Diaphorina citri psyllid: psy7198


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MTLIKVLIHRDLWGFFLILQKRSHDRQVDLTGGPDEVYLSGLPDREWLALDFHLAHHFRYIIMTKFDPTGARQAFPCFDEPIHKTTFNVSVTHSKKYSFLWNKNKLGTRLSGKPKSLKDSEPSISQCH
cEEEEEEEEEcccccEEEEEEcccCEEEEECccccCEEEccccccccEEEEEEEccEEEEEEEEcccccccccccccccccccccEEEEEEECccccEEEEccccccCECccccCEEECccccccccc
MTLIKVLIHRDLWGFFLILQKRSHDRQVDLTGGPDEVYLSGLPDREWLALDFHLAHHFRYIIMTKFDPTGARQAFPCFDEPIHKTTFNVSVTHSKKYSFLWNKNKLGTRLSGKPKSLKDSEPSISQC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLIKVLIHRDLWGFFLILQKRSHDRQVDLTGGPDEVYLSGLPDREWLALDFHLAHHFRYIIMTKFDPTGARQAFPCFDEPIHKTTFNVSVTHSKKYSFLWNKNKLGTRLSGKPKSLKDSEPSISQCH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0070006 [MF]metalloaminopeptidase activityprobableGO:0004177, GO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SE6, chain A
Confidence level:very confident
Coverage over the Query: 1-126
View the alignment between query and template
View the model in PyMOL