Diaphorina citri psyllid: psy7169

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MTFSMEKLAEATRKFSNLRNELKRSQEETMKSAKAKRKSALLLSRHKTDVPARKLQELKLAFSEYYLSLILLQNYQNLNFTGFRKILKKHDKLLNVDVGAKWRAEHVDISHFYVNKDINHLISETEATVTSELEEGDRQKAMKRLRVPPLGEQQSPWTTFKVGLFLGCFAILFAIILLRVWTERIVALSQILFKVGLFLGCFAILFAIILLRDGVRRNELKEGNSQSTNICVQVQ
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEECcccccccccEEcc
MTFSMEKLAEATRKFS************************************RKLQELKLAFSEYYLSLILLQNYQNLNFTGFRKILKKHDKLLNVDVGAKWRAEHVDISHFYVNKDINHLISETEATVTSELEEGDRQKA**************PWTTFKVGLFLGCFAILFAIILLRVWTERIVALSQILFKVGLFLGCFAILFAIILLRDGVRRNELKEGNSQSTNICVQV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxTMKSAKAKRKSALLLSRHKTDVPARKLQELKLAFSEYYLSLILLQNYQNLNFTGFRKILKKHDKLLNVDVGAKWRAEHVDISHFYVNKDINHLISETEATVTSELEEGDRQKAMKRLRVPPLGEQQSPWTTFKVGLFLGCFAILFAIILLRVWTERIVALSQILFKVGLFLGCFAILFAIILLRDGVRRNELKEGNSQSTNICVQVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Xenotropic and polytropic retrovirus receptor 1 homolog May function in G-protein coupled signal transduction.confidentQ9QZ70
Xenotropic and polytropic retrovirus receptor 1 homolog May function in G-protein coupled signal transduction.confidentQ28CY9
Xenotropic and polytropic retrovirus receptor 1 May function in G-protein coupled signal transduction (By similarity). Potential receptor for xenotropic and polytropic murine leukemia retroviruses.confidentQ9Z0U0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004872 [MF]receptor activityprobableGO:0003674
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted