Diaphorina citri psyllid: psy7158

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400--

MEPLLKWKEEKKKMEEEEEEKKNKKGEEEEEISMRLVHSLINVSNAAISLTDLGFFASHVKTLLNVDVGAKWRAEHVDVSHFYVNKDINHLISETEATVTSELEEGDRQKAMKRLRVPPLGEQQSPWTTFKVGLFLGCFAILFAIILLRVFFDTSQEDFKMAMRLYRGPLLIIQFIFLMGVNVYGWRSSGVNHVLIFELDPRNHLSEQHLMEISLIMGNVWALSLLCFFFSHVFSIPPYSQPVALLLIMLAFLLNPSRTLKYDARFWLLRVTPVALLLIMLAFLLNPSRTLKYDARFWLLRVTVKKDQSVMDNPFFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTEMKALLYQAMEEAPSLETTEPEVISRYFRMFDENFFHYYC

cccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHcHHHHHHHHHHHHcccccCEEEEEHHEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEECccccccccccccccEEEEEEEccccccEEEEEEEEEccccccccHHHHHHHHHHcccccccccc

******************************EISMRLVHSLINVSNAAISLTDLGFFASHVKTLLNVDVGAKWRAEHVDVSHFYVNKDINHLISETEATVTSELEEGDRQK***************PWTTFKVGLFLGCFAILFAIILLRVFFDTSQEDFKMAMRLYRGPLLIIQFIFLMGVNVYGWRSSGVNHVLIFELDPRNHLSEQHLMEISLIMGNVWALSLLCFFFSHVFSIPPYSQPVALLLIMLAFLLNPSRTLKYDARFWLLRVTPVALLLIMLAFLLNPSRTLKYDARFWLLRVTVKKDQSVMDNPFFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTEMKALLYQAMEEAPSLETTEPEVISRYFRMFDENFFHYYC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRLVHSLINVSNAAISLTDLGFFASHVKTLLNVDVGAKWRAEHVDVSHFYVNKDINHLISETEATVTSELEEGDRQKAMKRLRVPPLGEQQSPWTTFKVGLFLGCFAILFAIILLRVFFDTSQEDFKMAMRLYRGPLLIIQFIFLMGVNVYGWRSSGVNHVLIFELDPRNHLSEQHLMEISLIMGNVWALSLLCFFFSHVFSIPPYSQPVALLLIMLAFLLNPSRTLKYDARFWLLRVTPVALLLIMLAFLLNPSRTLKYDARFWLLRVTVKKDQSVMDNPFFYPWLAASVISSIYSYIWDIKMDWGLFDKNAPPDNPFLREETVYSSTEMKALLYQAMEEAPSLETTEPEVISRYFRMFDENFFHYYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Xenotropic and polytropic retrovirus receptor 1 homolog	May function in G-protein coupled signal transduction.	confident	Q9QZ70
Xenotropic and polytropic retrovirus receptor 1 homolog	May function in G-protein coupled signal transduction.	confident	Q28CY9
Xenotropic and polytropic retrovirus receptor 1	May function in G-protein coupled signal transduction (By similarity). Potential receptor for xenotropic and polytropic murine leukemia retroviruses.	confident	Q9Z0U0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0004872 [MF]	receptor activity	probable	GO:0003674

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 2-31
View the alignment between query and template
View the model in PyMOL