RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy719
         (45 letters)



>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain. This catalytic (head) domain
           has ATPase activity and belongs to the larger group of
           P-loop NTPases. Myosins are actin-dependent molecular
           motors that play important roles in muscle contraction,
           cell motility, and organelle transport. The head domain
           is a molecular motor, which utilizes ATP hydrolysis to
           generate directed movement toward the plus end along
           actin filaments. A cyclical interaction between myosin
           and actin provides the driving force. Rates of ATP
           hydrolysis and consequently the speed of movement along
           actin filaments vary widely, from about 0.04 micrometer
           per second for myosin I to 4.5 micrometer per second for
           myosin II in skeletal muscle. Myosin II moves in
           discrete steps about 5-10 nm long and generates 1-5
           piconewtons of force. Upon ATP binding, the myosin head
           dissociates from an actin filament. ATP hydrolysis
           causes the head to pivot and associate with a new actin
           subunit. The release of Pi causes the head to pivot and
           move the filament (power stroke). Release of ADP
           completes the cycle.
          Length = 679

 Score = 26.5 bits (59), Expect = 0.41
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 4   TIRKRKL-------YEEFLSRVSILVQCGSKKMGIVAKHVTCAMVEKG 44
           TIR R+L       ++EFLSR   L     +K+ +  K V C +   G
Sbjct: 605 TIRIRRLGFSVRIPFDEFLSRYRFLAPDLLEKVSLTKKQVECLLELLG 652


>gnl|CDD|217036 pfam02442, L1R_F9L, Lipid membrane protein of large eukaryotic
          DNA viruses.  The four families of large eukaryotic DNA
          viruses, Poxviridae, Asfarviridae, Iridoviridae, and
          Phycodnaviridae, referred to collectively as
          nucleocytoplasmic large DNA viruses or NCLDV, have all
          been shown to have a lipid membrane, in spite of the
          major differences in virion structure. The paralogous
          genes L1R and F9L encode membrane proteins that have a
          conserved domain architecture, with a single,
          C-terminal transmembrane helix, and an N-terminal,
          multiple-disulfide-bonded domain. The conservation of
          the myristoylated, disulfide-bonded protein L1R/F9L in
          most of the NCLDV correlates with the conservation of
          the thiol-disulfide oxidoreductase E10R which, in
          vaccinia virus, is required for the formation of
          disulfide bonds in L1R and F9L.
          Length = 203

 Score = 26.1 bits (58), Expect = 0.57
 Identities = 8/27 (29%), Positives = 11/27 (40%), Gaps = 1/27 (3%)

Query: 1  MGSTIRKRKLYEEFLSRVSI-LVQCGS 26
          MG+      L   F++R    L Q  S
Sbjct: 1  MGAAASINTLVNLFVARYLNKLAQYAS 27


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0714    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 2,123,197
Number of extensions: 116261
Number of successful extensions: 101
Number of sequences better than 10.0: 1
Number of HSP's gapped: 101
Number of HSP's successfully gapped: 2
Length of query: 45
Length of database: 10,937,602
Length adjustment: 18
Effective length of query: 27
Effective length of database: 10,139,230
Effective search space: 273759210
Effective search space used: 273759210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.2 bits)