Query         psy7177
Match_columns 66
No_of_seqs    191 out of 1007
Neff          7.6 
Searched_HMMs 46136
Date          Fri Aug 16 20:10:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7177.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7177hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd02667 Peptidase_C19K A subfa  99.8 9.5E-21 2.1E-25  122.7   5.3   53    1-53    206-279 (279)
  2 cd02673 Peptidase_C19Q A subfa  99.8 1.1E-20 2.4E-25  121.7   5.2   53    1-53    188-245 (245)
  3 cd02664 Peptidase_C19H A subfa  99.8 6.7E-21 1.5E-25  125.8   4.1   53    1-53    247-327 (327)
  4 cd02662 Peptidase_C19F A subfa  99.8 1.5E-20 3.1E-25  119.9   4.8   53    1-53    167-240 (240)
  5 cd02659 peptidase_C19C A subfa  99.8 2.6E-20 5.6E-25  122.1   5.3   56    1-56    256-333 (334)
  6 cd02658 Peptidase_C19B A subfa  99.8 5.9E-20 1.3E-24  119.7   6.2   53    1-53    256-311 (311)
  7 cd02663 Peptidase_C19G A subfa  99.8 2.8E-20   6E-25  121.4   4.5   51    1-53    241-300 (300)
  8 cd02657 Peptidase_C19A A subfa  99.8 2.7E-20 5.9E-25  120.9   4.4   53    1-53    245-305 (305)
  9 KOG1865|consensus               99.8 1.1E-19 2.5E-24  126.6   6.7   54    1-55    356-410 (545)
 10 cd02665 Peptidase_C19I A subfa  99.8 7.3E-20 1.6E-24  117.3   4.6   53    1-53    168-228 (228)
 11 PF00443 UCH:  Ubiquitin carbox  99.8 1.6E-19 3.5E-24  112.6   5.1   52    1-52    215-269 (269)
 12 cd02668 Peptidase_C19L A subfa  99.8 1.7E-19 3.7E-24  118.7   5.1   53    1-53    250-324 (324)
 13 cd02670 Peptidase_C19N A subfa  99.8 2.5E-19 5.3E-24  115.6   5.1   53    1-53    171-241 (241)
 14 COG5560 UBP12 Ubiquitin C-term  99.8 2.7E-19 5.8E-24  126.9   5.3   56    1-56    768-823 (823)
 15 cd02669 Peptidase_C19M A subfa  99.8   3E-19 6.5E-24  122.3   5.3   53    1-53    387-440 (440)
 16 cd02674 Peptidase_C19R A subfa  99.8 5.5E-19 1.2E-23  110.5   6.0   53    1-53    178-230 (230)
 17 cd02660 Peptidase_C19D A subfa  99.8 5.7E-19 1.2E-23  115.5   5.6   52    1-53    277-328 (328)
 18 cd02661 Peptidase_C19E A subfa  99.8 8.9E-19 1.9E-23  112.8   5.2   52    1-53    252-304 (304)
 19 KOG1868|consensus               99.7 2.9E-18 6.3E-23  122.2   6.4   60    1-60    592-651 (653)
 20 cd02257 Peptidase_C19 Peptidas  99.7   3E-18 6.6E-23  105.1   5.5   53    1-53    197-255 (255)
 21 cd02671 Peptidase_C19O A subfa  99.7 1.2E-17 2.6E-22  111.3   4.0   47    1-53    276-332 (332)
 22 KOG1870|consensus               99.7 6.9E-18 1.5E-22  122.9   2.9   56    1-56    787-842 (842)
 23 cd02672 Peptidase_C19P A subfa  99.7 5.7E-17 1.2E-21  105.6   5.4   47    1-53    217-268 (268)
 24 KOG1867|consensus               99.7 1.8E-17 3.9E-22  115.4   2.8   56    1-58    432-487 (492)
 25 cd02666 Peptidase_C19J A subfa  99.6 4.6E-16   1E-20  104.4   4.7   53    1-53    285-343 (343)
 26 COG5533 UBP5 Ubiquitin C-termi  99.6   2E-15 4.3E-20  101.0   5.8   53    1-55    361-414 (415)
 27 KOG4598|consensus               99.5 2.6E-15 5.7E-20  108.2   1.8   59    1-59    374-445 (1203)
 28 KOG1866|consensus               99.5 6.9E-16 1.5E-20  111.0  -1.9   59    1-59    357-438 (944)
 29 COG5077 Ubiquitin carboxyl-ter  99.5 1.6E-14 3.5E-19  104.6   1.3   61    1-61    435-517 (1089)
 30 KOG1873|consensus               99.4 1.3E-14 2.7E-19  104.5   0.1   55    1-55    803-877 (877)
 31 KOG0944|consensus               99.4 4.9E-13 1.1E-17   95.6   4.7   51    1-55    711-762 (763)
 32 KOG1864|consensus               99.3   3E-12 6.6E-17   91.0   4.4   54    1-55    515-572 (587)
 33 COG5207 UBP14 Isopeptidase T [  99.3 4.1E-12 8.9E-17   89.5   4.2   55    1-55    692-749 (749)
 34 KOG1872|consensus               99.3 2.7E-12 5.9E-17   88.8   3.2   55    1-56    408-470 (473)
 35 KOG1871|consensus               98.8 1.6E-08 3.4E-13   69.3   5.2   56    1-56    360-420 (420)
 36 KOG1863|consensus               98.7 4.7E-09   1E-13   78.9   2.4   61    1-61    415-491 (1093)
 37 PF13423 UCH_1:  Ubiquitin carb  98.6 7.3E-08 1.6E-12   63.0   4.3   34    1-34    259-295 (295)
 38 KOG1275|consensus               97.6 0.00022 4.7E-09   53.7   6.5   52    1-52    795-860 (1118)
 39 KOG2026|consensus               96.9 4.8E-05   1E-09   52.6  -3.2   47    9-55    395-441 (442)
 40 PF05408 Peptidase_C28:  Foot-a  93.7     0.2 4.2E-06   31.9   4.5   47    5-58    130-178 (193)
 41 PF15499 Peptidase_C98:  Ubiqui  93.6   0.081 1.7E-06   35.2   2.8   22   11-33    231-252 (275)
 42 PF01473 CW_binding_1:  Putativ  89.6    0.35 7.5E-06   19.3   1.6   14   17-32      3-16  (19)
 43 PF00770 Peptidase_C5:  Adenovi  76.1     4.3 9.3E-05   25.7   3.1   31    1-31     22-53  (183)
 44 PF08770 SoxZ:  Sulphur oxidati  71.5     7.1 0.00015   22.1   3.1   41   13-60     41-81  (100)
 45 PF08715 Viral_protease:  Papai  69.7     6.4 0.00014   26.9   3.0   33    4-41    266-298 (320)
 46 PF02099 Josephin:  Josephin;    61.2      17 0.00037   22.2   3.5   28    1-34    101-128 (157)
 47 smart00460 TGc Transglutaminas  59.9      18 0.00039   17.9   3.0   20   10-31     47-66  (68)
 48 PF05986 ADAM_spacer1:  ADAM-TS  54.4      39 0.00085   19.2   4.2   51   11-66     37-88  (114)
 49 cd05860 Ig4_SCFR Fourth immuno  53.9      21 0.00046   20.4   2.9   15    8-22     74-88  (101)
 50 cd05896 Ig1_IL1RAPL-1_like Fir  51.4      11 0.00024   21.7   1.4   13    9-21     80-92  (104)
 51 cd04480 RPA1_DBD_A_like RPA1_D  49.4      40 0.00087   17.9   3.9   32   23-54     51-82  (86)
 52 PF09149 DUF1935:  Domain of un  47.5      14 0.00031   21.1   1.5   15   22-36     30-44  (104)
 53 PF01841 Transglut_core:  Trans  47.3      24 0.00053   19.1   2.4   20   10-30     93-112 (113)
 54 COG0093 RplN Ribosomal protein  46.9      38 0.00082   20.2   3.2   18   23-40     73-90  (122)
 55 cd00524 SORL Superoxide reduct  45.1      50  0.0011   17.8   6.5   40    8-56     29-68  (86)
 56 PF14509 GH97_C:  Glycosyl-hydr  44.5      18  0.0004   20.5   1.7   38   11-48     13-55  (103)
 57 cd05751 Ig1_LILRB1_like First   44.4      21 0.00045   19.1   1.8   12   10-21     64-75  (91)
 58 PHA02131 hypothetical protein   41.3      31 0.00068   18.0   2.1   26   10-40     21-46  (70)
 59 PRK08571 rpl14p 50S ribosomal   39.6      55  0.0012   19.7   3.2   19   22-40     83-101 (132)
 60 cd03172 SORL_classII Superoxid  39.2      73  0.0016   18.0   5.1   41    9-56     38-80  (104)
 61 PTZ00054 60S ribosomal protein  38.8      56  0.0012   19.8   3.2   19   22-40     90-108 (139)
 62 cd05750 Ig_Pro_neuregulin Immu  38.0      55  0.0012   16.1   2.8   14    9-22     53-66  (75)
 63 cd04474 RPA1_DBD_A RPA1_DBD_A:  37.7      75  0.0016   17.6   3.8   32   23-54     67-98  (104)
 64 PHA01365 hypothetical protein   36.9      41 0.00088   18.8   2.2   25   28-52     15-41  (91)
 65 PF01088 Peptidase_C12:  Ubiqui  36.8      28  0.0006   22.2   1.8   24   12-37    166-189 (214)
 66 PF12252 SidE:  Dot/Icm substra  36.3      52  0.0011   26.7   3.3   24    8-32     59-82  (1439)
 67 cd05756 Ig1_IL1R_like First im  36.3      32  0.0007   18.7   1.8   14    8-21     69-82  (94)
 68 cd05747 Ig5_Titin_like M5, fif  36.1      63  0.0014   17.0   2.9   21    8-28     68-88  (92)
 69 PF02721 DUF223:  Domain of unk  35.3      62  0.0013   17.6   2.9   35   22-56     29-63  (95)
 70 cd05855 Ig_TrkB_d5 Fifth domai  34.9      46   0.001   17.7   2.2   15    8-22     53-67  (79)
 71 PF10572 UPF0556:  Uncharacteri  34.8      80  0.0017   19.6   3.5   26    8-33     69-94  (158)
 72 PRK05483 rplN 50S ribosomal pr  33.2      72  0.0016   18.8   3.0   19   22-40     72-90  (122)
 73 TIGR03673 rpl14p_arch 50S ribo  33.0      78  0.0017   19.0   3.1   19   22-40     82-100 (131)
 74 PF04473 DUF553:  Transglutamin  32.7      81  0.0018   19.2   3.3   19   12-32    109-127 (153)
 75 PRK04233 hypothetical protein;  32.1      38 0.00081   20.2   1.7    9   23-31    120-128 (129)
 76 COG3012 Uncharacterized protei  31.8      35 0.00075   21.0   1.5   12   23-34    119-130 (151)
 77 cd05854 Ig6_Contactin-2 Sixth   31.5      48   0.001   17.5   2.0   14    9-22     57-70  (85)
 78 cd05744 Ig_Myotilin_C_like Imm  30.5      52  0.0011   16.8   2.0   15    8-22     50-64  (75)
 79 TIGR03834 EAGR_box EAGR box. T  30.2      58  0.0013   14.4   1.7   19    7-31      2-23  (28)
 80 cd07702 Ig2_VEGFR-1 Second imm  30.1      64  0.0014   16.8   2.3   16    8-23     45-60  (72)
 81 PF05717 TnpB_IS66:  IS66 Orf2   29.7      88  0.0019   17.8   2.9   38    8-58     31-68  (107)
 82 cd04976 Ig2_VEGFR Second immun  29.4      48   0.001   16.8   1.7   15    8-22     44-58  (71)
 83 cd04971 Ig_TrKABC_d5 Fifth dom  29.1      95  0.0021   16.2   2.9   15    8-22     55-69  (81)
 84 cd05735 Ig8_DSCAM Eight immuno  28.9      62  0.0013   17.1   2.1   15    8-22     56-70  (88)
 85 PF02750 Synapsin_C:  Synapsin,  28.6      32  0.0007   22.2   1.1   17   11-27    107-123 (203)
 86 cd05869 Ig5_NCAM-1 Fifth immun  28.6   1E+02  0.0022   16.4   3.0   14    9-22     73-86  (97)
 87 PRK00183 hypothetical protein;  28.0      42 0.00092   20.7   1.5   11   23-33    120-130 (157)
 88 KOG1415|consensus               27.9      70  0.0015   20.9   2.5   24   12-37    160-183 (222)
 89 PRK10579 hypothetical protein;  27.8 1.2E+02  0.0027   17.2   4.5   36   17-52     53-93  (94)
 90 cd07693 Ig1_Robo First immunog  27.6      56  0.0012   16.9   1.8   14    8-21     73-86  (100)
 91 TIGR01067 rplN_bact ribosomal   27.3      72  0.0016   18.8   2.3   19   22-40     72-90  (122)
 92 cd04967 Ig1_Contactin First Ig  27.1      58  0.0013   17.1   1.8   14    9-22     69-82  (91)
 93 cd05895 Ig_Pro_neuregulin-1 Im  27.1      65  0.0014   16.2   1.9   15    8-22     53-67  (76)
 94 cd05863 Ig2_VEGFR-3 Second imm  26.9      55  0.0012   16.7   1.6   15    8-22     40-54  (67)
 95 cd05730 Ig3_NCAM-1_like Third   26.4      63  0.0014   17.0   1.9   15    8-22     67-81  (95)
 96 PF06680 DUF1181:  Protein of u  26.3      71  0.0015   18.4   2.1   25   10-34     43-67  (120)
 97 PF13529 Peptidase_C39_2:  Pept  26.3      64  0.0014   17.7   2.0   23    8-31    120-142 (144)
 98 cd04974 Ig3_FGFR Third immunog  26.2   1E+02  0.0022   16.2   2.7   14    9-22     65-78  (90)
 99 cd05893 Ig_Palladin_C C-termin  25.8      65  0.0014   16.6   1.8   13    9-21     51-63  (75)
100 cd05740 Ig_CEACAM_D4 Fourth im  25.5      67  0.0015   17.2   1.9   15    8-22     64-78  (91)
101 cd05746 Ig4_Peroxidasin Fourth  25.4      60  0.0013   16.1   1.6   15    8-22     45-59  (69)
102 cd05892 Ig_Myotilin_C C-termin  24.8      70  0.0015   16.6   1.8   15    8-22     50-64  (75)
103 COG5263 FOG: Glucan-binding do  24.4 1.1E+02  0.0025   21.0   3.1   15   23-37    221-235 (313)
104 cd04969 Ig5_Contactin_like Fif  24.2      63  0.0014   16.1   1.6   14    8-21     48-61  (73)
105 cd05876 Ig3_L1-CAM Third immun  24.2      69  0.0015   16.0   1.7   15    8-22     45-59  (71)
106 cd04978 Ig4_L1-NrCAM_like Four  24.1      71  0.0015   15.8   1.7   13    9-21     51-63  (76)
107 cd05712 Ig_Siglec_N Immunoglob  24.1 1.4E+02  0.0031   16.6   3.8   25    9-33     90-114 (119)
108 cd05852 Ig5_Contactin-1 Fifth   23.9      74  0.0016   16.2   1.8   15    8-22     48-62  (73)
109 cd05853 Ig6_Contactin-4 Sixth   23.9      61  0.0013   17.5   1.5   14    9-22     57-70  (85)
110 cd05736 Ig2_Follistatin_like S  23.6      86  0.0019   15.6   2.0   14    8-21     48-61  (76)
111 COG1998 RPS31 Ribosomal protei  23.2      94   0.002   15.7   2.0   17   24-40      5-21  (51)
112 cd05865 Ig1_NCAM-1 First immun  22.9 1.2E+02  0.0027   16.4   2.6   14    8-21     69-82  (96)
113 PF08053 Tna_leader:  Tryptopha  22.9      52  0.0011   13.7   0.8   12   23-34      9-20  (24)
114 cd04973 Ig1_FGFR First immunog  22.7      88  0.0019   16.0   2.0   14    8-21     54-67  (79)
115 PF10949 DUF2777:  Protein of u  22.7 1.8E+02  0.0039   18.5   3.6   19   23-41     25-43  (185)
116 PRK01842 hypothetical protein;  22.7      86  0.0019   19.2   2.1   10   23-32    137-146 (149)
117 cd05856 Ig2_FGFRL1-like Second  22.6      82  0.0018   15.6   1.8   15    8-22     57-71  (82)
118 cd05879 Ig_P0 Immunoglobulin (  22.6 1.1E+02  0.0025   17.4   2.5   15    8-22     89-103 (116)
119 cd05894 Ig_C5_MyBP-C C5 immuno  22.3      88  0.0019   16.4   1.9   15    8-22     61-75  (86)
120 cd05864 Ig2_VEGFR-2 Second imm  22.3      65  0.0014   16.5   1.4   15    8-22     43-57  (70)
121 PRK09806 tryptophanase leader   21.8      63  0.0014   13.8   1.0   13   23-35      9-21  (26)
122 PRK01617 hypothetical protein;  21.4      69  0.0015   19.6   1.5   15   17-33    117-131 (154)
123 cd05734 Ig7_DSCAM Seventh immu  21.3   1E+02  0.0022   15.6   2.0   14    8-21     53-66  (79)
124 cd05725 Ig3_Robo Third immunog  21.1      90   0.002   15.3   1.7   14    8-21     44-57  (69)
125 CHL00057 rpl14 ribosomal prote  21.1 1.2E+02  0.0026   17.9   2.4   20   22-41     72-91  (122)
126 cd05868 Ig4_NrCAM Fourth immun  21.0      91   0.002   15.8   1.8   14    9-22     51-64  (76)
127 PF06865 DUF1255:  Protein of u  20.9 1.8E+02  0.0038   16.5   4.1   37   17-53     53-94  (94)
128 PF05766 NinG:  Bacteriophage L  20.8      33 0.00072   21.8   0.0   26    5-34     97-122 (189)
129 PTZ00320 ribosomal protein L14  20.7 1.4E+02   0.003   19.1   2.8   20   22-41    138-157 (188)
130 KOG1296|consensus               20.7      56  0.0012   20.3   1.0   29    8-37    120-148 (161)
131 cd05723 Ig4_Neogenin Fourth im  20.6   1E+02  0.0023   15.3   1.9   14    8-21     46-59  (71)
132 PF07206 Baculo_LEF-10:  Baculo  20.4 1.4E+02   0.003   16.2   2.4   18   44-61     22-39  (71)
133 cd05718 Ig1_PVR_like First imm  20.2 1.5E+02  0.0033   15.4   2.7   19    9-27     72-90  (98)

No 1  
>cd02667 Peptidase_C19K A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.82  E-value=9.5e-21  Score=122.70  Aligned_cols=53  Identities=32%  Similarity=0.541  Sum_probs=49.3

Q ss_pred             CEEEeeecCCCCeEEEEEECCC---------------------CCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPN---------------------TKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~---------------------~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.|+.++|||+||+|...                     +++|++|||+.|++++.+++.+.+||||||+
T Consensus       206 ~vi~H~G~~~~GHY~a~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~~~dD~~V~~v~~~~v~~~~aYiLfYe  279 (279)
T cd02667         206 GVVEHSGTMRSGHYVAYVKVRPPQQRLSDLTKSKPAADEAGPGSGQWYYISDSDVREVSLEEVLKSEAYLLFYE  279 (279)
T ss_pred             EEEEEeCCCCCCEeEEEEEcCccccccccccccccccccCCCCCCcEEEEECCccEECCHHHhccCCcEEEEeC
Confidence            7999999779999999999854                     6899999999999999999999999999995


No 2  
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.82  E-value=1.1e-20  Score=121.70  Aligned_cols=53  Identities=25%  Similarity=0.479  Sum_probs=48.5

Q ss_pred             CEEEeee-cCCCCeEEEEEECCC-CCcEEEEcCceEEEcCCCcCC---CCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPN-TKEWHYFNDETVLEQRPQDED---FNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~-~~~W~~fdD~~V~~~~~~~~~---~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||+||+|... +++||+|||+.|++++.+++.   +++||||||+
T Consensus       188 ~VV~H~G~~~~~GHY~a~vk~~~~~~~Wy~fnD~~V~~v~~~~v~~~~~~~aYiLFY~  245 (245)
T cd02673         188 AVICHLGESPYDGHYIAYTKELYNGSSWLYCSDDEIRPVSKNDVSTNARSSGYLIFYD  245 (245)
T ss_pred             EEEEECCCCCCCceEEEEEEcCCCCCeEEEeeCceeeEcCHHHHhhccCCceEEEEEC
Confidence            6999999 689999999999875 689999999999999999876   6899999995


No 3  
>cd02664 Peptidase_C19H A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.82  E-value=6.7e-21  Score=125.83  Aligned_cols=53  Identities=32%  Similarity=0.551  Sum_probs=47.4

Q ss_pred             CEEEeee-cCCCCeEEEEEECCC--------------------CCcEEEEcCceEEEcCCCcCCC-------CCeEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPN--------------------TKEWHYFNDETVLEQRPQDEDF-------NNAYILFY   52 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~--------------------~~~W~~fdD~~V~~~~~~~~~~-------~~aYiLfY   52 (66)
                      |||+|.| ++++|||+||+|...                    .++|++|||+.|++++.+++.+       .+||||||
T Consensus       247 ~Vi~H~G~~~~~GHY~a~~r~~~~~~~~~~~~~~~~~~~~~~~~~~W~~fnD~~V~~~~~~~v~~~~~~~~~~~aYlLfY  326 (327)
T cd02664         247 AVVVHSGYSSESGHYFTYARDQTDADSTGQECPEPKDAEENDESKNWYLFNDSRVTFSSFESVQNVTSRFPKDTPYILFY  326 (327)
T ss_pred             EEEEEccCCCCCcceEEEEecCCccccccccccccccccccCCCCCEEEEeCCceEECCHHHHHHhhCCCCCCCEEEEEe
Confidence            7999999 689999999999863                    3789999999999999887754       89999999


Q ss_pred             E
Q psy7177          53 K   53 (66)
Q Consensus        53 ~   53 (66)
                      +
T Consensus       327 ~  327 (327)
T cd02664         327 E  327 (327)
T ss_pred             C
Confidence            5


No 4  
>cd02662 Peptidase_C19F A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.82  E-value=1.5e-20  Score=119.95  Aligned_cols=53  Identities=32%  Similarity=0.590  Sum_probs=49.0

Q ss_pred             CEEEeeecCCCCeEEEEEECC--------------------CCCcEEEEcCceEEEcCCCcC-CCCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHP--------------------NTKEWHYFNDETVLEQRPQDE-DFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~--------------------~~~~W~~fdD~~V~~~~~~~~-~~~~aYiLfY~   53 (66)
                      |||+|.|+.++|||++|+|.+                    ..++||+|||+.|++++.+++ .+.+||||||+
T Consensus       167 avi~H~G~~~~GHY~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~W~~fnD~~V~~v~~~~v~~~~~aY~LfYe  240 (240)
T cd02662         167 AVVVHYGSHSSGHYVCYRRKPLFSKDKEPGSFVRMREGPSSTSHPWWRISDTTVKEVSESEVLEQKSAYMLFYE  240 (240)
T ss_pred             EEEEEeccCCCceEEEEEeCCCcccccccccccccccccCccCCCEEEEechheEEeCHHHHhhCCCEEEEEeC
Confidence            799999987999999999986                    348999999999999999998 89999999995


No 5  
>cd02659 peptidase_C19C A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.81  E-value=2.6e-20  Score=122.08  Aligned_cols=56  Identities=32%  Similarity=0.634  Sum_probs=50.0

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC----------------------CCCeEEEEEEEcC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED----------------------FNNAYILFYKKRD   56 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~----------------------~~~aYiLfY~r~~   56 (66)
                      |||+|.|+.++|||++++|...+++|+.|||+.|++++.+++.                      +.+||||||+|++
T Consensus       256 ~vI~H~G~~~~GHY~~~vk~~~~~~W~~~nD~~V~~i~~~~v~~~~~g~~~~~~~~~~~~~~~~~~~~ay~l~Y~~~~  333 (334)
T cd02659         256 GVLVHSGDAHGGHYYSYIKDRDDGKWYKFNDDVVTPFDPNDAEEECFGGEETQKTYDSGPRAFKRTTNAYMLFYERKS  333 (334)
T ss_pred             EEEEecCCCCCCCeEEEEECCCCCceEEEeCcccEECCHHHHHHHcCCCccccccccccccccccccceEEEEEEEeC
Confidence            7999999999999999999976799999999999999877652                      4679999999976


No 6  
>cd02658 Peptidase_C19B A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.81  E-value=5.9e-20  Score=119.71  Aligned_cols=53  Identities=30%  Similarity=0.521  Sum_probs=49.0

Q ss_pred             CEEEeee-cCCCCeEEEEEECC--CCCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHP--NTKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~--~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||++++|..  .+++|++|||+.|++++..++..++||||||+
T Consensus       256 ~vI~H~G~~~~~GHY~~~vk~~~~~~~~W~~fnD~~V~~~~~~~~~~~~~YilfY~  311 (311)
T cd02658         256 AFISHKGTSVHSGHYVAHIKKEIDGEGKWVLFNDEKVVASQDPPEMKKLGYIYFYQ  311 (311)
T ss_pred             EEEEccCCCCCCcceEEEEeCCCCCCCCEEEecCceeEECCcccccCCcceEEEEC
Confidence            7999999 69999999999986  34899999999999999999999999999995


No 7  
>cd02663 Peptidase_C19G A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.81  E-value=2.8e-20  Score=121.42  Aligned_cols=51  Identities=31%  Similarity=0.535  Sum_probs=46.6

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC--------CCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED--------FNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~--------~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||++|+|.  +++|++|||+.|++++.+++.        +.+||||||+
T Consensus       241 ~vi~H~G~~~~~GHY~a~~k~--~~~W~~fdD~~V~~~~~~~v~~~~~~~~~~~~aYiLfY~  300 (300)
T cd02663         241 AVVVHIGGGPNHGHYVSIVKS--HGGWLLFDDETVEKIDENAVEEFFGDSPNQATAYVLFYQ  300 (300)
T ss_pred             EEEEEecCCCCCCceEEEEEC--CCcEEEEcCCceEEcCHHHHHHhcCCCCCCCceEEEEeC
Confidence            7999999 5999999999999  789999999999999887764        6899999995


No 8  
>cd02657 Peptidase_C19A A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.81  E-value=2.7e-20  Score=120.92  Aligned_cols=53  Identities=32%  Similarity=0.543  Sum_probs=48.0

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCC-------CCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDF-------NNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~-------~~aYiLfY~   53 (66)
                      |||+|.| ++++|||++|+|....++|++|||+.|++++.+++..       .+||||||+
T Consensus       245 ~vI~H~G~~~~~GHY~~~~~~~~~~~W~~fdD~~V~~~~~~~v~~~~~~~~~~~aYiL~Y~  305 (305)
T cd02657         245 AVITHQGRSADSGHYVAWVRRKNDGKWIKFDDDKVSEVTEEDILKLSGGGDWHIAYILLYK  305 (305)
T ss_pred             EEEEecCCCCCCcEEEEEEEcCCCCeEEEEECCceEEeCHHHHHhhcCCCCCceEEEEEEC
Confidence            7999999 6999999999999755899999999999999888753       699999995


No 9  
>KOG1865|consensus
Probab=99.80  E-value=1.1e-19  Score=126.59  Aligned_cols=54  Identities=24%  Similarity=0.457  Sum_probs=52.1

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEc
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~   55 (66)
                      |||+|.| +..+|||++|||.. +|+||+|||+.|+.++.+.+.++.||||||.|.
T Consensus       356 avlVH~g~~~~~GHY~cYvks~-~g~Wy~~DDS~V~~~~~~~VLsq~AYmLfY~R~  410 (545)
T KOG1865|consen  356 AVLVHLGTSCHSGHYFCYVKSQ-NGQWYKMDDSEVTQSSIESVLSQQAYILFYARK  410 (545)
T ss_pred             EEEEeccccccCCceEEEEEcC-CCceEEccCceeeeccccceecccceEEEEEee
Confidence            7999999 99999999999997 789999999999999999999999999999997


No 10 
>cd02665 Peptidase_C19I A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.79  E-value=7.3e-20  Score=117.28  Aligned_cols=53  Identities=30%  Similarity=0.506  Sum_probs=47.9

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC--------CCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED--------FNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~--------~~~aYiLfY~   53 (66)
                      |||+|.|++++|||++|+|+..+++|++|||+.|++++.+++.        ..+||||||.
T Consensus       168 aVi~H~G~~~~GHY~~~i~~~~~~~W~~fdD~~V~~~~~~~v~~~~fGg~~~~~AYiLfYv  228 (228)
T cd02665         168 AVLVHEGQANAGHYWAYIYKQSRQEWEKYNDISVTESSWEEVERDSFGGGRNPSAYCLMYI  228 (228)
T ss_pred             EEEEecCCCCCCEEEEEEEcCCCCEEEEEECCeeEEcCHHHHhhhccCCCCCCceEEEEEC
Confidence            7999999999999999999877899999999999999887764        4589999994


No 11 
>PF00443 UCH:  Ubiquitin carboxyl-terminal hydrolase;  InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to the MEROPS peptidase family C19 (ubiquitin-specific protease family, clan CA). Families within the CA clan are loosely termed papain-like as protein fold of the peptidase unit resembles that of papain, the type example for clan CA. Predicted active site residues for members of this family and family C1 occur in the same order in the sequence: N/Q, C, H. The type example is human ubiquitin-specific protease 14. Ubiquitin is highly conserved, commonly found conjugated to proteins in eukaryotic cells, where it may act as a marker for rapid degradation, or it may have a chaperone function in protein assembly []. The ubiquitin is released by cleavage from the bound protein by a protease []. A number of deubiquitinising proteases are known: all are activated by thiol compounds [, ], and inhibited by thiol-blocking agents and ubiquitin aldehyde [, ], and as such have the properties of cysteine proteases []. The deubiquitinsing proteases can be split into 2 size ranges (20-30 kDa, IPR001578 from INTERPRO, and 100-200 kDa) []: this family are the 100-200 kDa peptides which includes the Ubp1 ubiquitin peptidase from yeast. Only one conserved cysteine can be identified, along with two conserved histidines. The spacing between the cysteine and the second histidine is thought to be more representative of the cysteine/histidine spacing of a cysteine protease catalytic dyad [].; GO: 0004221 ubiquitin thiolesterase activity, 0006511 ubiquitin-dependent protein catabolic process; PDB: 2LBC_A 3MHH_A 3MHS_A 3M99_A 2Y6E_D 2VHF_A 2HD5_A 3NHE_A 2IBI_A 1NBF_B ....
Probab=99.79  E-value=1.6e-19  Score=112.56  Aligned_cols=52  Identities=29%  Similarity=0.522  Sum_probs=48.5

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCC---CCeEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDF---NNAYILFY   52 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~---~~aYiLfY   52 (66)
                      |||+|.|+.++|||+|++|+..+++|++|||+.|++++.+++..   .+||||||
T Consensus       215 avi~H~G~~~~GHY~a~v~~~~~~~W~~~dD~~v~~~~~~~v~~~~~~~~yll~Y  269 (269)
T PF00443_consen  215 AVIVHYGSADSGHYVAYVRDSDDGKWYKFDDSRVTEVSWEEVIKSSNSTAYLLFY  269 (269)
T ss_dssp             EEEEEESSTTSEEEEEEEEETTTTEEEEEETTEEEEESHHHHCCGGSTCEEEEEE
T ss_pred             hhhccccccccceEEEeeccccCCeEEEeeCCceEECCHHHHhhccCCceEEEeC
Confidence            69999999999999999999766779999999999999988877   99999999


No 12 
>cd02668 Peptidase_C19L A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.78  E-value=1.7e-19  Score=118.71  Aligned_cols=53  Identities=34%  Similarity=0.464  Sum_probs=46.5

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCc---------------------CCCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQD---------------------EDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~---------------------~~~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||++++|+..+++|++|||+.|++++...                     +.+..||||||+
T Consensus       250 ~vI~H~G~~~~~GHY~~~~k~~~~~~W~~fdD~~V~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~l~y~  324 (324)
T cd02668         250 GVLIHQGVSAYSGHYIAHIKDEQTGEWYKFNDEDVEEMPGKPLKLGNSEDPAKPRKSEIKKGTHSSRTAYMLVYK  324 (324)
T ss_pred             EEEEEcCCCCCCEeeEEEEECCCCCcEEEEECCceEEcCHHHhhcccccccccccccccCCCccccCceEEEEeC
Confidence            6999999 6899999999999767899999999999986553                     246899999995


No 13 
>cd02670 Peptidase_C19N A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.78  E-value=2.5e-19  Score=115.61  Aligned_cols=53  Identities=23%  Similarity=0.523  Sum_probs=45.5

Q ss_pred             CEEEeee-cCCCCeEEEEEECCC-----------CCcEEEEcCceEEEcCCC------cCCCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPN-----------TKEWHYFNDETVLEQRPQ------DEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~-----------~~~W~~fdD~~V~~~~~~------~~~~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||+||||...           +++|++|||..|+.+...      .+.+++||||||+
T Consensus       171 aVi~H~G~s~~sGHYva~vr~~~~~~~~~~~~~~~~~W~~FDD~~v~~~~~~~~~~~~~~~~~~aYmLFYq  241 (241)
T cd02670         171 SAVCHRGTSLETGHYVAFVRYGSYSLTETDNEAYNAQWVFFDDMADRDGVSNGFNIPAARLLEDPYMLFYQ  241 (241)
T ss_pred             EEEEeCCCCCCCcCeEEEEECCcccccccccCCCCCeEEEecCcccccccccccccchhcccCCceEEEeC
Confidence            6999999 699999999999975           379999999988776433      4578999999996


No 14 
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=99.78  E-value=2.7e-19  Score=126.91  Aligned_cols=56  Identities=34%  Similarity=0.678  Sum_probs=52.8

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD   56 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~   56 (66)
                      ||=+|.|.+.+||||||+|+..+++||+|||++|+++++++..++.||+|||+|+.
T Consensus       768 avDNHygglsgGHYtAyarn~~n~~wy~fdDsritevdped~vtssaYvLFyrrk~  823 (823)
T COG5560         768 AVDNHYGGLSGGHYTAYARNFANNGWYLFDDSRITEVDPEDSVTSSAYVLFYRRKS  823 (823)
T ss_pred             eccccccccCCcceeeeeecccCCceEEecCccccccCccccccceeEEEEEEecC
Confidence            46689999999999999999999999999999999999999999999999999974


No 15 
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.78  E-value=3e-19  Score=122.30  Aligned_cols=53  Identities=21%  Similarity=0.295  Sum_probs=50.2

Q ss_pred             CEEEeeecC-CCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSKGV-SAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~-~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.|++ ++|||++++|+..+++||+|||+.|++++.+.+..++||||||+
T Consensus       387 avI~H~G~~~~sGHY~a~v~~~~~~~W~~fdD~~V~~v~~~~v~~~eaYll~Y~  440 (440)
T cd02669         387 ANIVHEGTPQEDGTWRVQLRHKSTNKWFEIQDLNVKEVLPQLIFLSESYIQIWE  440 (440)
T ss_pred             EEEEEeccCCCCeeEEEEEEcCCCCeEEEEECCeeeEcCHHHhccCCceEEEeC
Confidence            799999977 99999999998768999999999999999999999999999995


No 16 
>cd02674 Peptidase_C19R A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.77  E-value=5.5e-19  Score=110.47  Aligned_cols=53  Identities=34%  Similarity=0.593  Sum_probs=49.6

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.|..++|||++++|...+++|+.|||+.|++++.+++...+||||||+
T Consensus       178 ~vI~H~G~~~~GHY~~~~~~~~~~~W~~fnD~~V~~i~~~~~~~~~~YlL~Y~  230 (230)
T cd02674         178 AVVNHYGSLNGGHYTAYCKNNETNDWYKFDDSRVTKVSESSVVSSSAYILFYE  230 (230)
T ss_pred             EEEEeeCCCCCcEEEEEEECCCCCceEEEcCCeEEEcCHHHccCCCceEEEeC
Confidence            69999997799999999999766899999999999999999989999999995


No 17 
>cd02660 Peptidase_C19D A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.77  E-value=5.7e-19  Score=115.51  Aligned_cols=52  Identities=29%  Similarity=0.549  Sum_probs=48.9

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.|+..+|||++++|.. +++|++|||+.|++++.+++...+||||||.
T Consensus       277 avi~H~G~~~~GHY~~~~~~~-~~~W~~~nD~~V~~~~~~~v~~~~ayil~Y~  328 (328)
T cd02660         277 AVVVHKGTLDTGHYTAYCRQG-DGQWFKFDDAMITRVSEEEVLKSQAYLLFYH  328 (328)
T ss_pred             EEEEeeccCCCCcEEEEEECC-CCcEEEEECCeeEECCHHHhcCCCcEEEEeC
Confidence            799999988999999999996 4899999999999999999999999999994


No 18 
>cd02661 Peptidase_C19E A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.76  E-value=8.9e-19  Score=112.75  Aligned_cols=52  Identities=27%  Similarity=0.420  Sum_probs=48.3

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.| .+++|||++++|.. +++|++|||+.|++++.+++...+||||||.
T Consensus       252 ~vi~H~G~~~~~GHY~~~~~~~-~~~W~~~nD~~V~~v~~~~v~~~~aYil~Y~  304 (304)
T cd02661         252 AVLVHSGFSPHSGHYYCYVKSS-NGKWYNMDDSKVSPVSIETVLSQKAYILFYI  304 (304)
T ss_pred             EEEEECCCCCCCcCCEEEEECC-CCCEEEEeCCeeEECCHHHhcCCCcEEEEeC
Confidence            6999999 55999999999985 6899999999999999999999999999994


No 19 
>KOG1868|consensus
Probab=99.74  E-value=2.9e-18  Score=122.19  Aligned_cols=60  Identities=32%  Similarity=0.546  Sum_probs=55.1

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCCCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSD   60 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~~~   60 (66)
                      ||++|.|++.+|||||+|+....+.|+.|||+.|+.+....+.++.||||||+|....+.
T Consensus       592 aVv~H~Gtl~sGHYta~~~~~~~~~W~~fdDs~Vs~~~~~~~~~s~aYIlFY~~~~~~~~  651 (653)
T KOG1868|consen  592 AVVNHSGTLNSGHYTAYVYKNEKQRWFTFDDSEVSPISETDVGSSSAYILFYERLGIFEE  651 (653)
T ss_pred             EEEeccCcccCCceEEEEeecCCCceEEecCeeeeccccccccCCCceEEEeecCCcccc
Confidence            699999999999999999887778999999999999999888899999999999876553


No 20 
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.74  E-value=3e-18  Score=105.10  Aligned_cols=53  Identities=38%  Similarity=0.653  Sum_probs=48.5

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcC-----CCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDE-----DFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~-----~~~~aYiLfY~   53 (66)
                      |||+|.| ++.+|||++++|...+++|++|||..|++++.+++     ...+||+|||+
T Consensus       197 ~vi~h~G~~~~~GHY~~~~~~~~~~~W~~~nD~~V~~v~~~~~~~~~~~~~~~yll~Y~  255 (255)
T cd02257         197 AVVVHSGTSADSGHYVAYVKDPSDGKWYKFNDDKVTEVSEEEVLEFGSLSSSAYILFYE  255 (255)
T ss_pred             EEEEEecCCCCCcCeEEEEeCCCCCceEEEeccccEEcCHHHhhhccCCCCceEEEEEC
Confidence            6999999 55999999999997668999999999999999987     67999999995


No 21 
>cd02671 Peptidase_C19O A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.70  E-value=1.2e-17  Score=111.31  Aligned_cols=47  Identities=40%  Similarity=0.693  Sum_probs=41.4

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcC---------CCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDE---------DFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~---------~~~~aYiLfY~   53 (66)
                      |||+|.| ++++|||+||+|      |++|||+.|++++++++         ...+||||||+
T Consensus       276 ~VI~H~G~~~~~GHY~a~vr------W~~fdD~~V~~~~~~~~~~~~~~~~~~~~~aYiLfY~  332 (332)
T cd02671         276 AVVMHSGATISSGHYTAYVR------WLLFDDSEVKVTEEKDFLEALSPNTSSTSTPYLLFYK  332 (332)
T ss_pred             EEEEEcCCCCCCCeEEEEEE------EEEEcCcceEEccHHHHHhhcCCCCCCCCceEEEEEC
Confidence            6999999 689999999999      99999999999876543         35799999995


No 22 
>KOG1870|consensus
Probab=99.70  E-value=6.9e-18  Score=122.89  Aligned_cols=56  Identities=34%  Similarity=0.604  Sum_probs=53.7

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD   56 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~   56 (66)
                      ||.+|+|.+.+|||+||+|+..+++|+.|||+.|++++++++.++.||+|||+|++
T Consensus       787 av~nHyG~l~~GHYta~~k~~~~~~w~~fdDs~v~~~~~~~i~t~~aY~Lfy~r~~  842 (842)
T KOG1870|consen  787 AVGNHYGQLSGGHYTAYAKNVGDGKWYLFDDSSVSEVDEDEIDTEAAYVLFYRRLD  842 (842)
T ss_pred             eeecccCCcCCcchhhhhhcCCCCceEEeccccCCCCChhhcccccceEEEEEecC
Confidence            78999999999999999999889999999999999999999999999999999974


No 23 
>cd02672 Peptidase_C19P A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.68  E-value=5.7e-17  Score=105.61  Aligned_cols=47  Identities=28%  Similarity=0.404  Sum_probs=42.4

Q ss_pred             CEEEeee-cCCCCeEEEEEECCC----CCcEEEEcCceEEEcCCCcCCCCCeEEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPN----TKEWHYFNDETVLEQRPQDEDFNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~----~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~   53 (66)
                      |||+|.| +.++|||+|++|...    .++||.|||..|++++.      .||||||+
T Consensus       217 gvV~hig~~~~~GHyva~vk~~~~~~~~~~WylFND~~V~~vs~------~aYiLfY~  268 (268)
T cd02672         217 GYVCEINDSSRGQHNVVFVIKVNEESTHGRWYLFNDFLVTPVSE------LAYILLYQ  268 (268)
T ss_pred             EEEEEecCCCCCCcEEEEEEccCCCCCCCcEEEecCeEEEEcCc------hheeeecC
Confidence            7999999 459999999999864    57899999999999887      99999995


No 24 
>KOG1867|consensus
Probab=99.68  E-value=1.8e-17  Score=115.43  Aligned_cols=56  Identities=29%  Similarity=0.512  Sum_probs=52.2

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDED   58 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~   58 (66)
                      |||+|.|..++|||+||+|.  .+.|++|||+.|+.++.+++.+..||+|||.++...
T Consensus       432 AVV~H~G~~~SGHY~aY~r~--~~~~~~~dDs~v~~~s~~eVl~~~aylLFY~~~~~~  487 (492)
T KOG1867|consen  432 AVVVHHGTVGSGHYVAYRRQ--SGGWFKCDDSTVTKVSEEEVLSSQAYLLFYTQEQVE  487 (492)
T ss_pred             EEEEeccCCCCCceEEEEEe--CCCcEEEcCeEEEEeeHHHhhhchhhheehhHHhhh
Confidence            79999999999999999999  578999999999999999999999999999886543


No 25 
>cd02666 Peptidase_C19J A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.62  E-value=4.6e-16  Score=104.38  Aligned_cols=53  Identities=26%  Similarity=0.378  Sum_probs=47.5

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC------CCCeEEEEEE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED------FNNAYILFYK   53 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~------~~~aYiLfY~   53 (66)
                      ||++|.|+.++|||++++|+..++.|++|||+.|++++..++.      +.+||||+|.
T Consensus       285 avv~H~G~~~~GHY~~~~~~~~~~~W~~~dD~~V~~v~~~ev~~~~~~~~~~pY~l~Yv  343 (343)
T cd02666         285 AVFIHRGEASSGHYWVYIKDFEENVWRKYNDETVTVVPASEVFLFTLGNTATPYFLVYV  343 (343)
T ss_pred             EEEEeecCCCCCeEEEEEEECCCCeEEEEECCeeEEecHHHHhhcccCCCCCCEEEEeC
Confidence            6999999889999999999987789999999999999886643      4799999994


No 26 
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=99.60  E-value=2e-15  Score=100.98  Aligned_cols=53  Identities=23%  Similarity=0.470  Sum_probs=47.4

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCc-CCCCCeEEEEEEEc
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQD-EDFNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~-~~~~~aYiLfY~r~   55 (66)
                      ||+||.|+.++|||+++++.  ++.|+.|||+.|++++... ....++|||||+|.
T Consensus       361 gv~Ch~G~L~gGHY~s~v~~--~~~W~~~dDs~vr~~~~~t~~~~pSsYilFY~r~  414 (415)
T COG5533         361 GVVCHNGTLNGGHYFSEVKR--SGTWNVYDDSQVRKGSRTTSGSHPSSYILFYTRS  414 (415)
T ss_pred             EEEeecceecCceeEEeeee--cCceEEechhheeeccceecccCCcceEEEEEec
Confidence            69999999999999999998  6899999999999987653 45679999999985


No 27 
>KOG4598|consensus
Probab=99.53  E-value=2.6e-15  Score=108.22  Aligned_cols=59  Identities=31%  Similarity=0.524  Sum_probs=52.7

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC-------------CCCeEEEEEEEcCCCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED-------------FNNAYILFYKKRDEDS   59 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~-------------~~~aYiLfY~r~~~~~   59 (66)
                      +|.+|+|++.+|||+||+++.+++.||.|||.+|+.++..++.             +.+||||+|+|.+..-
T Consensus       374 ~imihsg~a~gghy~ayik~~d~~~w~~fnd~~v~~~t~~~i~~sfgg~~~~~~~s~tnaymlmyr~id~kr  445 (1203)
T KOG4598|consen  374 SVMVHSGNAAGGHYFAYIKNLDQDRWYVFNDTRVDFATPLEIEKSFGGHPSGWNQSNTNAYMLMYRRIDPKR  445 (1203)
T ss_pred             hhheecCCCCCceeeeeecccCcCceEEecCccccccCHHHHHHhhCCCCCCccccCcchhhhhhhhcCccc
Confidence            5789999999999999999999999999999999999887743             4789999999987654


No 28 
>KOG1866|consensus
Probab=99.52  E-value=6.9e-16  Score=111.03  Aligned_cols=59  Identities=32%  Similarity=0.544  Sum_probs=50.7

Q ss_pred             CEEEeeecCCCCeEEEEEECC---CCCcEEEEcCceEEEcCCCcC--------------------CCCCeEEEEEEEcCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHP---NTKEWHYFNDETVLEQRPQDE--------------------DFNNAYILFYKKRDE   57 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~---~~~~W~~fdD~~V~~~~~~~~--------------------~~~~aYiLfY~r~~~   57 (66)
                      ||++|+|.+.+|||++|++..   .+++||+|||..|++.+.+++                    .-.+||||||+|++.
T Consensus       357 GVlvHSGqAsaGHYySfIk~rr~~~~~kWykfnD~~Vte~~~n~me~~cfGGey~q~~~~~~~rrR~WNAYmlFYer~~d  436 (944)
T KOG1866|consen  357 GVLVHSGQASAGHYYSFIKQRRGEDGNKWYKFNDGDVTECKMNEMENECFGGEYMQMMKRMSYRRRWWNAYMLFYERMDD  436 (944)
T ss_pred             EEEEecccccCcchhhhhhhhccCCCCceEeccCccccccchhhHHHHhhcchhhhcccccchHHHhhhhHHHHHHHhcC
Confidence            699999999999999999975   357899999999999987762                    237999999999976


Q ss_pred             CC
Q psy7177          58 DS   59 (66)
Q Consensus        58 ~~   59 (66)
                      .+
T Consensus       437 ~p  438 (944)
T KOG1866|consen  437 IP  438 (944)
T ss_pred             CC
Confidence            65


No 29 
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]
Probab=99.45  E-value=1.6e-14  Score=104.58  Aligned_cols=61  Identities=23%  Similarity=0.335  Sum_probs=52.3

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC---------------C-------CCeEEEEEEEcCCC
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED---------------F-------NNAYILFYKKRDED   58 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~---------------~-------~~aYiLfY~r~~~~   58 (66)
                      ||++|.|..+.|||+|++|...+++||+|||++|+..+..++.               +       -+||||+|-|++..
T Consensus       435 gVlVHsGDl~~GHyYallKpe~dg~WykfdDtrVtrat~kevleeNfGgd~~~~~k~r~~~~~kRfmsAYmLvYlRks~~  514 (1089)
T COG5077         435 GVLVHSGDLHEGHYYALLKPEKDGRWYKFDDTRVTRATEKEVLEENFGGDHPYKDKIRDHSGIKRFMSAYMLVYLRKSML  514 (1089)
T ss_pred             EEEEeccccCCceEEEEeccccCCCceeecceehhhHHHHHHHHHhcCCCCCCcccccCCchhhhhhhhheeeeehHhHH
Confidence            6999999999999999999888999999999999998766521               1       46899999999877


Q ss_pred             CCc
Q psy7177          59 SDV   61 (66)
Q Consensus        59 ~~~   61 (66)
                      ++.
T Consensus       515 ddL  517 (1089)
T COG5077         515 DDL  517 (1089)
T ss_pred             Hhh
Confidence            643


No 30 
>KOG1873|consensus
Probab=99.44  E-value=1.3e-14  Score=104.52  Aligned_cols=55  Identities=33%  Similarity=0.500  Sum_probs=50.3

Q ss_pred             CEEEeeecCCCCeEEEEEECC--------------------CCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEc
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHP--------------------NTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~--------------------~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~   55 (66)
                      |||.|.|.+..|||++|+|..                    ..++||+.-|+.|++++++++...+||||||+|.
T Consensus       803 gvvehsgtm~~ghyvayv~~~t~~~~~~~~~~~~~~sd~~~~~~~Wy~iSDs~VrevS~d~vLkseAYlLFYERI  877 (877)
T KOG1873|consen  803 GVVEHSGTMSYGHYVAYVRGGTFLDLSAPSNSKDFESDAGIPSGRWYYISDSIVREVSLDEVLKSEAYLLFYERI  877 (877)
T ss_pred             cceeccccccCCcchhhhhccchhhccCccccccchhccCCCCcceEEecchheecccHHHHhhhhhhhhheecC
Confidence            689999999999999999953                    2468999999999999999999999999999984


No 31 
>KOG0944|consensus
Probab=99.38  E-value=4.9e-13  Score=95.59  Aligned_cols=51  Identities=24%  Similarity=0.461  Sum_probs=45.2

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEc
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~   55 (66)
                      |+|.|.| ++.+|||+|++|..  |+|+.|||++|-  ..++.-...+||.||+|.
T Consensus       711 a~IsHmGts~~sGHYV~hirKe--gkWVlfNDeKv~--~S~~ppK~lgYvY~y~R~  762 (763)
T KOG0944|consen  711 AFISHMGTSAHSGHYVCHIRKE--GKWVLFNDEKVA--ASQEPPKDLGYVYLYTRI  762 (763)
T ss_pred             EEEecCCCCCCCcceEEEEeec--CcEEEEcchhhh--hccCChhhcceEEEEEec
Confidence            6899999 99999999999994  789999999987  455556789999999985


No 32 
>KOG1864|consensus
Probab=99.29  E-value=3e-12  Score=90.95  Aligned_cols=54  Identities=24%  Similarity=0.349  Sum_probs=45.2

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC---CCCeEEEEEEEc
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED---FNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~---~~~aYiLfY~r~   55 (66)
                      |||+|.| +++.|||+|++|... ..|+.|||+.|++++.+.+.   ..+.|++||...
T Consensus       515 avVvH~G~~p~~GHYia~~r~~~-~nWl~fdD~~V~~~s~~~v~~~~~~s~~~~~~~~~  572 (587)
T KOG1864|consen  515 AVVVHLGSTPNRGHYVAYVKSLD-FNWLLFDDDNVEPISEEPVSEFTGSSGDTLFYYVQ  572 (587)
T ss_pred             EEEEeccCCCCCcceEEEEeeCC-CCceecccccccccCcchhhhccCCCccceeeeEE
Confidence            7999999 999999999999853 33999999999999888765   467777777654


No 33 
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=99.27  E-value=4.1e-12  Score=89.49  Aligned_cols=55  Identities=22%  Similarity=0.407  Sum_probs=48.9

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCC--cEEEEcCceEEEcCCCcCCCCCeEEEEEEEc
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTK--EWHYFNDETVLEQRPQDEDFNNAYILFYKKR   55 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~--~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~   55 (66)
                      |||+|.| ++.+|||++|+|+...+  +|+.|||+++-..+.-+....+.||.||+|.
T Consensus       692 AvI~HkG~s~haGHYv~fIrk~~~~K~kWvl~nDek~v~~~svE~~k~nGYiylf~R~  749 (749)
T COG5207         692 AVICHKGDSIHAGHYVWFIRKNGKDKWKWVLKNDEKTVLNSSVEVLKDNGYIYLFKRC  749 (749)
T ss_pred             eEEeccCCcccccceEEEEecccCcceeEEEEccchheehhhHHHHhhCCeEEEEecC
Confidence            7999999 99999999999986443  6899999999888888888899999999883


No 34 
>KOG1872|consensus
Probab=99.27  E-value=2.7e-12  Score=88.80  Aligned_cols=55  Identities=25%  Similarity=0.450  Sum_probs=49.2

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCC-------CCeEEEEEEEcC
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDF-------NNAYILFYKKRD   56 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~-------~~aYiLfY~r~~   56 (66)
                      |||.|.| +..+|||.+++|.+ .++|++|||..|+.+..+.+.+       .+||||.|+-+.
T Consensus       408 ~vithkgrss~sghy~aw~r~s-~~~w~~fdd~~vs~v~~e~i~~lsgggd~~~ayvllyk~~~  470 (473)
T KOG1872|consen  408 LVITHKGRSSKSGHYVAWNRVS-EDKWGHFDDDMVSFVLGETILSLSGGGDWHSAYVLLYKARV  470 (473)
T ss_pred             EeeeccccccCCCcceEEEecc-CCceeeccccccccccccceeeecCCCccchhhheeecccc
Confidence            6899999 99999999999997 5699999999999998888653       789999998654


No 35 
>KOG1871|consensus
Probab=98.76  E-value=1.6e-08  Score=69.32  Aligned_cols=56  Identities=21%  Similarity=0.430  Sum_probs=49.9

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC----CCCeEEEEEEEcC
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED----FNNAYILFYKKRD   56 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~----~~~aYiLfY~r~~   56 (66)
                      ||+.|.| ++..|||+..+.+..-+.|+.+||..|..+..+++.    +.+||+|.|++.+
T Consensus       360 ~vvyhtgtsatvghYl~dv~~s~~~gw~rIDD~~i~~v~q~dv~~~t~~r~~yllyY~~~d  420 (420)
T KOG1871|consen  360 AVVYHTGTSATVGHYLEDVSRSVPSGWQRIDDALILFVAQEDVEKVTGSRTPYLLYYIEAD  420 (420)
T ss_pred             EEEEecccccccCceEEeeeecccCceeEeccceeeeccHhhhccccCccchheeEeeecC
Confidence            5889999 999999999999988889999999999999888765    4789999998853


No 36 
>KOG1863|consensus
Probab=98.74  E-value=4.7e-09  Score=78.87  Aligned_cols=61  Identities=26%  Similarity=0.435  Sum_probs=50.7

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCC----------C------CCeEEEEEEEcCCCCCc
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDED----------F------NNAYILFYKKRDEDSDV   61 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~----------~------~~aYiLfY~r~~~~~~~   61 (66)
                      ||.+|.|..++|||+++++.+..++|++|||..|+.++..++.          .      ..||+|+|.|.+..+..
T Consensus       415 ~v~vh~g~~~~ghy~~~i~~~~~~~w~kfdd~~v~~~~~~~~l~~~~g~~~~~~~~~~~~~~~~~lv~~~~s~~~~~  491 (1093)
T KOG1863|consen  415 AVLVHSGDAHSGHYVAYINPKLDGKWVKFDDLVVTVVSEKEALEQNYGTEEIELSSTADFKNAYMLVYIRDSCESKI  491 (1093)
T ss_pred             hhhcccccccCccceeeecchhhccceeccCceeeeccHHHHHHhhCCCcchhhhcccccCCcceEEEEecCcHHhh
Confidence            5889988999999999999888899999999999999765421          1      23899999999876544


No 37 
>PF13423 UCH_1:  Ubiquitin carboxyl-terminal hydrolase
Probab=98.59  E-value=7.3e-08  Score=62.96  Aligned_cols=34  Identities=24%  Similarity=0.337  Sum_probs=29.5

Q ss_pred             CEEEeee-cCCCCeEEEEEECCC--CCcEEEEcCceE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPN--TKEWHYFNDETV   34 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~--~~~W~~fdD~~V   34 (66)
                      |+|+|.| +.+.|||+|++|...  +.+||.|||-.|
T Consensus       259 ~~V~~i~~~~~~~HlVs~vrv~~~~~~~W~lFNDflV  295 (295)
T PF13423_consen  259 SMVCHIGDSIESGHLVSLVRVGPSDDSQWYLFNDFLV  295 (295)
T ss_pred             EEEEEecCCCCCCceEEEEEcCCCCCCcEEEECcEeC
Confidence            6899999 799999999999863  369999999654


No 38 
>KOG1275|consensus
Probab=97.63  E-value=0.00022  Score=53.71  Aligned_cols=52  Identities=19%  Similarity=0.247  Sum_probs=44.6

Q ss_pred             CEEEeee-cCCCCeEEEEEECC--------CCCcEEEEcCceEEEcCCCcCC-----CCCeEEEEE
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHP--------NTKEWHYFNDETVLEQRPQDED-----FNNAYILFY   52 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~--------~~~~W~~fdD~~V~~~~~~~~~-----~~~aYiLfY   52 (66)
                      |+|+|.+ +-+.+|.+++|+..        .+.+||.|||-.|.++++++..     -+.+-||+|
T Consensus       795 a~V~~I~d~~~e~~lVs~Ikv~~~~~~~~~~dsqWylFNDfLV~~ite~EAl~~~~~WKvP~Il~Y  860 (1118)
T KOG1275|consen  795 AMVHAIGDNENEVNLVSPIKVLRPYHVIKPDDSQWYLFNDFLVSEITEEEALHFDGPWKVPAILYY  860 (1118)
T ss_pred             eEEEEeccCCCccceEEEEEccCcccccCcCcceeEEEcceeeeeCChHHheEeccCccCcEEEEE
Confidence            6899999 77899999999953        2358999999999999998855     378999999


No 39 
>KOG2026|consensus
Probab=96.92  E-value=4.8e-05  Score=52.60  Aligned_cols=47  Identities=19%  Similarity=0.369  Sum_probs=42.4

Q ss_pred             CCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEc
Q psy7177           9 VSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKR   55 (66)
Q Consensus         9 ~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~   55 (66)
                      ...|||...+++.+.++||..+|-.|++...+.+.-..+||-+|++.
T Consensus       395 ~e~~~~riqi~~~~s~kW~eiqdl~v~e~~~qmi~L~Es~iQiwe~~  441 (442)
T KOG2026|consen  395 DEDGNFRIQIYDNSSEKWYEIQDLHVTERLPQMIFLKESFIQIWEKQ  441 (442)
T ss_pred             cccCceEEEEEeCCCcceEEecccchhhhhhHHHHHHHHHHHHHhcc
Confidence            56799999999999999999999999999998888888888888764


No 40 
>PF05408 Peptidase_C28:  Foot-and-mouth virus L-proteinase;  InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C28 (clan CA).The protein fold of the peptidase unit for members of this family resembles that of papain.  The leader peptidase of Foot-and-mouth disease virus cleaves itself from the growing polyprotein and also cleaves the host translation initiation factor 4GI (eIF4G), thus inhibiting 5'-cap dependent translation [].; GO: 0004197 cysteine-type endopeptidase activity, 0016032 viral reproduction, 0019082 viral protein processing; PDB: 2JQF_R 1QMY_B 1QOL_G 2JQG_R.
Probab=93.69  E-value=0.2  Score=31.88  Aligned_cols=47  Identities=15%  Similarity=0.239  Sum_probs=31.0

Q ss_pred             eee-c-CCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCC
Q psy7177           5 PSK-G-VSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDED   58 (66)
Q Consensus         5 H~G-~-~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~   58 (66)
                      |.| . -..||-+.+++.  .+.||.+||+.+.+-+++-.     =+|.|..-+.+
T Consensus       130 ~agi~~~g~~Havfa~~t--s~gWy~iDDe~~y~~tPdp~-----~VLvfvp~D~E  178 (193)
T PF05408_consen  130 HAGIFLKGQEHAVFACVT--SDGWYAIDDEDFYPWTPDPS-----DVLVFVPYDQE  178 (193)
T ss_dssp             EEEEEEESTTEEEEEEEE--TTCEEEEETTEEEE----GG-----GEEEEEESSSS
T ss_pred             hhHheecCCcceEEEEEe--eCcEEEecCCeeeeCCCChh-----heEEEcccCcc
Confidence            566 3 447999988887  57899999999998766432     24666655433


No 41 
>PF15499 Peptidase_C98:  Ubiquitin-specific peptidase-like, SUMO isopeptidase
Probab=93.59  E-value=0.081  Score=35.22  Aligned_cols=22  Identities=14%  Similarity=0.382  Sum_probs=19.5

Q ss_pred             CCeEEEEEECCCCCcEEEEcCce
Q psy7177          11 AGHYTAYTLHPNTKEWHYFNDET   33 (66)
Q Consensus        11 ~GHY~a~~~~~~~~~W~~fdD~~   33 (66)
                      --|+++++++. +|.|.++||-+
T Consensus       231 ~~HFvtWi~~~-dGsWLecDDLk  252 (275)
T PF15499_consen  231 LNHFVTWIRDS-DGSWLECDDLK  252 (275)
T ss_pred             CceeEEEEEcC-CCCeEeeccCC
Confidence            46999999997 78899999976


No 42 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=89.57  E-value=0.35  Score=19.32  Aligned_cols=14  Identities=21%  Similarity=0.843  Sum_probs=10.3

Q ss_pred             EEECCCCCcEEEEcCc
Q psy7177          17 YTLHPNTKEWHYFNDE   32 (66)
Q Consensus        17 ~~~~~~~~~W~~fdD~   32 (66)
                      +++.  ++.||.|+++
T Consensus         3 W~~~--~~~wYy~~~~   16 (19)
T PF01473_consen    3 WVQD--NGNWYYFDSD   16 (19)
T ss_dssp             EEEE--TTEEEEETTT
T ss_pred             CEEE--CCEEEEeCCC
Confidence            4555  6899999874


No 43 
>PF00770 Peptidase_C5:  Adenovirus endoprotease;  InterPro: IPR000855 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine aminopeptidases belong to the peptidase family C5 (adenain family, clan CE). Several adenovirus proteins are synthesised as precursors, requiring processing by a protease before the virion is assembled [, ]. Until recently, the adenovirus endopeptidase was classified as a serine protease, having been reported to be inhibited by serine protease inhibitors [, ]. However, it has since been shown to be inhibited by cysteine protease inhibitors, and the catalytic residues are believed to be His-54 and Cys-104 [, ].; GO: 0004197 cysteine-type endopeptidase activity, 0006508 proteolysis; PDB: 1NLN_A 1AVP_A.
Probab=76.11  E-value=4.3  Score=25.68  Aligned_cols=31  Identities=16%  Similarity=0.393  Sum_probs=21.2

Q ss_pred             CEEEeee-cCCCCeEEEEEECCCCCcEEEEcC
Q psy7177           1 MCVRPSK-GVSAGHYTAYTLHPNTKEWHYFND   31 (66)
Q Consensus         1 avv~H~G-~~~~GHY~a~~~~~~~~~W~~fdD   31 (66)
                      |||+-.| ...+=|..|++.++.+.+.|.||-
T Consensus        22 AIVNT~~retGGvHWlA~Aw~P~s~t~YmFDP   53 (183)
T PF00770_consen   22 AIVNTGGRETGGVHWLAFAWDPRSRTFYMFDP   53 (183)
T ss_dssp             EEEESS-TTT--S-EEEEEEETTTTEEEEE-T
T ss_pred             EEEecCCcccCceeEEEEEecCCcceEEEeCC
Confidence            4666666 566669999999998889999984


No 44 
>PF08770 SoxZ:  Sulphur oxidation protein SoxZ;  InterPro: IPR014880 SoxZ forms an anti parallel beta structure and forms a complex with SoxY. Sulphur oxidation occurs at the thiol of a conserved cysteine residue of the SoxY subunit []. ; PDB: 1V8H_B 2OX5_E 2OXG_E 2OXH_C.
Probab=71.54  E-value=7.1  Score=22.14  Aligned_cols=41  Identities=17%  Similarity=0.194  Sum_probs=29.0

Q ss_pred             eEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCCCC
Q psy7177          13 HYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDEDSD   60 (66)
Q Consensus        13 HY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~~~   60 (66)
                      ||+.-+.       +.+||..|-..+.....++++|+-|+-+-.....
T Consensus        41 ~~I~~v~-------v~~ng~~v~~~~~~~siS~NP~l~F~~~~~~~g~   81 (100)
T PF08770_consen   41 HFIEEVE-------VTYNGKPVFRADWGPSISENPYLRFSFKGKKSGT   81 (100)
T ss_dssp             B-EEEEE-------EEETTEEEEEEEE-TTB-SS-EEEEEEEESSSEE
T ss_pred             HheEEEE-------EEECCEEEEEEEeCCcccCCCcEEEEEecCCCcE
Confidence            6655554       3689999999999989999999999988755443


No 45 
>PF08715 Viral_protease:  Papain like viral protease;  InterPro: IPR014827 This family of viral proteases are similar to the papain protease and are required for proteolytic processing of the replicase polyprotein. The structure of this protein has shown it adopts a fold similar to that of de-ubiquitinating enzymes []. ; GO: 0004197 cysteine-type endopeptidase activity, 0008242 omega peptidase activity, 0016740 transferase activity; PDB: 3MP2_A 3EWP_B 3EWO_B 2FE8_A 3MJ5_B 3EKE_A 3EJF_A 3JZT_H 3ETI_E 3E9S_A.
Probab=69.73  E-value=6.4  Score=26.89  Aligned_cols=33  Identities=18%  Similarity=0.306  Sum_probs=20.7

Q ss_pred             EeeecCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCc
Q psy7177           4 RPSKGVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQD   41 (66)
Q Consensus         4 ~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~   41 (66)
                      +-.|+.++|||+ |.+..  +.  .+|-.++.+.+...
T Consensus       266 vF~G~~~~GHYt-~~~~~--~~--~~Dg~~~~k~~~~~  298 (320)
T PF08715_consen  266 VFTGSTDSGHYT-HDVAG--KA--MYDGDKVKKFSDNK  298 (320)
T ss_dssp             EEESCTTTCEEE-EEEES--SS--EEETTEEEEESEEE
T ss_pred             EEEcCCCccceE-EEccC--ce--eEEcCcccccCccc
Confidence            346888999999 76653  22  24666666655443


No 46 
>PF02099 Josephin:  Josephin;  InterPro: IPR006155 Human genes containing triplet repeats can markedly expand in length, leading to neuropsychiatric disease. Expansion of triplet repeats explains the phenomenon of anticipation, i.e. the increasing severity or earlier age of onset in successive generations in a pedigree []. A novel gene containing CAG repeats has been identified and mapped to chromosome 14q32.1, the genetic locus for Machado-Joseph disease (MJD). Normally, the gene contains 13-36 CAG repeats, but most clinically diagnosed patients and all affected members of a family with the clinical and pathological diagnosis of MJD show expansion of the repeat number, from 68-79 []. Similar abnormalities in related genes may give rise to diseases similar to MJD. MJD is a neurodegenerative disorder characterised by cerebellar ataxia, pyramidal and extra-pyramidal signs, peripheral nerve palsy, external ophtalmoplegia, facial and lingual fasciculation and bulging. The disease is autosomal dominant, with late onset of symptoms, generally after the fourth decade.; GO: 0008242 omega peptidase activity; PDB: 3O65_G 1YZB_A 2JRI_A 2DOS_A 2AGA_A.
Probab=61.20  E-value=17  Score=22.22  Aligned_cols=28  Identities=11%  Similarity=0.143  Sum_probs=19.9

Q ss_pred             CEEEeeecCCCCeEEEEEECCCCCcEEEEcCceE
Q psy7177           1 MCVRPSKGVSAGHYTAYTLHPNTKEWHYFNDETV   34 (66)
Q Consensus         1 avv~H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V   34 (66)
                      |+|++    ..-|.++.-|-  ++.||.+|-..-
T Consensus       101 gfI~N----~~~HWf~iRki--~~~wyNLDS~l~  128 (157)
T PF02099_consen  101 GFICN----LSRHWFAIRKI--GGQWYNLDSKLK  128 (157)
T ss_dssp             EEEEE----CTTEEEEEEEE--TTEEEEECTTTS
T ss_pred             EEEec----cCcceEEEEee--CCeeEeccCCCC
Confidence            34555    45688876666  799999987543


No 47 
>smart00460 TGc Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
Probab=59.92  E-value=18  Score=17.88  Aligned_cols=20  Identities=15%  Similarity=0.069  Sum_probs=16.1

Q ss_pred             CCCeEEEEEECCCCCcEEEEcC
Q psy7177          10 SAGHYTAYTLHPNTKEWHYFND   31 (66)
Q Consensus        10 ~~GHY~a~~~~~~~~~W~~fdD   31 (66)
                      ...|-+.-++.  +++|+.||-
T Consensus        47 ~~~H~W~ev~~--~~~W~~~D~   66 (68)
T smart00460       47 WEAHAWAEVYL--EGGWVPVDP   66 (68)
T ss_pred             CCcEEEEEEEE--CCCeEEEeC
Confidence            57888888887  489999984


No 48 
>PF05986 ADAM_spacer1:  ADAM-TS Spacer 1;  InterPro: IPR010294 This domain represents the Spacer-1 domain from the ADAM-TS family of metalloproteinases []. A cellular disintegrin and metalloproteinase (ADAM) is a family of genes with structural homology to the snake venom metalloproteinases and disintegrins []. There is variation amongst members of the family, however, all have a similar domain organisation comprising a preproregion, a reprolysin-type catalytic domain, a disintegrin-like domain, a thrombospondin type-1 (TS) module, a cysteine-rich domain, a spacer domain without cysteine residues, and a COOH-terminal TS module [, ]. They are involved in embryogenesis and have been implicated in some cancers and inflammatory diseases [].; GO: 0004222 metalloendopeptidase activity, 0031012 extracellular matrix
Probab=54.41  E-value=39  Score=19.25  Aligned_cols=51  Identities=12%  Similarity=0.147  Sum_probs=29.0

Q ss_pred             CCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCC-CCCcccCCC
Q psy7177          11 AGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDE-DSDVEVSGP   66 (66)
Q Consensus        11 ~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~-~~~~~~~gP   66 (66)
                      +.+|.| +|+. +++++.=.+..+..-..   ..-..=.+.|+|.+. .+.+...||
T Consensus        37 s~n~La-lk~~-~g~y~lNg~~~i~~~~~---~~~aGt~~~Y~~~~~~~E~i~~~GP   88 (114)
T PF05986_consen   37 SSNYLA-LKNS-DGKYVLNGNWVISWPGT---YSVAGTTFEYSRSDDNLERITAPGP   88 (114)
T ss_pred             CccEEE-EEec-CCcEEEcCCccccCCcC---EEeCCeEEEEEecCCCCEEEEcCCC
Confidence            347775 5554 36665555554432211   223333688988777 667777777


No 49 
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=53.86  E-value=21  Score=20.36  Aligned_cols=15  Identities=27%  Similarity=0.519  Sum_probs=12.5

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|+|+..+++..
T Consensus        74 ~~E~G~YTf~a~N~~   88 (101)
T cd05860          74 GTEGGTYTFLVSNSD   88 (101)
T ss_pred             hhhCcEEEEEEECCC
Confidence            467899999999863


No 50 
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=51.42  E-value=11  Score=21.69  Aligned_cols=13  Identities=23%  Similarity=0.325  Sum_probs=11.4

Q ss_pred             CCCCeEEEEEECC
Q psy7177           9 VSAGHYTAYTLHP   21 (66)
Q Consensus         9 ~~~GHY~a~~~~~   21 (66)
                      .++|+|+|-+|+.
T Consensus        80 eDSG~Y~C~~rN~   92 (104)
T cd05896          80 QDSGLYTCVLRNS   92 (104)
T ss_pred             hhCeEEEEEECCC
Confidence            4789999999986


No 51 
>cd04480 RPA1_DBD_A_like RPA1_DBD_A_like: A subgroup of uncharacterized plant OB folds with similarity to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-A, RPA1 contains three other OB folds: DBD-B, DBD-C, and RPA1N. The major DNA binding activity of RPA is associated with DBD-A and DBD-B of RPA1. RPA1 DBD-C is involved in trimerization. The ssDNA-binding mechanism is believed to be multistep and to involve conformational change.
Probab=49.37  E-value=40  Score=17.89  Aligned_cols=32  Identities=9%  Similarity=0.193  Sum_probs=25.4

Q ss_pred             CCcEEEEcCceEEEcCCCcCCCCCeEEEEEEE
Q psy7177          23 TKEWHYFNDETVLEQRPQDEDFNNAYILFYKK   54 (66)
Q Consensus        23 ~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r   54 (66)
                      .|+||.+..=.|.+.+..--.....|++.+..
T Consensus        51 eg~vy~is~f~v~~~~~~y~~~~~~y~I~f~~   82 (86)
T cd04480          51 EGKWYTISNFEVAPNTGSYRPTDHPYKIKFMS   82 (86)
T ss_pred             eCCEEEEeeEEEEcCCCcccccCCcEEEEeec
Confidence            57899999999988876666677889887654


No 52 
>PF09149 DUF1935:  Domain of unknown function (DUF1935);  InterPro: IPR015232 This entry represents a conserved region found in various bacterial and eukaryotic hypothetical proteins, as well as in the cysteine protease calpain. Its function has not, as yet, been defined. ; PDB: 1R75_A 2FE0_A.
Probab=47.48  E-value=14  Score=21.11  Aligned_cols=15  Identities=27%  Similarity=0.729  Sum_probs=9.9

Q ss_pred             CCCcEEEEcCceEEE
Q psy7177          22 NTKEWHYFNDETVLE   36 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~   36 (66)
                      .+++|..+||+.--.
T Consensus        30 ~~~~WaFYNDT~~y~   44 (104)
T PF09149_consen   30 KEGRWAFYNDTKDYE   44 (104)
T ss_dssp             TTTEEEEEE--SSEE
T ss_pred             CCCEEEEEeCCCcEE
Confidence            478999999987544


No 53 
>PF01841 Transglut_core:  Transglutaminase-like superfamily;  InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the epsilon-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Tranglutaminases have been found in a diverse range of species, from bacteria through to mammals. The enzymes require calcium binding and their activity leads to post-translational modification of proteins through acyl-transfer reactions, involving peptidyl glutamine residues as acyl donors and a variety of primary amines as acyl acceptors, with the generation of proteinase resistant isopeptide bonds [].  Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterised transglutaminase, the human blood clotting factor XIIIa' []. On the basis of the experimentally demonstrated activity of the Methanobacterium phage psiM2 pseudomurein endoisopeptidase [], it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease [].  A subunit of plasma Factor XIII revealed that each Factor XIIIA subunit is composed of four domains (termed N-terminal beta-sandwich, core domain (containing the catalytic and the regulatory sites), and C-terminal beta-barrels 1 and 2) and that two monomers assemble into the native dimer through the surfaces in domains 1 and 2, in opposite orientation. This organisation in four domains is highly conserved during evolution among transglutaminase isoforms [].; PDB: 2F4M_A 2F4O_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B ....
Probab=47.32  E-value=24  Score=19.07  Aligned_cols=20  Identities=15%  Similarity=0.244  Sum_probs=16.0

Q ss_pred             CCCeEEEEEECCCCCcEEEEc
Q psy7177          10 SAGHYTAYTLHPNTKEWHYFN   30 (66)
Q Consensus        10 ~~GHY~a~~~~~~~~~W~~fd   30 (66)
                      ..+|.+.-+..+ +++|+.+|
T Consensus        93 ~~~H~w~ev~~~-~~~W~~~D  112 (113)
T PF01841_consen   93 NDNHAWVEVYLP-GGGWIPLD  112 (113)
T ss_dssp             EEEEEEEEEEET-TTEEEEEE
T ss_pred             CCCEEEEEEEEc-CCcEEEcC
Confidence            446988888884 68899987


No 54 
>COG0093 RplN Ribosomal protein L14 [Translation, ribosomal structure and biogenesis]
Probab=46.86  E-value=38  Score=20.17  Aligned_cols=18  Identities=17%  Similarity=0.379  Sum_probs=14.9

Q ss_pred             CCcEEEEcCceEEEcCCC
Q psy7177          23 TKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        23 ~~~W~~fdD~~V~~~~~~   40 (66)
                      +|.|.+|||.-.-.++.+
T Consensus        73 DGs~i~FddNA~Viin~~   90 (122)
T COG0093          73 DGSYIKFDDNAAVIINPD   90 (122)
T ss_pred             CCCEEEeCCceEEEECCC
Confidence            789999999887777665


No 55 
>cd00524 SORL Superoxide reductase-like (SORL) domain; present in a family of mononuclear non-heme iron proteins that includes superoxide reductase and desulfoferrodoxin.  Superoxide reductase-like proteins scavenge superoxide anion radicals as a defense mechanism against reactive oxygen species and are found in anaerobic bacteria and archeae, and microaerophilic Treponema pallidum. The SORL domain contains an active iron site, Fe[His4Cys(Glu)], which in the reduced state loses the glutamate ligand. Superoxide reductase (class II) forms a homotetramer with four Fe[His4Cys(Glu)] centers. Desulfoferrodoxin (class I) is a homodimeric protein, with each protomer comprised of two domains, the N-terminal desulforedoxin (DSRD) domain and C-terminal SORL domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=45.11  E-value=50  Score=17.78  Aligned_cols=40  Identities=23%  Similarity=0.239  Sum_probs=27.7

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcC
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD   56 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~   56 (66)
                      -+.-.||+.++..       .++|..|.......  ..+++.-|..+.+
T Consensus        29 pm~~~HyI~wI~l-------~~~d~~v~~~~l~P--~~~P~~~F~l~~~   68 (86)
T cd00524          29 PMTEEHYIEWIEL-------YFGDEKVGRVELTP--GTKPEATFTVKAP   68 (86)
T ss_pred             CCCCCcEEEEEEE-------EECCeEEEEEECCC--CCCCEEEEEEecC
Confidence            4667899998864       57776777665544  5677777776643


No 56 
>PF14509 GH97_C:  Glycosyl-hydrolase 97 C-terminal, oligomerisation; PDB: 3A24_A 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A.
Probab=44.48  E-value=18  Score=20.55  Aligned_cols=38  Identities=18%  Similarity=0.311  Sum_probs=21.6

Q ss_pred             CCeEEEEEECCC-CCcEEE--EcCc--eEEEcCCCcCCCCCeE
Q psy7177          11 AGHYTAYTLHPN-TKEWHY--FNDE--TVLEQRPQDEDFNNAY   48 (66)
Q Consensus        11 ~GHY~a~~~~~~-~~~W~~--fdD~--~V~~~~~~~~~~~~aY   48 (66)
                      -|.|...+|.+. ++.||.  .|++  +.-.++.+.......|
T Consensus        13 pGeyvviARr~~~G~~Wyvg~in~~~~r~i~l~L~FL~~g~~y   55 (103)
T PF14509_consen   13 PGEYVVIARRKRDGDDWYVGGINGEDARTITLPLSFLDKGKKY   55 (103)
T ss_dssp             TTTEEEEEEEETTTTEEEEEEEE-TT-EEEEEEGCCS-TT--E
T ss_pred             CceEEEEEEEcCCCCCEEEEEeeCCCceEEEEECcccCCCCcE
Confidence            499999999963 589993  4444  3333444444444355


No 57 
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=44.36  E-value=21  Score=19.13  Aligned_cols=12  Identities=33%  Similarity=0.540  Sum_probs=10.2

Q ss_pred             CCCeEEEEEECC
Q psy7177          10 SAGHYTAYTLHP   21 (66)
Q Consensus        10 ~~GHY~a~~~~~   21 (66)
                      ++|.|.|..++.
T Consensus        64 ~~G~Y~C~~~~~   75 (91)
T cd05751          64 HAGRYRCYYRSG   75 (91)
T ss_pred             HCEEEEEEEECC
Confidence            589999999874


No 58 
>PHA02131 hypothetical protein
Probab=41.30  E-value=31  Score=18.03  Aligned_cols=26  Identities=23%  Similarity=0.469  Sum_probs=18.3

Q ss_pred             CCCeEEEEEECCCCCcEEEEcCceEEEcCCC
Q psy7177          10 SAGHYTAYTLHPNTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        10 ~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~   40 (66)
                      -.|||+--+     ..|..|.|.+|..++..
T Consensus        21 irgh~~~g~-----~c~imfk~~~v~dctfk   46 (70)
T PHA02131         21 IRGHYRFGI-----SCWIMFKNDQVIDCTFK   46 (70)
T ss_pred             eccceecce-----EEEEEEcCCCEEEeeec
Confidence            357776433     25999999999887543


No 59 
>PRK08571 rpl14p 50S ribosomal protein L14P; Reviewed
Probab=39.58  E-value=55  Score=19.67  Aligned_cols=19  Identities=16%  Similarity=0.232  Sum_probs=15.7

Q ss_pred             CCCcEEEEcCceEEEcCCC
Q psy7177          22 NTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~   40 (66)
                      .+|.|..|||..+--++.+
T Consensus        83 ~dGs~i~F~dNa~VLin~~  101 (132)
T PRK08571         83 PDGTRVKFEDNAAVIVTPE  101 (132)
T ss_pred             CCCcEEEeCCcEEEEECCC
Confidence            3788999999998888755


No 60 
>cd03172 SORL_classII Superoxide reductase-like (SORL) domain, class II; SORL-domains are present in a family of mononuclear non-heme iron proteins that includes superoxide reductase and desulfoferrodoxin.  Superoxide reductase-like proteins scavenge superoxide anion radicals as a defense mechanism against reactive oxygen species and are found in anaerobic bacteria and archeae, and microaerophilic Treponema pallidum. The SORL domain contains an active iron site, Fe[His4Cys(Glu)], which in the reduced state loses the glutamate ligand. Superoxide reductase (class II) forms a homotetramer with four Fe[His4Cys(Glu)] centers.
Probab=39.23  E-value=73  Score=18.00  Aligned_cols=41  Identities=12%  Similarity=0.042  Sum_probs=26.5

Q ss_pred             CCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcC--CCCCeEEEEEEEcC
Q psy7177           9 VSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDE--DFNNAYILFYKKRD   56 (66)
Q Consensus         9 ~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~--~~~~aYiLfY~r~~   56 (66)
                      +..+||+.++..       .++|..|........  ....+..-|..+.+
T Consensus        38 M~~~HyI~wI~l-------~~~~~~v~r~~l~p~~~~~~~P~a~F~l~~~   80 (104)
T cd03172          38 NTTEHHIEWIEL-------YFGVYLLGRVEFTAHGGVYTKPEATFTVKIP   80 (104)
T ss_pred             CCCCeEEEEEEE-------EECCEEEEEEEEeCCCCCCCCCeEEEEEEcc
Confidence            667999998864       566767766655432  25666677765544


No 61 
>PTZ00054 60S ribosomal protein L23; Provisional
Probab=38.80  E-value=56  Score=19.82  Aligned_cols=19  Identities=21%  Similarity=0.436  Sum_probs=15.9

Q ss_pred             CCCcEEEEcCceEEEcCCC
Q psy7177          22 NTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~   40 (66)
                      .+|.|+.|||.-+--++.+
T Consensus        90 ~dGs~i~F~dNA~VLin~~  108 (139)
T PTZ00054         90 KDGVFIYFEDNAGVIVNPK  108 (139)
T ss_pred             CCCcEEEeCCcEEEEECCC
Confidence            3789999999998888765


No 62 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=37.96  E-value=55  Score=16.15  Aligned_cols=14  Identities=21%  Similarity=0.268  Sum_probs=10.6

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .+.|.|+|.+.+..
T Consensus        53 ~D~G~Y~C~a~N~~   66 (75)
T cd05750          53 ADSGEYTCVVENIL   66 (75)
T ss_pred             ccCeEEEEEEEEcC
Confidence            56788888888753


No 63 
>cd04474 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds corresponding to the second OB fold, the ssDNA-binding domain (DBD)-A, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-A, RPA1 contains three other OB folds: DBD-B, DBD-C, and RPA1N. The major DNA binding activity of human RPA (hRPA) and Saccharomyces cerevisiae RPA (ScRPA) is associated with DBD-A and DBD-B of RPA1. RPA1 DBD-C is involved in trimerization. The ssDNA-binding mechanism is believed to be multistep and to involve conformational change. Although ScRPA and the hRPA have similar ssDNA-binding properties, they differ funct
Probab=37.69  E-value=75  Score=17.63  Aligned_cols=32  Identities=13%  Similarity=0.247  Sum_probs=26.0

Q ss_pred             CCcEEEEcCceEEEcCCCcCCCCCeEEEEEEE
Q psy7177          23 TKEWHYFNDETVLEQRPQDEDFNNAYILFYKK   54 (66)
Q Consensus        23 ~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r   54 (66)
                      .|+||.+..-.|.+.+..--.....|.+.+.+
T Consensus        67 eG~vy~i~~~~V~~a~~~y~~~~~~yeI~f~~   98 (104)
T cd04474          67 VGKVYYISKGSVKVANKKFNTLKNDYEITFNR   98 (104)
T ss_pred             cccEEEEeccEEeeccccCCCCCCcEEEEECC
Confidence            57899999999999877666667899887765


No 64 
>PHA01365 hypothetical protein
Probab=36.86  E-value=41  Score=18.78  Aligned_cols=25  Identities=12%  Similarity=0.207  Sum_probs=15.7

Q ss_pred             EEcCceEEEc--CCCcCCCCCeEEEEE
Q psy7177          28 YFNDETVLEQ--RPQDEDFNNAYILFY   52 (66)
Q Consensus        28 ~fdD~~V~~~--~~~~~~~~~aYiLfY   52 (66)
                      +|+|++|.++  ...+..-..-||.|=
T Consensus        15 ~fkdskieki~~lps~~dv~~KYiif~   41 (91)
T PHA01365         15 CFKDSSIDVIFMSCNNLSPHKKYMIID   41 (91)
T ss_pred             HhCCCceEEEEEecCCCCccccEEEEE
Confidence            5788888776  333334466777753


No 65 
>PF01088 Peptidase_C12:  Ubiquitin carboxyl-terminal hydrolase, family 1;  InterPro: IPR001578 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].   This group of cysteine peptidases belong to the MEROPS peptidase family C12 (ubiquitin C-terminal hydrolase family, clan CA). Families within the CA clan are loosely termed papain-like as protein fold of the peptidase unit resembles that of papain, the type example for clan CA. The type example is the human ubiquitin C-terminal hydrolase UCH-L1. Ubiquitin is highly conserved, commonly found conjugated to proteins in eukaryotic cells, where it may act as a marker for rapid degradation, or it may have a chaperone function in protein assembly []. The ubiquitin is released by cleavage from the bound protein by a protease []. A number of deubiquitinising proteases are known: all are activated by thiol compounds [, ], and inhibited by thiol-blocking agents and ubiquitin aldehyde [, ], and as such have the properties of cysteine proteases []. The deubiquitinsing proteases can be split into 2 size ranges (20-30 kDa and 100-200 kDa, IPR001394 from INTERPRO) []: this family are the 20-30 kDa ppeptides which includes the yeast yuh1. Yeast yuh1 protease is known to be active only against small ubiquitin conjugates, being inactive against conjugated beta-galactosidase []. A mammalian homologue, UCH (ubiquitin conjugate hydrolase), is one of the most abundant proteins in the brain []. Only one conserved cysteine can be identified, along with two conserved histidines. The spacing between the cysteine and the second histidine is thought to be more representative of the cysteine/histidine spacing of a cysteine protease catalytic dyad [].; GO: 0004221 ubiquitin thiolesterase activity, 0006511 ubiquitin-dependent protein catabolic process, 0005622 intracellular; PDB: 1CMX_A 4DM9_A 2ETL_A 3IRT_A 3KW5_A 3IFW_A 2LEN_A 3KVF_A 2WDT_C 2WE6_B ....
Probab=36.84  E-value=28  Score=22.21  Aligned_cols=24  Identities=8%  Similarity=-0.009  Sum_probs=18.6

Q ss_pred             CeEEEEEECCCCCcEEEEcCceEEEc
Q psy7177          12 GHYTAYTLHPNTKEWHYFNDETVLEQ   37 (66)
Q Consensus        12 GHY~a~~~~~~~~~W~~fdD~~V~~~   37 (66)
                      =||+|||..  +|.=|++|..+-.++
T Consensus       166 ~HFI~fV~~--~G~LyELDG~k~~Pi  189 (214)
T PF01088_consen  166 FHFIAFVPV--DGHLYELDGRKSGPI  189 (214)
T ss_dssp             EEEEEEEEE--TTEEEEEETTSSS-E
T ss_pred             ccEEEEEeE--CCeEEEcCCCCCCCe
Confidence            499999996  788889988765444


No 66 
>PF12252 SidE:  Dot/Icm substrate protein;  InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria. There is little literature describing the family.
Probab=36.33  E-value=52  Score=26.66  Aligned_cols=24  Identities=13%  Similarity=0.268  Sum_probs=20.6

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcCc
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFNDE   32 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD~   32 (66)
                      ..++||++..++-+ ++++|.||.-
T Consensus        59 ~~~sghwimlikg~-gn~y~lfdpl   82 (1439)
T PF12252_consen   59 RQDSGHWIMLIKGQ-GNQYYLFDPL   82 (1439)
T ss_pred             CCcCceeEEEEEcC-CCceEEeccc
Confidence            57899999999987 7899999853


No 67 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=36.31  E-value=32  Score=18.67  Aligned_cols=14  Identities=21%  Similarity=0.218  Sum_probs=11.8

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..++|.|+|.+++.
T Consensus        69 ~~DsG~Y~C~~~N~   82 (94)
T cd05756          69 LEDSGLYTCVVRNS   82 (94)
T ss_pred             cccCeEEEEEEcCC
Confidence            46789999999986


No 68 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=36.10  E-value=63  Score=16.99  Aligned_cols=21  Identities=19%  Similarity=0.158  Sum_probs=14.7

Q ss_pred             cCCCCeEEEEEECCCCCcEEE
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHY   28 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~   28 (66)
                      ..++|-|+|.+.+..+..+..
T Consensus        68 ~~D~G~Y~C~a~N~~G~~~~~   88 (92)
T cd05747          68 MSDEGNYTVVVENSEGKQEAQ   88 (92)
T ss_pred             cccCEeEEEEEEcCCCCEeEE
Confidence            467889999988875544443


No 69 
>PF02721 DUF223:  Domain of unknown function DUF223;  InterPro: IPR003871 The function of this domain has not been characterised, but may be involved in nucleic acid or nucleotide binding. 
Probab=35.28  E-value=62  Score=17.58  Aligned_cols=35  Identities=11%  Similarity=0.183  Sum_probs=27.0

Q ss_pred             CCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcC
Q psy7177          22 NTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRD   56 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~   56 (66)
                      ..|.||.+.+=.|.+....--.+...|.+.+....
T Consensus        29 ~Eg~~y~i~~F~V~~~~~~yr~t~h~y~I~f~~~T   63 (95)
T PF02721_consen   29 KEGSWYTISNFTVSPNSGSYRPTDHKYKINFMPNT   63 (95)
T ss_pred             ccCCEEEeEeEEEEeCCCceeccCCCEEEEECCcC
Confidence            36899999998888877666667888988776554


No 70 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=34.86  E-value=46  Score=17.73  Aligned_cols=15  Identities=20%  Similarity=0.251  Sum_probs=11.9

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|+|-+++..
T Consensus        53 ~~D~G~YtC~A~N~~   67 (79)
T cd05855          53 HLNNGIYTLVAKNEY   67 (79)
T ss_pred             cccCEEEEEEEEcCC
Confidence            357899999999863


No 71 
>PF10572 UPF0556:  Uncharacterised protein family UPF0556;  InterPro: IPR018887  This family of proteins has no known function. 
Probab=34.75  E-value=80  Score=19.64  Aligned_cols=26  Identities=23%  Similarity=0.529  Sum_probs=15.7

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcCce
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFNDET   33 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD~~   33 (66)
                      +.+.+||+|.|-.+.......|-+=+
T Consensus        69 s~d~~~~sC~I~RPqgkSYL~F~qFk   94 (158)
T PF10572_consen   69 SDDNGHYSCIIWRPQGKSYLFFTQFK   94 (158)
T ss_pred             cCCCCceEEEEECCCCCcEEEEEEEE
Confidence            45667777777766554555555444


No 72 
>PRK05483 rplN 50S ribosomal protein L14; Validated
Probab=33.22  E-value=72  Score=18.82  Aligned_cols=19  Identities=11%  Similarity=0.204  Sum_probs=16.0

Q ss_pred             CCCcEEEEcCceEEEcCCC
Q psy7177          22 NTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~   40 (66)
                      .+|.|..|||..+--++.+
T Consensus        72 ~dG~~i~F~dNavVLin~~   90 (122)
T PRK05483         72 PDGSYIRFDDNAAVLLNND   90 (122)
T ss_pred             CCCCEEEcCCCEEEEECCC
Confidence            4788999999999888765


No 73 
>TIGR03673 rpl14p_arch 50S ribosomal protein L14P. Part of the 50S ribosomal subunit. Forms a cluster with proteins L3 and L24e, part of which may contact the 16S rRNA in 2 intersubunit bridges.
Probab=32.99  E-value=78  Score=18.98  Aligned_cols=19  Identities=21%  Similarity=0.275  Sum_probs=15.8

Q ss_pred             CCCcEEEEcCceEEEcCCC
Q psy7177          22 NTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~   40 (66)
                      .+|.|+.|||..+--++.+
T Consensus        82 ~dGs~i~FddNa~VLin~~  100 (131)
T TIGR03673        82 PDGTRVKFEDNAVVIVTPD  100 (131)
T ss_pred             CCCcEEEeCCcEEEEECCC
Confidence            3788999999998888765


No 74 
>PF04473 DUF553:  Transglutaminase-like domain;  InterPro: IPR007562 This entry represents a transglutaminase-like domain found in a family of uncharacterised archaeal proteins that had previously been called DUF553 and UPF0252.
Probab=32.72  E-value=81  Score=19.25  Aligned_cols=19  Identities=11%  Similarity=0.204  Sum_probs=16.1

Q ss_pred             CeEEEEEECCCCCcEEEEcCc
Q psy7177          12 GHYTAYTLHPNTKEWHYFNDE   32 (66)
Q Consensus        12 GHY~a~~~~~~~~~W~~fdD~   32 (66)
                      ||-.+.++-  +|+||..|-.
T Consensus       109 ~Haa~aV~i--ng~~yvlDq~  127 (153)
T PF04473_consen  109 GHAAVAVKI--NGKYYVLDQH  127 (153)
T ss_pred             CeEEEEEEE--CCEEEEEeCC
Confidence            899999998  7899988743


No 75 
>PRK04233 hypothetical protein; Provisional
Probab=32.07  E-value=38  Score=20.19  Aligned_cols=9  Identities=22%  Similarity=0.851  Sum_probs=7.0

Q ss_pred             CCcEEEEcC
Q psy7177          23 TKEWHYFND   31 (66)
Q Consensus        23 ~~~W~~fdD   31 (66)
                      +|+|++.|.
T Consensus       120 ~g~W~YvDg  128 (129)
T PRK04233        120 DGRWYYLDA  128 (129)
T ss_pred             CCEEEEecC
Confidence            688998874


No 76 
>COG3012 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.81  E-value=35  Score=21.04  Aligned_cols=12  Identities=17%  Similarity=0.584  Sum_probs=9.5

Q ss_pred             CCcEEEEcCceE
Q psy7177          23 TKEWHYFNDETV   34 (66)
Q Consensus        23 ~~~W~~fdD~~V   34 (66)
                      +++||+.|...-
T Consensus       119 ngrWyyiDgtv~  130 (151)
T COG3012         119 NGRWYYIDGTVP  130 (151)
T ss_pred             CCEEEEECCCCC
Confidence            688999987653


No 77 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=31.46  E-value=48  Score=17.46  Aligned_cols=14  Identities=29%  Similarity=0.266  Sum_probs=10.4

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .++|-|+|.+++..
T Consensus        57 ~D~G~YtC~A~n~~   70 (85)
T cd05854          57 SHAGTYTCTAQTVV   70 (85)
T ss_pred             hhCeEEEEEEecCC
Confidence            56788888888753


No 78 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=30.54  E-value=52  Score=16.78  Aligned_cols=15  Identities=27%  Similarity=0.379  Sum_probs=11.4

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|.|+|.+.+..
T Consensus        50 ~~D~G~Y~C~a~N~~   64 (75)
T cd05744          50 KEDAGWYTVSAVNEA   64 (75)
T ss_pred             cccCEEEEEEEEcCC
Confidence            467888988888763


No 79 
>TIGR03834 EAGR_box EAGR box. The EAGR box (Enriched in Aromatic and Glycine Residues) is found in three different proteins of the Mycoplasma genitalium terminal organelle, which acts in both cytadherence and gliding motility. The presence of this domain in a genome predicts the Mycoplasma-type terminal organelle structure, gliding motility, and cytadherence. The EAGR box may occur from one to nine times in a protein.
Probab=30.18  E-value=58  Score=14.44  Aligned_cols=19  Identities=32%  Similarity=0.758  Sum_probs=12.0

Q ss_pred             ecCCCCeEEEEEECCCCCcEE---EEcC
Q psy7177           7 KGVSAGHYTAYTLHPNTKEWH---YFND   31 (66)
Q Consensus         7 G~~~~GHY~a~~~~~~~~~W~---~fdD   31 (66)
                      |+...|||-      .++.|.   .||+
T Consensus         2 Gn~~YG~yd------~~~~WiW~GyFDe   23 (28)
T TIGR03834         2 GNEEYGYYD------ENGEWIWKGYFDE   23 (28)
T ss_pred             CccccccCc------CCCcEEEeeEeCc
Confidence            566778883      256776   5554


No 80 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=30.08  E-value=64  Score=16.76  Aligned_cols=16  Identities=25%  Similarity=0.094  Sum_probs=11.9

Q ss_pred             cCCCCeEEEEEECCCC
Q psy7177           8 GVSAGHYTAYTLHPNT   23 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~   23 (66)
                      ..++|-|+|.+++...
T Consensus        45 ~~D~G~YtC~a~~~~~   60 (72)
T cd07702          45 EEDAGIYTILLGIKQY   60 (72)
T ss_pred             HHHCEEEEEEEEcccc
Confidence            3567999999888643


No 81 
>PF05717 TnpB_IS66:  IS66 Orf2 like protein;  InterPro: IPR008878 Thess proteins are found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition []. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=29.70  E-value=88  Score=17.84  Aligned_cols=38  Identities=11%  Similarity=0.183  Sum_probs=25.1

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcCceEEEcCCCcCCCCCeEEEEEEEcCCC
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQRPQDEDFNNAYILFYKKRDED   58 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~~~~~~~~~~aYiLfY~r~~~~   58 (66)
                      .+.+||-+.|+-..         -+.|+.+-+    ..+.|.|+|+|.+..
T Consensus        31 dp~~g~~fvF~nr~---------r~riKiL~w----d~~G~~L~~KRLe~G   68 (107)
T PF05717_consen   31 DPFSGDLFVFCNRR---------RDRIKILYW----DGDGFWLYYKRLERG   68 (107)
T ss_pred             CCCcceEEEEEecc---------CCceEEEec----cCCceEEeeeeecCC
Confidence            56677777666553         245555533    478999999987653


No 82 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=29.35  E-value=48  Score=16.75  Aligned_cols=15  Identities=27%  Similarity=0.357  Sum_probs=12.0

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+.+..
T Consensus        44 ~~D~G~YtC~a~N~~   58 (71)
T cd04976          44 EEDAGNYTVVLTNKQ   58 (71)
T ss_pred             HHHCEEEEEEEEcCC
Confidence            467899999999864


No 83 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=29.10  E-value=95  Score=16.25  Aligned_cols=15  Identities=27%  Similarity=0.361  Sum_probs=12.0

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+.+..
T Consensus        55 ~~D~G~YtC~A~N~~   69 (81)
T cd04971          55 HVNNGNYTLVASNEY   69 (81)
T ss_pred             cccCeEEEEEEEeCC
Confidence            357899999999864


No 84 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=28.85  E-value=62  Score=17.10  Aligned_cols=15  Identities=7%  Similarity=0.306  Sum_probs=11.1

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+++..
T Consensus        56 ~~D~G~YtC~A~N~~   70 (88)
T cd05735          56 REDSGFFSCHAINSY   70 (88)
T ss_pred             cccCEEEEEEEEcCC
Confidence            457788888888763


No 85 
>PF02750 Synapsin_C:  Synapsin, ATP binding domain;  InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments). The family comprises 5 homologous proteins Ia, Ib, IIa, IIb and III. Synapsins I, II, and III are encoded by 3 different genes. The a and b isoforms of synapsin I and II are splice variants of the primary transcripts []. Synapsin I is mainly associated with regulation of neurotransmitter release from presynaptic neuron terminals []. Synapsin II, as well as being involved in neurotransmitter release, has a role in the synaptogenesis and synaptic plasticity responsible for long term potentiation []. Recent studies implicate synapsin III with a developmental role in neurite elongation and synapse formation that is distinct from the functions of synapsins I and II []. Structurally, synapsins are multidomain proteins, of which 3 domains are common to all the mammalian forms. The N-terminal `A' domain is ~30 residues long and contains a serine residue that serves as an acceptor site for protein kinase-mediated phosphorylation. This is followed by the `B' linker domain, which is ~80 residues long and is relatively poorly conserved. Domain `C' is the longest, spanning approximately 300 residues. This domain is highly conserved across all the synapsins (including those from Drosophila) and is possessed by all splice variants. The remaining six domains, D-I, are not shared by all the synapsins and differ both between the primary transcripts and the splice variants. This entry represent the ATP-grasp fold found in synapsins, which is responsible for Ca dependent ATP binding. ; PDB: 1PX2_A 1PK8_F 1AUV_B 1AUX_A 2P0A_A 1I7N_A 1I7L_A.
Probab=28.61  E-value=32  Score=22.19  Aligned_cols=17  Identities=24%  Similarity=0.604  Sum_probs=13.1

Q ss_pred             CCeEEEEEECCCCCcEE
Q psy7177          11 AGHYTAYTLHPNTKEWH   27 (66)
Q Consensus        11 ~GHY~a~~~~~~~~~W~   27 (66)
                      +.+|.||.|.+.++.|-
T Consensus       107 G~~ykA~~R~sis~nWK  123 (203)
T PF02750_consen  107 GNNYKAYMRTSISGNWK  123 (203)
T ss_dssp             TTEEEEEEEEESSSTSS
T ss_pred             cCeEEEEEEcccccccc
Confidence            57999999986556664


No 86 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=28.58  E-value=1e+02  Score=16.39  Aligned_cols=14  Identities=21%  Similarity=0.287  Sum_probs=10.7

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .+.|.|+|.+++..
T Consensus        73 ~D~G~Y~C~A~N~~   86 (97)
T cd05869          73 TDAGEYLCTASNTI   86 (97)
T ss_pred             CcCEEEEEEEecCC
Confidence            46788888888764


No 87 
>PRK00183 hypothetical protein; Provisional
Probab=27.97  E-value=42  Score=20.65  Aligned_cols=11  Identities=9%  Similarity=0.570  Sum_probs=8.8

Q ss_pred             CCcEEEEcCce
Q psy7177          23 TKEWHYFNDET   33 (66)
Q Consensus        23 ~~~W~~fdD~~   33 (66)
                      +++|++.|...
T Consensus       120 ~g~W~YvDG~~  130 (157)
T PRK00183        120 QGRWYFIDPTV  130 (157)
T ss_pred             CCEEEeccccC
Confidence            68999998744


No 88 
>KOG1415|consensus
Probab=27.94  E-value=70  Score=20.91  Aligned_cols=24  Identities=4%  Similarity=0.087  Sum_probs=19.3

Q ss_pred             CeEEEEEECCCCCcEEEEcCceEEEc
Q psy7177          12 GHYTAYTLHPNTKEWHYFNDETVLEQ   37 (66)
Q Consensus        12 GHY~a~~~~~~~~~W~~fdD~~V~~~   37 (66)
                      =||+||+..  +|.-|..|...--++
T Consensus       160 ~HFI~~v~~--~G~lYELDgR~~fPi  183 (222)
T KOG1415|consen  160 LHFICFVNK--NGHLYELDGRKPFPI  183 (222)
T ss_pred             eEEEEEEcc--CCeEEEecCCcCCCc
Confidence            399999996  789999998755444


No 89 
>PRK10579 hypothetical protein; Provisional
Probab=27.82  E-value=1.2e+02  Score=17.16  Aligned_cols=36  Identities=17%  Similarity=0.404  Sum_probs=25.0

Q ss_pred             EEECCCCCcEEEEcCceEEEcCCCc-----CCCCCeEEEEE
Q psy7177          17 YTLHPNTKEWHYFNDETVLEQRPQD-----EDFNNAYILFY   52 (66)
Q Consensus        17 ~~~~~~~~~W~~fdD~~V~~~~~~~-----~~~~~aYiLfY   52 (66)
                      .++.+....|-.|.--.--.++.+.     +....+|+..|
T Consensus        53 ~V~Lpg~~ew~~~~aG~sF~VpanssF~l~v~~~t~Y~C~y   93 (94)
T PRK10579         53 NVLLPGATDWQVYEAGEVFNVPGHSEFHLQVAEPTSYLCRY   93 (94)
T ss_pred             EEECCCCcccEEeCCCCEEEECCCCeEEEEECcceeeEEEc
Confidence            5566666789888877666666554     44578888776


No 90 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=27.56  E-value=56  Score=16.86  Aligned_cols=14  Identities=14%  Similarity=0.254  Sum_probs=11.3

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..+.|.|+|.+.+.
T Consensus        73 ~~D~G~Y~C~a~N~   86 (100)
T cd07693          73 RSDEGVYVCVAHNS   86 (100)
T ss_pred             cCcCEEEEEEEEcc
Confidence            45889999999875


No 91 
>TIGR01067 rplN_bact ribosomal protein L14, bacterial/organelle. This model distinguishes bacterial and most organellar examples of ribosomal protein L14 from all archaeal and eukaryotic forms.
Probab=27.30  E-value=72  Score=18.80  Aligned_cols=19  Identities=11%  Similarity=0.228  Sum_probs=15.9

Q ss_pred             CCCcEEEEcCceEEEcCCC
Q psy7177          22 NTKEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~   40 (66)
                      .+|.|+.|||..+--++.+
T Consensus        72 ~dG~~i~F~~Na~VLin~~   90 (122)
T TIGR01067        72 KDGSYIRFDDNACVLINKN   90 (122)
T ss_pred             CCCCEEECCCceEEEECCC
Confidence            3788999999998888765


No 92 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=27.14  E-value=58  Score=17.09  Aligned_cols=14  Identities=21%  Similarity=0.278  Sum_probs=11.9

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .+.|.|+|.+++..
T Consensus        69 ~d~G~Y~C~a~N~~   82 (91)
T cd04967          69 KDAGRYQCLASNIV   82 (91)
T ss_pred             CCCEEEEEEEEcCC
Confidence            68999999999863


No 93 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=27.08  E-value=65  Score=16.16  Aligned_cols=15  Identities=13%  Similarity=0.118  Sum_probs=11.8

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+.+..
T Consensus        53 ~~DsG~Y~C~a~N~~   67 (76)
T cd05895          53 LADNGEYKCMVSSKL   67 (76)
T ss_pred             cccCEEEEEEEEeCC
Confidence            467899999998763


No 94 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=26.94  E-value=55  Score=16.74  Aligned_cols=15  Identities=33%  Similarity=0.390  Sum_probs=11.8

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|-+.+..
T Consensus        40 ~~D~G~YtC~a~N~~   54 (67)
T cd05863          40 EASAGTYTLVLWNSA   54 (67)
T ss_pred             HHHCEEEEEEEEECC
Confidence            357899999998863


No 95 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=26.39  E-value=63  Score=16.98  Aligned_cols=15  Identities=13%  Similarity=0.231  Sum_probs=12.1

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|+|.+.+..
T Consensus        67 ~~D~G~Y~C~a~N~~   81 (95)
T cd05730          67 KLDEAEYTCIAENKA   81 (95)
T ss_pred             hhhCEEEEEEEEcCC
Confidence            457899999999864


No 96 
>PF06680 DUF1181:  Protein of unknown function (DUF1181);  InterPro: IPR009566 This family consists of several hypothetical proteins of around 120 residues in length which are found specifically in Trypanosoma brucei. The function of this family is unknown.
Probab=26.31  E-value=71  Score=18.38  Aligned_cols=25  Identities=28%  Similarity=0.708  Sum_probs=19.2

Q ss_pred             CCCeEEEEEECCCCCcEEEEcCceE
Q psy7177          10 SAGHYTAYTLHPNTKEWHYFNDETV   34 (66)
Q Consensus        10 ~~GHY~a~~~~~~~~~W~~fdD~~V   34 (66)
                      .+|||.-++-...+..|-+-|.-.|
T Consensus        43 ~~ghy~~wvargesedwdysnsfvv   67 (120)
T PF06680_consen   43 NSGHYHRWVARGESEDWDYSNSFVV   67 (120)
T ss_pred             ccCceEEeeecCCccccCccCceEE
Confidence            5799999998877778877766443


No 97 
>PF13529 Peptidase_C39_2:  Peptidase_C39 like family; PDB: 3ERV_A.
Probab=26.26  E-value=64  Score=17.69  Aligned_cols=23  Identities=30%  Similarity=0.514  Sum_probs=13.1

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcC
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFND   31 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD   31 (66)
                      ....|||+..+--..++ ++.++|
T Consensus       120 ~~~~~H~vvi~Gy~~~~-~~~v~D  142 (144)
T PF13529_consen  120 GTYGGHYVVIIGYDEDG-YVYVND  142 (144)
T ss_dssp             E-TTEEEEEEEEE-SSE--EEEE-
T ss_pred             CCcCCEEEEEEEEeCCC-EEEEeC
Confidence            34689999888754343 566655


No 98 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=26.17  E-value=1e+02  Score=16.20  Aligned_cols=14  Identities=29%  Similarity=0.306  Sum_probs=10.4

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .+.|.|+|.+.+..
T Consensus        65 ~D~G~Y~C~A~N~~   78 (90)
T cd04974          65 DDAGEYTCLAGNSI   78 (90)
T ss_pred             ccCcEEEEEeeccc
Confidence            57788888888753


No 99 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=25.77  E-value=65  Score=16.62  Aligned_cols=13  Identities=31%  Similarity=0.373  Sum_probs=9.9

Q ss_pred             CCCCeEEEEEECC
Q psy7177           9 VSAGHYTAYTLHP   21 (66)
Q Consensus         9 ~~~GHY~a~~~~~   21 (66)
                      .++|-|+|.+.+.
T Consensus        51 ~D~G~Y~C~A~N~   63 (75)
T cd05893          51 EDAGWYTVSAKNE   63 (75)
T ss_pred             HHCEEEEEEEEcC
Confidence            4678888888875


No 100
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=25.47  E-value=67  Score=17.18  Aligned_cols=15  Identities=20%  Similarity=0.319  Sum_probs=12.1

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|.|-+++..
T Consensus        64 ~~D~G~Y~C~a~N~~   78 (91)
T cd05740          64 RSDTGHYQCEASNEV   78 (91)
T ss_pred             hhhCEEEEEEEEcCC
Confidence            357899999999864


No 101
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=25.36  E-value=60  Score=16.08  Aligned_cols=15  Identities=13%  Similarity=0.186  Sum_probs=12.0

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|+|.+.+..
T Consensus        45 ~~D~G~Y~C~a~N~~   59 (69)
T cd05746          45 VADQGRYECVARNTI   59 (69)
T ss_pred             hhhCEEEEEEEECCC
Confidence            467899999998863


No 102
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=24.78  E-value=70  Score=16.56  Aligned_cols=15  Identities=27%  Similarity=0.384  Sum_probs=10.8

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|+|.+.+..
T Consensus        50 ~~D~G~Y~C~A~N~~   64 (75)
T cd05892          50 KKDAGWYTVSAVNEA   64 (75)
T ss_pred             hhhCEEEEEEEEcCc
Confidence            456788888888753


No 103
>COG5263 FOG: Glucan-binding domain (YG repeat) [General function prediction only]
Probab=24.42  E-value=1.1e+02  Score=20.95  Aligned_cols=15  Identities=20%  Similarity=0.598  Sum_probs=8.2

Q ss_pred             CCcEEEEcCceEEEc
Q psy7177          23 TKEWHYFNDETVLEQ   37 (66)
Q Consensus        23 ~~~W~~fdD~~V~~~   37 (66)
                      ++.||.|||..+...
T Consensus       221 ~GsWYyl~~~g~m~t  235 (313)
T COG5263         221 KGSWYYLDDSGDMAT  235 (313)
T ss_pred             cceEEEEecCcccee
Confidence            456666665554443


No 104
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=24.24  E-value=63  Score=16.12  Aligned_cols=14  Identities=21%  Similarity=0.399  Sum_probs=11.6

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..+.|.|+|.+.+.
T Consensus        48 ~~D~G~Y~C~a~N~   61 (73)
T cd04969          48 KSDEGKYTCFAENF   61 (73)
T ss_pred             hhHCEEEEEEEECC
Confidence            45789999999986


No 105
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=24.24  E-value=69  Score=16.00  Aligned_cols=15  Identities=13%  Similarity=0.271  Sum_probs=11.8

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|.|+|.+.+..
T Consensus        45 ~~D~G~Y~C~a~N~~   59 (71)
T cd05876          45 ESDDGEYVCTAENSE   59 (71)
T ss_pred             HHhCEEEEEEEEcCC
Confidence            457899999998863


No 106
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=24.11  E-value=71  Score=15.79  Aligned_cols=13  Identities=8%  Similarity=0.059  Sum_probs=10.7

Q ss_pred             CCCCeEEEEEECC
Q psy7177           9 VSAGHYTAYTLHP   21 (66)
Q Consensus         9 ~~~GHY~a~~~~~   21 (66)
                      .+.|.|+|.+++.
T Consensus        51 ~D~G~Y~C~A~N~   63 (76)
T cd04978          51 NDTAVYQCNASNV   63 (76)
T ss_pred             hhCEEEEEEEEcc
Confidence            5678999999875


No 107
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=24.09  E-value=1.4e+02  Score=16.58  Aligned_cols=25  Identities=8%  Similarity=0.292  Sum_probs=12.6

Q ss_pred             CCCCeEEEEEECCCCCcEEEEcCce
Q psy7177           9 VSAGHYTAYTLHPNTKEWHYFNDET   33 (66)
Q Consensus         9 ~~~GHY~a~~~~~~~~~W~~fdD~~   33 (66)
                      .++|-|.|.+....+.+|.--.+..
T Consensus        90 ~Dsg~Y~C~~~~~~~~~~~f~~gt~  114 (119)
T cd05712          90 EDSGKYFFRVELGDSNKYNFLKNTL  114 (119)
T ss_pred             hhCeEEEEEEEcCCccEEEecCCeE
Confidence            4566666666554344444333333


No 108
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=23.90  E-value=74  Score=16.25  Aligned_cols=15  Identities=20%  Similarity=0.488  Sum_probs=11.8

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..+.|-|+|.+.+..
T Consensus        48 ~~D~G~Y~C~A~N~~   62 (73)
T cd05852          48 KLDEGSYTCFAENNR   62 (73)
T ss_pred             hhHCEEEEEEEECCC
Confidence            457899999999863


No 109
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=23.88  E-value=61  Score=17.48  Aligned_cols=14  Identities=21%  Similarity=0.290  Sum_probs=10.5

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .++|-|+|.+++..
T Consensus        57 ~dsG~YtC~a~n~~   70 (85)
T cd05853          57 KHAGKYVCMVQTSV   70 (85)
T ss_pred             HHCEEEEEEEEccc
Confidence            35688999998753


No 110
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=23.64  E-value=86  Score=15.65  Aligned_cols=14  Identities=21%  Similarity=0.247  Sum_probs=10.8

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..+.|.|+|.+.+.
T Consensus        48 ~~D~G~Y~C~a~N~   61 (76)
T cd05736          48 YEDTGAYTCIAKNE   61 (76)
T ss_pred             cccCEEEEEEEEcC
Confidence            35778898888875


No 111
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=23.22  E-value=94  Score=15.72  Aligned_cols=17  Identities=18%  Similarity=0.178  Sum_probs=13.3

Q ss_pred             CcEEEEcCceEEEcCCC
Q psy7177          24 KEWHYFNDETVLEQRPQ   40 (66)
Q Consensus        24 ~~W~~fdD~~V~~~~~~   40 (66)
                      .+||+.+|+.|+.....
T Consensus         5 ~~yY~v~~~kv~rk~~~   21 (51)
T COG1998           5 LKYYEVDDEKVKRKNRF   21 (51)
T ss_pred             eeEEEEcCCcEEEcccc
Confidence            47999999998876543


No 112
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=22.95  E-value=1.2e+02  Score=16.41  Aligned_cols=14  Identities=21%  Similarity=0.140  Sum_probs=11.0

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..++|-|+|.+.+.
T Consensus        69 ~~D~G~YtC~A~N~   82 (96)
T cd05865          69 IDDAGIYKCVVSNE   82 (96)
T ss_pred             hhhCEEEEEEEEcC
Confidence            46788888888875


No 113
>PF08053 Tna_leader:  Tryptophanese operon leader peptide;  InterPro: IPR012620 This entry defines the apparent leader peptides of tryptophanase operons in Escherichia coli, Vibrio cholerae, Photobacterium profundum, Haemophilus influenzae, and related species. It has been suggested that these peptides act in cis to alter the behaviour of the translating ribosome []. The tryptophanese (tna) operon leader peptide catalyses the degradation of L-tryptophan to indole, pyruvate and ammonia, enabling the bacteria to utilise tryptophan as a source of carbon, nitrogen and energy. The tna operon of Escherichia coli contains two major structural genes, tnaA and tnaB. Preceding tnaA in the tna operon is a 319 -nucleotide transcribed regulatory region that contains the coding region for a 24-residue leader peptide, TnaC. The RNA sequence in the vicinity of the tnaC stop codon is rich in Cytidylate residues which is required for efficient Rho -dependent termination in the leader region of the tna operon [].; GO: 0031554 regulation of transcription termination, DNA-dependent, 0031556 transcriptional attenuation by ribosome
Probab=22.89  E-value=52  Score=13.74  Aligned_cols=12  Identities=25%  Similarity=0.720  Sum_probs=8.9

Q ss_pred             CCcEEEEcCceE
Q psy7177          23 TKEWHYFNDETV   34 (66)
Q Consensus        23 ~~~W~~fdD~~V   34 (66)
                      ..+|+..|...|
T Consensus         9 tskwfnidnkiv   20 (24)
T PF08053_consen    9 TSKWFNIDNKIV   20 (24)
T ss_pred             eeeeEeccCeec
Confidence            358999987655


No 114
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=22.70  E-value=88  Score=16.00  Aligned_cols=14  Identities=29%  Similarity=0.437  Sum_probs=11.3

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..++|-|+|.+++.
T Consensus        54 ~~DsG~Y~C~a~n~   67 (79)
T cd04973          54 PRDSGLYACVTSSP   67 (79)
T ss_pred             hhhCEEEEEEEeCC
Confidence            45789999999875


No 115
>PF10949 DUF2777:  Protein of unknown function (DUF2777);  InterPro: IPR024488 This family of proteins with unknown function appears to be restricted to Bacillaceae.
Probab=22.70  E-value=1.8e+02  Score=18.50  Aligned_cols=19  Identities=26%  Similarity=0.550  Sum_probs=13.2

Q ss_pred             CCcEEEEcCceEEEcCCCc
Q psy7177          23 TKEWHYFNDETVLEQRPQD   41 (66)
Q Consensus        23 ~~~W~~fdD~~V~~~~~~~   41 (66)
                      +++|+.|||+.=+....++
T Consensus        25 ~~~w~ffddE~~Eallle~   43 (185)
T PF10949_consen   25 NDEWIFFDDEEGEALLLEE   43 (185)
T ss_pred             eCcEEEEEcCCCceechhh
Confidence            5789999998755444433


No 116
>PRK01842 hypothetical protein; Provisional
Probab=22.67  E-value=86  Score=19.19  Aligned_cols=10  Identities=20%  Similarity=0.900  Sum_probs=8.2

Q ss_pred             CCcEEEEcCc
Q psy7177          23 TKEWHYFNDE   32 (66)
Q Consensus        23 ~~~W~~fdD~   32 (66)
                      +|+|++.|..
T Consensus       137 ~G~W~YvDG~  146 (149)
T PRK01842        137 QGRWRYVDGD  146 (149)
T ss_pred             CCeEEEeCCE
Confidence            6899999863


No 117
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=22.62  E-value=82  Score=15.64  Aligned_cols=15  Identities=20%  Similarity=0.264  Sum_probs=11.5

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+.+..
T Consensus        57 ~~D~G~Y~C~a~N~~   71 (82)
T cd05856          57 PEDSGKYTCHVSNRA   71 (82)
T ss_pred             hhhCEEEEEEEEcCC
Confidence            457889999988753


No 118
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=22.56  E-value=1.1e+02  Score=17.36  Aligned_cols=15  Identities=20%  Similarity=0.304  Sum_probs=11.4

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      -.+.|-|+|.++++.
T Consensus        89 ~sD~G~Y~C~v~n~p  103 (116)
T cd05879          89 YTDNGTFTCDVKNPP  103 (116)
T ss_pred             cccCEEEEEEEEcCC
Confidence            357788999988764


No 119
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=22.33  E-value=88  Score=16.45  Aligned_cols=15  Identities=27%  Similarity=0.337  Sum_probs=12.1

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|.|++.+++..
T Consensus        61 ~~D~G~Y~c~a~N~~   75 (86)
T cd05894          61 REDEGVYTITVTNPV   75 (86)
T ss_pred             cCcCEEEEEEEEeCC
Confidence            467899999999863


No 120
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=22.30  E-value=65  Score=16.47  Aligned_cols=15  Identities=33%  Similarity=0.465  Sum_probs=11.6

Q ss_pred             cCCCCeEEEEEECCC
Q psy7177           8 GVSAGHYTAYTLHPN   22 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~   22 (66)
                      ..++|-|+|.+.+..
T Consensus        43 ~~D~G~YtC~a~N~~   57 (70)
T cd05864          43 EKDAGNYTVVLTNPI   57 (70)
T ss_pred             HHHCEEEEEEEEECC
Confidence            356799999998863


No 121
>PRK09806 tryptophanase leader peptide; Provisional
Probab=21.84  E-value=63  Score=13.75  Aligned_cols=13  Identities=23%  Similarity=0.562  Sum_probs=9.6

Q ss_pred             CCcEEEEcCceEE
Q psy7177          23 TKEWHYFNDETVL   35 (66)
Q Consensus        23 ~~~W~~fdD~~V~   35 (66)
                      ..+|+..|...|.
T Consensus         9 tskwfnidnkivd   21 (26)
T PRK09806          9 TSKWFNIDNKIVD   21 (26)
T ss_pred             eeeEEeccCeeec
Confidence            3589999877664


No 122
>PRK01617 hypothetical protein; Provisional
Probab=21.36  E-value=69  Score=19.56  Aligned_cols=15  Identities=13%  Similarity=0.578  Sum_probs=10.9

Q ss_pred             EEECCCCCcEEEEcCce
Q psy7177          17 YTLHPNTKEWHYFNDET   33 (66)
Q Consensus        17 ~~~~~~~~~W~~fdD~~   33 (66)
                      |+|.  +|+|++.|...
T Consensus       117 F~r~--~g~W~Yvdg~~  131 (154)
T PRK01617        117 FLKE--NGQWYYIDGTR  131 (154)
T ss_pred             eEEe--CCCEEecCCCC
Confidence            4554  68999998754


No 123
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=21.28  E-value=1e+02  Score=15.58  Aligned_cols=14  Identities=14%  Similarity=0.159  Sum_probs=10.3

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..+.|.|.|-+.+.
T Consensus        53 ~~D~G~Y~C~a~N~   66 (79)
T cd05734          53 EEDSGYYLCKVSND   66 (79)
T ss_pred             cccCEEEEEEEEeC
Confidence            35678888888775


No 124
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=21.11  E-value=90  Score=15.28  Aligned_cols=14  Identities=21%  Similarity=0.211  Sum_probs=11.2

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..++|-|+|.+.+.
T Consensus        44 ~~D~G~Y~C~a~N~   57 (69)
T cd05725          44 AGDEGSYTCEAENM   57 (69)
T ss_pred             hhHCEEEEEEEEcC
Confidence            45789999999875


No 125
>CHL00057 rpl14 ribosomal protein L14
Probab=21.10  E-value=1.2e+02  Score=17.89  Aligned_cols=20  Identities=10%  Similarity=0.146  Sum_probs=16.1

Q ss_pred             CCCcEEEEcCceEEEcCCCc
Q psy7177          22 NTKEWHYFNDETVLEQRPQD   41 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~~   41 (66)
                      .+|.|.+|||..+--++.+.
T Consensus        72 ~dG~~i~F~~Na~VLin~~~   91 (122)
T CHL00057         72 DNGMIIRFDDNAAVVIDQEG   91 (122)
T ss_pred             CCCcEEEcCCceEEEECCCC
Confidence            36889999999988887653


No 126
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=21.04  E-value=91  Score=15.84  Aligned_cols=14  Identities=14%  Similarity=0.109  Sum_probs=10.7

Q ss_pred             CCCCeEEEEEECCC
Q psy7177           9 VSAGHYTAYTLHPN   22 (66)
Q Consensus         9 ~~~GHY~a~~~~~~   22 (66)
                      .+.|.|.|.+++..
T Consensus        51 ~D~G~Y~C~A~N~~   64 (76)
T cd05868          51 RSSAVYQCNASNEY   64 (76)
T ss_pred             hhCEEEEEEEEcCC
Confidence            56788888888753


No 127
>PF06865 DUF1255:  Protein of unknown function (DUF1255);  InterPro: IPR009664 This family consists of several conserved hypothetical bacterial proteins of around 95 residues in length. The function of this family is unknown; PDB: 2OYZ_A 3HQX_A.
Probab=20.92  E-value=1.8e+02  Score=16.50  Aligned_cols=37  Identities=19%  Similarity=0.326  Sum_probs=20.2

Q ss_pred             EEECCCCCcEEEEcCceEEEcCCCc-----CCCCCeEEEEEE
Q psy7177          17 YTLHPNTKEWHYFNDETVLEQRPQD-----EDFNNAYILFYK   53 (66)
Q Consensus        17 ~~~~~~~~~W~~fdD~~V~~~~~~~-----~~~~~aYiLfY~   53 (66)
                      .++.+....|-.|..-..-.++.+.     +....+|+..|.
T Consensus        53 ~V~lpg~~ew~~~~aGesF~VpanssF~v~v~~~~~Y~C~y~   94 (94)
T PF06865_consen   53 EVKLPGEDEWQTYSAGESFEVPANSSFDVKVKEPTAYLCSYL   94 (94)
T ss_dssp             EEEETT-SS-EEEETT-EEEE-TTEEEEEEESS-EEEEEEE-
T ss_pred             EEEcCCCcccEEeCCCCeEEECCCCeEEEEECcceeeEEEeC
Confidence            4555555678877776666665554     446788888773


No 128
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=20.78  E-value=33  Score=21.83  Aligned_cols=26  Identities=27%  Similarity=0.428  Sum_probs=17.0

Q ss_pred             eeecCCCCeEEEEEECCCCCcEEEEcCceE
Q psy7177           5 PSKGVSAGHYTAYTLHPNTKEWHYFNDETV   34 (66)
Q Consensus         5 H~G~~~~GHY~a~~~~~~~~~W~~fdD~~V   34 (66)
                      |.|..+.|||.+--..+    -..||-.++
T Consensus        97 ~~~~~dagHy~s~g~~~----~lRF~~~N~  122 (189)
T PF05766_consen   97 HGGQWDAGHYRSRGAAP----ELRFNEDNI  122 (189)
T ss_pred             CCCCcccccccccccCc----ccccChhhH
Confidence            55688999998764433    356665554


No 129
>PTZ00320 ribosomal protein L14; Provisional
Probab=20.74  E-value=1.4e+02  Score=19.12  Aligned_cols=20  Identities=15%  Similarity=0.074  Sum_probs=16.4

Q ss_pred             CCCcEEEEcCceEEEcCCCc
Q psy7177          22 NTKEWHYFNDETVLEQRPQD   41 (66)
Q Consensus        22 ~~~~W~~fdD~~V~~~~~~~   41 (66)
                      .+|.|+.|||.-+-.++.+.
T Consensus       138 ~DGs~IrFDdNAaVLIN~qg  157 (188)
T PTZ00320        138 MSGLQTNFDRNTCILMNDQR  157 (188)
T ss_pred             CCCCEEEeCCcEEEEECCCC
Confidence            47889999999988887653


No 130
>KOG1296|consensus
Probab=20.69  E-value=56  Score=20.27  Aligned_cols=29  Identities=17%  Similarity=0.234  Sum_probs=18.6

Q ss_pred             cCCCCeEEEEEECCCCCcEEEEcCceEEEc
Q psy7177           8 GVSAGHYTAYTLHPNTKEWHYFNDETVLEQ   37 (66)
Q Consensus         8 ~~~~GHY~a~~~~~~~~~W~~fdD~~V~~~   37 (66)
                      ++.+|--..-+-.. ++.|+.|||..-..|
T Consensus       120 s~esG~~f~eidls-e~ew~dYDdk~~e~V  148 (161)
T KOG1296|consen  120 SAESGTAFSEIDLS-EKEWTDYDDKAGESV  148 (161)
T ss_pred             ecccCceeeeeecc-cccceehhhcCCCee
Confidence            35566655555443 669999999764444


No 131
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=20.60  E-value=1e+02  Score=15.30  Aligned_cols=14  Identities=14%  Similarity=0.259  Sum_probs=10.8

Q ss_pred             cCCCCeEEEEEECC
Q psy7177           8 GVSAGHYTAYTLHP   21 (66)
Q Consensus         8 ~~~~GHY~a~~~~~   21 (66)
                      ..++|-|+|.+.+.
T Consensus        46 ~~D~G~Y~C~A~N~   59 (71)
T cd05723          46 KSDEGFYQCIAEND   59 (71)
T ss_pred             cccCEEEEEEEEcC
Confidence            35678888888875


No 132
>PF07206 Baculo_LEF-10:  Baculovirus late expression factor 10 (LEF-10);  InterPro: IPR009855 This family consists of several Baculovirus specific late expression factor 10 (LEF-10) sequences. LEF-10 is thought to be a late expressed structural protein although its exact function is unknown [].
Probab=20.41  E-value=1.4e+02  Score=16.16  Aligned_cols=18  Identities=22%  Similarity=0.543  Sum_probs=13.0

Q ss_pred             CCCeEEEEEEEcCCCCCc
Q psy7177          44 FNNAYILFYKKRDEDSDV   61 (66)
Q Consensus        44 ~~~aYiLfY~r~~~~~~~   61 (66)
                      -.+.||+||..-.....+
T Consensus        22 idn~Yii~nVvd~~~~~i   39 (71)
T PF07206_consen   22 IDNKYIILNVVDQESGEI   39 (71)
T ss_pred             ecCcEEEEEEEeCCCCce
Confidence            378899999887655443


No 133
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=20.23  E-value=1.5e+02  Score=15.41  Aligned_cols=19  Identities=11%  Similarity=0.045  Sum_probs=11.4

Q ss_pred             CCCCeEEEEEECCCCCcEE
Q psy7177           9 VSAGHYTAYTLHPNTKEWH   27 (66)
Q Consensus         9 ~~~GHY~a~~~~~~~~~W~   27 (66)
                      .++|-|+|-+.....|.|.
T Consensus        72 ~D~G~Y~C~v~~~~~g~~~   90 (98)
T cd05718          72 EDEGNYICEFATFPQGNRQ   90 (98)
T ss_pred             ccCEEEEEEEEeCCCCcEE
Confidence            5677787777653344443


Done!