RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy719
(45 letters)
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain. This catalytic (head) domain
has ATPase activity and belongs to the larger group of
P-loop NTPases. Myosins are actin-dependent molecular
motors that play important roles in muscle contraction,
cell motility, and organelle transport. The head domain
is a molecular motor, which utilizes ATP hydrolysis to
generate directed movement toward the plus end along
actin filaments. A cyclical interaction between myosin
and actin provides the driving force. Rates of ATP
hydrolysis and consequently the speed of movement along
actin filaments vary widely, from about 0.04 micrometer
per second for myosin I to 4.5 micrometer per second for
myosin II in skeletal muscle. Myosin II moves in
discrete steps about 5-10 nm long and generates 1-5
piconewtons of force. Upon ATP binding, the myosin head
dissociates from an actin filament. ATP hydrolysis
causes the head to pivot and associate with a new actin
subunit. The release of Pi causes the head to pivot and
move the filament (power stroke). Release of ADP
completes the cycle.
Length = 679
Score = 26.5 bits (59), Expect = 0.41
Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 7/48 (14%)
Query: 4 TIRKRKL-------YEEFLSRVSILVQCGSKKMGIVAKHVTCAMVEKG 44
TIR R+L ++EFLSR L +K+ + K V C + G
Sbjct: 605 TIRIRRLGFSVRIPFDEFLSRYRFLAPDLLEKVSLTKKQVECLLELLG 652
>gnl|CDD|217036 pfam02442, L1R_F9L, Lipid membrane protein of large eukaryotic
DNA viruses. The four families of large eukaryotic DNA
viruses, Poxviridae, Asfarviridae, Iridoviridae, and
Phycodnaviridae, referred to collectively as
nucleocytoplasmic large DNA viruses or NCLDV, have all
been shown to have a lipid membrane, in spite of the
major differences in virion structure. The paralogous
genes L1R and F9L encode membrane proteins that have a
conserved domain architecture, with a single,
C-terminal transmembrane helix, and an N-terminal,
multiple-disulfide-bonded domain. The conservation of
the myristoylated, disulfide-bonded protein L1R/F9L in
most of the NCLDV correlates with the conservation of
the thiol-disulfide oxidoreductase E10R which, in
vaccinia virus, is required for the formation of
disulfide bonds in L1R and F9L.
Length = 203
Score = 26.1 bits (58), Expect = 0.57
Identities = 8/27 (29%), Positives = 11/27 (40%), Gaps = 1/27 (3%)
Query: 1 MGSTIRKRKLYEEFLSRVSI-LVQCGS 26
MG+ L F++R L Q S
Sbjct: 1 MGAAASINTLVNLFVARYLNKLAQYAS 27
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.322 0.133 0.373
Gapped
Lambda K H
0.267 0.0714 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,123,197
Number of extensions: 116261
Number of successful extensions: 101
Number of sequences better than 10.0: 1
Number of HSP's gapped: 101
Number of HSP's successfully gapped: 2
Length of query: 45
Length of database: 10,937,602
Length adjustment: 18
Effective length of query: 27
Effective length of database: 10,139,230
Effective search space: 273759210
Effective search space used: 273759210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.2 bits)