Diaphorina citri psyllid: psy7160


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MLRSICSQGDCRSYNYVVGISCEKEPDWTDLAVIARIVPKAKDKESKKETNNITLMRGQVSSDGVPR
ccEEEEECcccccEEEEEEEcccccccHHHHHHHHHHccccccccccccccCEEEEccccccccccc
*LRSICSQGDCRSYNYVVGISCEKEPDWTDLAVIARIVPKAKDKESKKETNNITLMRGQVS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRSICSQGDCRSYNYVVGISCEKEPDWTDLAVIARIVPKAKDKESKKETNNITLMRGQVSSDGVPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GMP synthase [glutamine-hydrolyzing] Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.confidentP49915
GMP synthase [glutamine-hydrolyzing] confidentQ4V7C6
GMP synthase [glutamine-hydrolyzing] Involved in the de novo synthesis of guanine nucleotides which are not only essential for DNA and RNA synthesis, but also provide GTP, which is involved in a number of cellular processes important for cell division.confidentQ3THK7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0003921 [MF]GMP synthase activityprobableGO:0016879, GO:0003674, GO:0016874, GO:0003824
GO:1901564 [BP]organonitrogen compound metabolic processprobableGO:0071704, GO:0006807, GO:0008150, GO:0008152
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:2000152 [BP]regulation of ubiquitin-specific protease activityprobableGO:0051336, GO:0019222, GO:0052547, GO:0050790, GO:0065007, GO:0008150, GO:0065009, GO:0050789
GO:0016578 [BP]histone deubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0070647, GO:0070646, GO:0016043, GO:0071704, GO:0016570, GO:0016579, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0035800 [MF]ubiquitin-specific protease activator activityprobableGO:0016504, GO:0030234, GO:0061134, GO:0003674, GO:0008047

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VXO, chain A
Confidence level:very confident
Coverage over the Query: 2-66
View the alignment between query and template
View the model in PyMOL