaVelak~~~~~~~~~fVN  116 (126)
T cd00620          91 PPHAAVDETVEIAKIRKDLGRAGLVN  116 (126)
T ss_pred             CchHHHHHHHHHHHHhCCCchhhHHH
Confidence            345688999999999988776  544


No 34 
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]
Probab=25.75  E-value=82  Score=24.64  Aligned_cols=31  Identities=42%  Similarity=0.601  Sum_probs=23.3

Q ss_pred             CcccccccccCChhHHHHHHHHHHHHcCCcccee
Q psy7097          11 DAIDYSQMKRENIGDLVQETLQILERHGGEDACI   44 (63)
Q Consensus        11 D~idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfi   44 (63)
                      .+-+|+- .+..--+..++.+-.||  ||++||.
T Consensus        53 ~~~~Y~R-~~nPT~~~lE~~~a~LE--g~~~~~a   83 (396)
T COG0626          53 GGYDYSR-TGNPTRDALEEALAELE--GGEDAFA   83 (396)
T ss_pred             cCccccc-CCCccHHHHHHHHHHhh--CCCcEEE
Confidence            3567774 34556678899999999  9999874


No 35 
>PF04230 PS_pyruv_trans:  Polysaccharide pyruvyl transferase;  InterPro: IPR007345 Pyruvyl-transferases are involved in peptidoglycan-associated polymer biosynthesis. CsaB in Bacillus anthracis is necessary for the non-covalent anchoring of proteins containing an SLH (S-layer homology) domain to peptidoglycan-associated pyruvylated polysaccharides. WcaK and AmsJ are involved in the biosynthesis of colanic acid in Escherichia coli and of amylovoran in Erwinia amylovora [, ].
Probab=25.62  E-value=1e+02  Score=19.44  Aligned_cols=28  Identities=43%  Similarity=0.543  Sum_probs=18.7

Q ss_pred             ChhHH--HHHHHHHHHHcCCccceeeeeecc
Q psy7097          22 NIGDL--VQETLQILERHGGEDACIYIKYMI   50 (63)
Q Consensus        22 nlGdL--I~eTL~~lEr~GG~dAfinIKymV   50 (63)
                      |+||.  .+.+++.|++++ +++-+-+-..-
T Consensus         1 N~GD~~i~~~~~~~l~~~~-~~~~~~~~~~~   30 (286)
T PF04230_consen    1 NIGDDLILEALLKLLKKHG-PDAEIIIFSPD   30 (286)
T ss_pred             CchHHHHHHHHHHHHHhcC-CceEEEEeCCC
Confidence            45553  467899999999 77755444333


No 36 
>KOG0699|consensus
Probab=25.24  E-value=54  Score=27.07  Aligned_cols=40  Identities=28%  Similarity=0.498  Sum_probs=27.8

Q ss_pred             CCCCcccccccccCChhHHHHHH----HHHHHHcCCccceeeeeecccCc
Q psy7097           8 NTGDAIDYSQMKRENIGDLVQET----LQILERHGGEDACIYIKYMIPTY   53 (63)
Q Consensus         8 n~gD~idy~qrk~~nlGdLI~eT----L~~lEr~GG~dAfinIKymVPTY   53 (63)
                      --++..||.   .....+||+|.    -++|+|+||...   =|-|.|.|
T Consensus       123 ~~aeaDd~d---eed~a~l~EEa~~pl~ElL~rY~G~~~---hK~~~sp~  166 (542)
T KOG0699|consen  123 AGAEADDED---EEDRADLIEEASVPLAELLKRYGGAGV---HKSLLSPF  166 (542)
T ss_pred             ccccccccc---hHHHHHHHHhccCcHHHHHHHhcCCCc---cccccChh
Confidence            345667776   35678899885    489999999654   35565544


No 37 
>COG2345 Predicted transcriptional regulator [Transcription]
Probab=25.10  E-value=33  Score=24.94  Aligned_cols=25  Identities=36%  Similarity=0.531  Sum_probs=22.3

Q ss_pred             cCChhHHHHHHHHHHHHcCCcccee
Q psy7097          20 RENIGDLVQETLQILERHGGEDACI   44 (63)
Q Consensus        20 ~~nlGdLI~eTL~~lEr~GG~dAfi   44 (63)
                      ....++|+...|..||..||+|++-
T Consensus        82 ~~~y~~l~~~~l~~l~~~~G~~~l~  106 (218)
T COG2345          82 PKRYGELALALLDALEETGGEEALN  106 (218)
T ss_pred             chhhHHHHHHHHHHHHHhccHHHHH
Confidence            4678999999999999999999864


No 38 
>PF13730 HTH_36:  Helix-turn-helix domain
Probab=25.10  E-value=66  Score=17.00  Aligned_cols=14  Identities=36%  Similarity=0.532  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHcC
Q psy7097          25 DLVQETLQILERHG   38 (63)
Q Consensus        25 dLI~eTL~~lEr~G   38 (63)
                      .=|+..|..||..|
T Consensus        40 ~Tv~~~i~~L~~~G   53 (55)
T PF13730_consen   40 RTVQRAIKELEEKG   53 (55)
T ss_pred             HHHHHHHHHHHHCc
Confidence            45788899999887


No 39 
>TIGR01951 nusB transcription antitermination factor NusB. A transcription antitermination complex active in many bacteria was designated N-utilization substance (Nus) in E. coli because of its interaction with phage lambda protein N. This model represents NusB. Other components are NusA and NusG. NusE is, in fact, ribosomal protein S10.
Probab=24.60  E-value=54  Score=20.25  Aligned_cols=24  Identities=17%  Similarity=0.419  Sum_probs=18.0

Q ss_pred             ChhHHHHHHHHHHHHcCCccc--eee
Q psy7097          22 NIGDLVQETLQILERHGGEDA--CIY   45 (63)
Q Consensus        22 nlGdLI~eTL~~lEr~GG~dA--fin   45 (63)
                      .-...|.|+.++-.+++++.+  |+|
T Consensus        95 p~~avineaV~lak~~~~~~~~~fVN  120 (129)
T TIGR01951        95 PYKVVINEAVELAKKFGDEDSHKFVN  120 (129)
T ss_pred             CCcchHHHHHHHHHHHCCCCchhhHH
Confidence            456789999999988877664  554


No 40 
>PF06751 EutB:  Ethanolamine ammonia lyase large subunit (EutB);  InterPro: IPR010628 This family consists of several bacterial ethanolamine ammonia lyase large subunit (EutB) proteins. Ethanolamine ammonia-lyase is a bacterial enzyme that catalyses the adenosylcobalamin-dependent conversion of certain vicinal amino alcohols to oxo compounds and ammonia. The enzyme is a heterodimer composed of subunits of Mr approximately 55,000 (EutB) and 35,000 (EutC) [].; GO: 0008851 ethanolamine ammonia-lyase activity, 0006520 cellular amino acid metabolic process; PDB: 3ABQ_C 3ABS_C 3AO0_A 3ABR_A 3ABO_C 3ANY_A 2QEZ_B.
Probab=23.71  E-value=33  Score=27.89  Aligned_cols=13  Identities=46%  Similarity=1.022  Sum_probs=8.1

Q ss_pred             eeecccCcceeeee
Q psy7097          46 IKYMIPTYESCILR   59 (63)
Q Consensus        46 IKymVPTYeScv~~   59 (63)
                      -+|-||| |+||+-
T Consensus       204 ~~~~IPt-Q~CVL~  216 (444)
T PF06751_consen  204 QRFEIPT-QSCVLA  216 (444)
T ss_dssp             HHCT-SS--EEE-S
T ss_pred             HHhCCCC-cceEee
Confidence            4788999 899974


No 41 
>KOG3219|consensus
Probab=23.67  E-value=69  Score=23.37  Aligned_cols=19  Identities=32%  Similarity=0.585  Sum_probs=16.2

Q ss_pred             CChhHHHHHHHHHHHHcCC
Q psy7097          21 ENIGDLVQETLQILERHGG   39 (63)
Q Consensus        21 ~nlGdLI~eTL~~lEr~GG   39 (63)
                      .=+||+|+++|.+-|..|=
T Consensus       144 vFVGEvVEeAl~V~~~~~e  162 (195)
T KOG3219|consen  144 VFVGEVVEEALDVREEWGE  162 (195)
T ss_pred             HhHHHHHHHHHHHHHHhcc
Confidence            3479999999999998873


No 42 
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=23.64  E-value=89  Score=17.64  Aligned_cols=16  Identities=31%  Similarity=0.534  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHcCCc
Q psy7097          25 DLVQETLQILERHGGE   40 (63)
Q Consensus        25 dLI~eTL~~lEr~GG~   40 (63)
                      +-...+..+||++||+
T Consensus         6 ~Y~~~~~~~l~~~GG~   21 (65)
T PF07045_consen    6 EYREAVPPILEKYGGR   21 (65)
T ss_dssp             HHHHHHHHHHHHTT-E
T ss_pred             HHHHHHHHHHHHcCCE
Confidence            4455677889999997


No 43 
>COG4718 Phage-related protein [Function unknown]
Probab=23.56  E-value=65  Score=21.76  Aligned_cols=21  Identities=29%  Similarity=0.488  Sum_probs=17.7

Q ss_pred             hHHHHHHHHHHHHcCCcccee
Q psy7097          24 GDLVQETLQILERHGGEDACI   44 (63)
Q Consensus        24 GdLI~eTL~~lEr~GG~dAfi   44 (63)
                      .+.|..-..-|.||||-.||-
T Consensus        54 ~~~~~~l~aFL~rHgg~ksFl   74 (111)
T COG4718          54 KEEIRPLEAFLSRHGGVKAFL   74 (111)
T ss_pred             HHHhhhHHHHHHhcCcEEEEE
Confidence            467888888899999999984


No 44 
>PF09651 Cas_APE2256:  CRISPR-associated protein (Cas_APE2256);  InterPro: IPR013442 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   This entry represents a conserved region of about 150 amino acids found in a family of Cas proteins in at least five archaeal and three bacterial species. In six of eight species, the protein is encoded the vicinity of a CRISPR/Cas locus.; PDB: 3QYF_A.
Probab=23.44  E-value=73  Score=20.79  Aligned_cols=25  Identities=12%  Similarity=0.195  Sum_probs=21.0

Q ss_pred             ChhHHHHHHHHHHH--HcCCccceeee
Q psy7097          22 NIGDLVQETLQILE--RHGGEDACIYI   46 (63)
Q Consensus        22 nlGdLI~eTL~~lE--r~GG~dAfinI   46 (63)
                      -|.+|+....+.+.  +.+|.+.++|+
T Consensus        72 Gl~~Lv~~~~~~v~~~~~~~~~v~~n~   98 (136)
T PF09651_consen   72 GLRNLVRWVAEEVKNYKGRGYEVIFNA   98 (136)
T ss_dssp             HHHHHHHHTHHHHHHHHHTT-EEEEE-
T ss_pred             HHHHHHHHHHHHHHHhhcCCCeEEEEe
Confidence            49999999999998  89999999986


No 45 
>PF14066 DUF4256:  Protein of unknown function (DUF4256)
Probab=23.43  E-value=52  Score=23.78  Aligned_cols=14  Identities=43%  Similarity=0.615  Sum_probs=11.5

Q ss_pred             HHHHHHHHcCCccc
Q psy7097          29 ETLQILERHGGEDA   42 (63)
Q Consensus        29 eTL~~lEr~GG~dA   42 (63)
                      -+|.-+|++||+--
T Consensus        36 wsL~eME~TgGEPD   49 (173)
T PF14066_consen   36 WSLNEMERTGGEPD   49 (173)
T ss_pred             HHHHHHHHhCCCCC
Confidence            47889999999754


No 46 
>KOG2449|consensus
Probab=23.31  E-value=31  Score=24.57  Aligned_cols=42  Identities=21%  Similarity=0.243  Sum_probs=29.6

Q ss_pred             cCCCCCcccccc-cccCChhHHHHHHHHHHHHcCCccceeeeeecccCcceee
Q psy7097           6 NKNTGDAIDYSQ-MKRENIGDLVQETLQILERHGGEDACIYIKYMIPTYESCI   57 (63)
Q Consensus         6 n~n~gD~idy~q-rk~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeScv   57 (63)
                      ..|.|+.-+-+- +-+.+|-.|||.          ++-..+.+..+|+|+-|-
T Consensus        23 ~v~~g~kp~tD~~a~~~ri~~liqS----------~~~~~~r~~yl~~ya~~~   65 (157)
T KOG2449|consen   23 KVNAGEKPQTDKYAPKVRIDKLIQS----------EDPLDGRFIYLPGYAEGN   65 (157)
T ss_pred             EeccCCCCCccchhHHHHHHHHhcC----------cCccCCceEEeeccccCC
Confidence            345555443221 234778899988          488899999999999875


No 47 
>PF11573 Med23:  Mediator complex subunit 23;  InterPro: IPR021629  Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice. 
Probab=22.97  E-value=40  Score=30.59  Aligned_cols=34  Identities=24%  Similarity=0.325  Sum_probs=26.2

Q ss_pred             cccccCChhHHHHHHHHHHHHcCCc-------------cceeeeeec
Q psy7097          16 SQMKRENIGDLVQETLQILERHGGE-------------DACIYIKYM   49 (63)
Q Consensus        16 ~qrk~~nlGdLI~eTL~~lEr~GG~-------------dAfinIKym   49 (63)
                      .+.+.+.++|+..+-.++|++-...             |-|=|||||
T Consensus      1292 ~~er~~~~~~i~i~ly~~l~~vd~~~~~~~l~~~d~ICDllYhiKYm 1338 (1341)
T PF11573_consen 1292 MRERTRCLMDITIELYELLKQVDKAQEGVELKYEDPICDLLYHIKYM 1338 (1341)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHhhhcccCccceehhhHHHHhhhheee
Confidence            4556789999999999999986555             456677877


No 48 
>COG0694 Thioredoxin-like proteins and domains [Posttranslational modification, protein turnover, chaperones]
Probab=22.78  E-value=63  Score=20.73  Aligned_cols=26  Identities=27%  Similarity=0.331  Sum_probs=19.7

Q ss_pred             hhHHHHHHHH-----HHHHcCCccceeeeee
Q psy7097          23 IGDLVQETLQ-----ILERHGGEDACIYIKY   48 (63)
Q Consensus        23 lGdLI~eTL~-----~lEr~GG~dAfinIKy   48 (63)
                      +-+.|++.|+     .|.++||.=+++.|+-
T Consensus        10 ~~e~v~~~l~~~irP~l~~dGGdve~~~i~~   40 (93)
T COG0694          10 LLERVEEVLDEKIRPQLAMDGGDVELVGIDE   40 (93)
T ss_pred             HHHHHHHHHHhccCcceeccCCeEEEEEEec
Confidence            3345566666     6789999999999984


No 49 
>smart00796 AHS1 Allophanate hydrolase subunit 1. This domain represents subunit 1 of allophanate hydrolase (AHS1).
Probab=22.25  E-value=1.4e+02  Score=20.79  Aligned_cols=45  Identities=11%  Similarity=0.231  Sum_probs=26.8

Q ss_pred             ccccccccCChhHHHHHHHHHHHHcCCccceeeeeecccCcceeeeeee
Q psy7097          13 IDYSQMKRENIGDLVQETLQILERHGGEDACIYIKYMIPTYESCILRYT   61 (63)
Q Consensus        13 idy~qrk~~nlGdLI~eTL~~lEr~GG~dAfinIKymVPTYeScv~~~~   61 (63)
                      ++|+..-...+-..|..--+.|++.    ..-.|.-+||+|.|....|.
T Consensus        13 v~~~~~~~~~~~~~v~~l~~~l~~~----~~~gi~e~vp~~~sllv~fd   57 (201)
T smart00796       13 VEFGDEIDLALNRRVLALARALRAA----PLPGVVELVPGYRSLLVHFD   57 (201)
T ss_pred             EEECCcCCHHHHHHHHHHHHHHHhc----CCCCeEEccccceEEEEEEc
Confidence            4454332233344445555555543    34468899999999987663


No 50 
>PRK12419 riboflavin synthase subunit beta; Provisional
Probab=22.15  E-value=1.2e+02  Score=21.11  Aligned_cols=28  Identities=11%  Similarity=0.272  Sum_probs=20.2

Q ss_pred             hhHHHHHHHHHHHHcCCccceeeeeeccc
Q psy7097          23 IGDLVQETLQILERHGGEDACIYIKYMIP   51 (63)
Q Consensus        23 lGdLI~eTL~~lEr~GG~dAfinIKymVP   51 (63)
                      ...|++-.++.|+++|.++.=+ --+.||
T Consensus        25 t~~Ll~gA~~~l~~~G~~~~~i-~v~~VP   52 (158)
T PRK12419         25 VDQARKGFVAEIAARGGAASQV-DIFDVP   52 (158)
T ss_pred             HHHHHHHHHHHHHHcCCCccce-EEEECC
Confidence            4568888999999999987633 223466


No 51 
>PF03511 Fanconi_A:  Fanconi anaemia group A protein;  InterPro: IPR003516 Fanconi anaemia (FA) [, , ] is a recessive inherited disease characterised by defective DNA repair. FA cells are sensitive to DNA cross-linking agents that cause chromosomal instability and cell death. The disease is manifested clinically by progressive pancytopenia, variable physical anomalies, and predisposition to malignancy []. Four complementation groups have been identified, designated A to D. The FA group A gene (FAA) has been cloned [], but its function remains to be elucidated.
Probab=22.08  E-value=89  Score=19.36  Aligned_cols=15  Identities=33%  Similarity=0.392  Sum_probs=13.3

Q ss_pred             hHHHHHHHHHHHHcC
Q psy7097          24 GDLVQETLQILERHG   38 (63)
Q Consensus        24 GdLI~eTL~~lEr~G   38 (63)
                      =|...|-|+.||+.|
T Consensus        33 ldiCaeIL~cLE~R~   47 (64)
T PF03511_consen   33 LDICAEILGCLEKRK   47 (64)
T ss_pred             HHHHHHHHHHHHhCC
Confidence            388999999999987


No 52 
>PRK09507 cspE cold shock protein CspE; Reviewed
Probab=22.04  E-value=47  Score=19.50  Aligned_cols=15  Identities=13%  Similarity=0.293  Sum_probs=12.2

Q ss_pred             cCCccceeeeeeccc
Q psy7097          37 HGGEDACIYIKYMIP   51 (63)
Q Consensus        37 ~GG~dAfinIKymVP   51 (63)
                      -||+|.|.+|+-..+
T Consensus        24 ~g~~dvfvH~s~l~~   38 (69)
T PRK09507         24 DGSKDVFVHFSAIQT   38 (69)
T ss_pred             CCCeeEEEEeecccc
Confidence            378999999988764


No 53 
>PRK13689 hypothetical protein; Provisional
Probab=22.03  E-value=1e+02  Score=19.53  Aligned_cols=20  Identities=35%  Similarity=0.625  Sum_probs=17.2

Q ss_pred             CChhHHHHHHHHHHHHcCCc
Q psy7097          21 ENIGDLVQETLQILERHGGE   40 (63)
Q Consensus        21 ~nlGdLI~eTL~~lEr~GG~   40 (63)
                      +-+..|+.|-+.+||+|.-|
T Consensus        10 ~qvE~il~el~~VLeKH~Ap   29 (75)
T PRK13689         10 EQVEQLLAELLAVLEKHKAP   29 (75)
T ss_pred             HHHHHHHHHHHHHHHhcCCC
Confidence            44889999999999999765


No 54 
>PF09290 AcetDehyd-dimer:  Prokaryotic acetaldehyde dehydrogenase, dimerisation;  InterPro: IPR015426 This C-terminal domain is found in prokaryotic acetaldehyde dehydrogenases, it adopts a structure consisting of an alpha-beta-alpha-beta(3) core, which mediates dimerisation of the protein []. The acetaldehyde dehydrogenase family of bacterial enzymes catalyses the formation of acetyl-CoA from acetaldehyde in the 3-hydroxyphenylpropinoate degradation pathway. It occurs as a late step in the meta-cleavage pathways of a variety of compounds, including catechol, biphenyl, toluene, salicylate [].; GO: 0008774 acetaldehyde dehydrogenase (acetylating) activity, 0019439 aromatic compound catabolic process, 0055114 oxidation-reduction process; PDB: 1NVM_F.
Probab=21.95  E-value=2.1e+02  Score=19.88  Aligned_cols=24  Identities=29%  Similarity=0.556  Sum_probs=20.0

Q ss_pred             ccCChhHHHHHHHHHHHHcCCccc
Q psy7097          19 KRENIGDLVQETLQILERHGGEDA   42 (63)
Q Consensus        19 k~~nlGdLI~eTL~~lEr~GG~dA   42 (63)
                      -|.||.|-++-|=..||+.||.+-
T Consensus        37 TR~NIDEft~TT~~ai~~vgGa~~   60 (137)
T PF09290_consen   37 TRANIDEFTETTARAIEQVGGAKR   60 (137)
T ss_dssp             HHTTHHHHHHHHHHHHHHTT--SS
T ss_pred             hhhhHHHHHHHHHHHHHHhcCccc
Confidence            468999999999999999999874


No 55 
>PF03235 DUF262:  Protein of unknown function DUF262;  InterPro: IPR004919 This entry is found in prokaryotic proteins of unknown function.
Probab=21.92  E-value=29  Score=22.19  Aligned_cols=14  Identities=36%  Similarity=0.567  Sum_probs=9.8

Q ss_pred             ceeeee--ecccCcce
Q psy7097          42 ACIYIK--YMIPTYES   55 (63)
Q Consensus        42 AfinIK--ymVPTYeS   55 (63)
                      .|-+++  |.||.||-
T Consensus         4 l~~~~~~~~~iP~yQR   19 (221)
T PF03235_consen    4 LFSNIKIGIVIPDYQR   19 (221)
T ss_pred             HHhCCCCCccCCCCCC
Confidence            344555  89999984


No 56 
>PRK11190 Fe/S biogenesis protein NfuA; Provisional
Probab=21.48  E-value=1.3e+02  Score=21.12  Aligned_cols=25  Identities=32%  Similarity=0.404  Sum_probs=20.4

Q ss_pred             hhHHHHHHHH-----HHHHcCCccceeeee
Q psy7097          23 IGDLVQETLQ-----ILERHGGEDACIYIK   47 (63)
Q Consensus        23 lGdLI~eTL~-----~lEr~GG~dAfinIK   47 (63)
                      +-+.|+++|+     .|..|||.=.++.|+
T Consensus       107 ~~~~i~~~l~~~irP~l~~dGGdielv~v~  136 (192)
T PRK11190        107 LMERVEYVLQSQINPQLAGHGGRVSLMEIT  136 (192)
T ss_pred             HHHHHHHHHHhccChhHHhcCCcEEEEEEc
Confidence            5667777776     689999999998886


No 57 
>PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional
Probab=21.15  E-value=53  Score=19.77  Aligned_cols=15  Identities=27%  Similarity=0.250  Sum_probs=12.0

Q ss_pred             cCCccceeeeeeccc
Q psy7097          37 HGGEDACIYIKYMIP   51 (63)
Q Consensus        37 ~GG~dAfinIKymVP   51 (63)
                      -||+|+|.+|.-.-+
T Consensus        22 ~gg~dVFvH~s~i~~   36 (74)
T PRK09937         22 GGGEDIFAHYSTIQM   36 (74)
T ss_pred             CCCccEEEEEeeccc
Confidence            478999999987653


No 58 
>TIGR03341 YhgI_GntY IscR-regulated protein YhgI. IscR (TIGR02010) is an iron-sulfur cluster-binding transcriptional regulator (see Genome Property GenProp0138). Members of this protein family include YhgI, whose expression is under control of IscR, and show sequence similarity to IscA, a known protein of iron-sulfur cluster biosynthesis. These two lines of evidence strongly suggest a role as an iron-sulfur cluster biosynthesis protein. An older study designated this protein GntY and suggested a role for it and for the product of an adjacent gene, based on complementation studies, in gluconate utilization.
Probab=20.67  E-value=1.3e+02  Score=20.90  Aligned_cols=25  Identities=28%  Similarity=0.445  Sum_probs=20.7

Q ss_pred             hhHHHHHHHH-----HHHHcCCccceeeee
Q psy7097          23 IGDLVQETLQ-----ILERHGGEDACIYIK   47 (63)
Q Consensus        23 lGdLI~eTL~-----~lEr~GG~dAfinIK   47 (63)
                      +-+.|++.|+     .|..|||.=.++.|+
T Consensus       106 ~~~~i~~~l~~~irP~l~~dGGdielv~v~  135 (190)
T TIGR03341       106 LEERINYVLQSEINPQLASHGGKVTLVEIT  135 (190)
T ss_pred             HHHHHHHHHHhccCHHHHhcCCceEEEEEc
Confidence            6777777775     689999999998876


No 59 
>PF14028 SpaB_C:  SpaB C-terminal domain
Probab=20.61  E-value=39  Score=23.21  Aligned_cols=9  Identities=44%  Similarity=0.807  Sum_probs=7.3

Q ss_pred             HHHcCCccc
Q psy7097          34 LERHGGEDA   42 (63)
Q Consensus        34 lEr~GG~dA   42 (63)
                      +||+||+++
T Consensus       101 ~eRYGG~~~  109 (283)
T PF14028_consen  101 IERYGGPAG  109 (283)
T ss_pred             hhhhcCchH
Confidence            689999876


No 60 
>PRK10943 cold shock-like protein CspC; Provisional
Probab=20.24  E-value=42  Score=19.69  Aligned_cols=15  Identities=13%  Similarity=0.255  Sum_probs=11.9

Q ss_pred             cCCccceeeeeeccc
Q psy7097          37 HGGEDACIYIKYMIP   51 (63)
Q Consensus        37 ~GG~dAfinIKymVP   51 (63)
                      .||+|.|.+|+-.-.
T Consensus        24 ~g~~dvFvH~s~l~~   38 (69)
T PRK10943         24 DGSKDVFVHFSAIQG   38 (69)
T ss_pred             CCCeeEEEEhhHccc
Confidence            378899999987654


Done!