Query         psy72
Match_columns 202
No_of_seqs    74 out of 76
Neff          2.3 
Searched_HMMs 46136
Date          Fri Aug 16 20:42:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy72.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/72hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4111|consensus              100.0 4.6E-33   1E-37  224.7   3.6   98   13-121    35-134 (136)
  2 PF04281 Tom22:  Mitochondrial   99.9   4E-24 8.6E-29  171.6  -0.0   77   18-101    49-128 (137)
  3 TIGR00986 3a0801s05tom22 mitoc  99.8 1.2E-21 2.6E-26  159.8   1.3   83   19-108    48-137 (145)
  4 PF04281 Tom22:  Mitochondrial   91.4   0.032   7E-07   45.5  -1.4   69   30-101    62-131 (137)
  5 TIGR03729 acc_ester putative p  50.5     9.7 0.00021   31.2   1.6   15  147-162   210-224 (239)
  6 PF03288 Pox_D5:  Poxvirus D5 p  49.7     6.5 0.00014   27.6   0.4   11  169-179    32-42  (86)
  7 PF09752 DUF2048:  Uncharacteri  40.3       8 0.00017   36.0  -0.4   26  169-199   166-191 (348)
  8 PF05381 Peptidase_C21:  Tymovi  39.6     7.3 0.00016   31.1  -0.7   20   24-45     19-40  (104)
  9 KOG1819|consensus               36.1      21 0.00045   36.4   1.6   16   89-104   817-832 (990)
 10 PF13975 gag-asp_proteas:  gag-  35.0      17 0.00036   25.4   0.6   35   11-50     26-60  (72)
 11 PF11119 DUF2633:  Protein of u  34.0      43 0.00093   24.6   2.6   24   65-88      8-31  (59)
 12 PF06752 E_Pc_C:  Enhancer of P  32.6      27 0.00059   31.4   1.6   15   87-101    18-32  (230)
 13 PRK13892 conjugal transfer pro  30.0      29 0.00062   29.1   1.3   17  118-134    40-56  (134)
 14 PF13664 DUF4149:  Domain of un  28.1      50  0.0011   23.7   2.1   29   67-95      4-34  (101)
 15 PTZ00481 Membrane attack compl  27.7      64  0.0014   32.1   3.3   40   89-130   354-394 (524)
 16 PF10925 DUF2680:  Protein of u  27.2      27 0.00058   24.9   0.6    9  171-179    51-59  (59)
 17 TIGR03141 cytochro_ccmD heme e  26.1      98  0.0021   20.5   3.1   15   87-101    30-44  (45)
 18 PF04995 CcmD:  Heme exporter p  24.9 1.2E+02  0.0025   20.1   3.3   11   91-101    33-43  (46)
 19 KOG3648|consensus               24.6      59  0.0013   34.2   2.6   27   79-107    62-88  (1179)
 20 PF03746 LamB_YcsF:  LamB/YcsF   22.1      34 0.00073   30.5   0.3   27  147-176    29-55  (242)
 21 PRK05406 LamB/YcsF family prot  21.9      30 0.00066   30.9   0.0   27  147-176    31-57  (246)
 22 PRK12569 hypothetical protein;  21.8      29 0.00064   31.0  -0.1   28  147-177    34-61  (245)
 23 KOG4670|consensus               20.4      46 0.00099   33.5   0.9   32   67-102   368-401 (602)

No 1  
>KOG4111|consensus
Probab=99.97  E-value=4.6e-33  Score=224.72  Aligned_cols=98  Identities=24%  Similarity=0.332  Sum_probs=88.0

Q ss_pred             ChhHHHHHhhhhhhcccccCCCcccccCchhhhccccceEE--eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHh
Q psy72            13 STSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFL--IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFE   90 (202)
Q Consensus        13 ~~~~~~~~t~gERLWgLEMfPesLtEMFPe~VRSAAgatfs--v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~Q   90 (202)
                      +.++--.||+-||+|||       +||||+..|++++.+++  ++++||+|+|||+++||++|||||||+|||||+||+|
T Consensus        35 ~dd~e~dETi~eRi~gL-------kEivp~g~R~~i~~~~~~av~~~kk~~~fsg~a~Wi~tTt~lIL~vP~i~e~E~~q  107 (136)
T KOG4111|consen   35 GDDSEEDETILERIWGL-------KEIVPQGRRSAIGATAGDAVFVVKKLYSFSGKAAWIATTTFLILVVPLIFETEREQ  107 (136)
T ss_pred             ccCCCcchhHHHHHHhh-------HhhcchhhhhhhhhcchhHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHHHH
Confidence            34455789999999999       78888888889887776  8999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhhhhcCCCccchhhcccCCCCC
Q psy72            91 VQEMQRNQQKQWSTRPFSWLIFAFQGVNFEN  121 (202)
Q Consensus        91 MEE~Q~qQQRQiLLGP~aa~~~A~sG~~~~~  121 (202)
                      |++.|.+||||+||||++    |++|+..+.
T Consensus       108 ~~~e~e~Qq~q~ll~p~~----~~q~~~~~a  134 (136)
T KOG4111|consen  108 QLQEQEKQQRQQLLAPNV----AAQGGKPGA  134 (136)
T ss_pred             HHhHHHHHHHHHhCCCcc----cccCCCCCC
Confidence            999999999999999999    777765543


No 2  
>PF04281 Tom22:  Mitochondrial import receptor subunit Tom22 ;  InterPro: IPR005683  The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins []. The N-terminal region of Tom22 has been shown to have chaperone-like activity, and the C-terminal region faces the intermembrane face []. ; GO: 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane
Probab=99.88  E-value=4e-24  Score=171.63  Aligned_cols=77  Identities=23%  Similarity=0.341  Sum_probs=65.1

Q ss_pred             HHHhhhhhhcccccCCCcccccCchhhhccccceEE--eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHh-HHHH
Q psy72            18 MKNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFL--IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFE-VQEM   94 (202)
Q Consensus        18 ~~~t~gERLWgLEMfPesLtEMFPe~VRSAAgatfs--v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~Q-MEE~   94 (202)
                      ..||++||||||       ++|||+.+|+.++.+++  ++.+|++|+|+|+++||++||+|||++|++||.||+| +.||
T Consensus        49 ~dETl~ERl~aL-------kdi~P~~~R~~i~~~~~~~~~~~k~~~~~~g~a~Wi~tTSallLgvPl~l~ie~EqQl~em  121 (137)
T PF04281_consen   49 EDETLLERLWAL-------KDIFPPSVRNWISSTVSTTSSAVKSLFSFSGKALWIVTTSALLLGVPLALEIEREQQLVEM  121 (137)
T ss_pred             ccccHHHHHHHH-------hccCCHHHHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            679999999999       77777777777776655  7999999999999999999999999999999999875 6666


Q ss_pred             HHhhhhh
Q psy72            95 QRNQQKQ  101 (202)
Q Consensus        95 Q~qQQRQ  101 (202)
                      |++||.|
T Consensus       122 Ekeq~~q  128 (137)
T PF04281_consen  122 EKEQQMQ  128 (137)
T ss_pred             HHHHHHH
Confidence            6544443


No 3  
>TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22. translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom22 proteins.
Probab=99.82  E-value=1.2e-21  Score=159.81  Aligned_cols=83  Identities=14%  Similarity=0.148  Sum_probs=70.9

Q ss_pred             HHhhhhhhcccccCCCcccccCchhhhccccceEE--eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHh-HHHHH
Q psy72            19 KNLKGSALWNGEQGRSSLDNSTPKESYSAAGEIFL--IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFE-VQEMQ   95 (202)
Q Consensus        19 ~~t~gERLWgLEMfPesLtEMFPe~VRSAAgatfs--v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~Q-MEE~Q   95 (202)
                      .||+.||||+|       ++|||+++|+.++++++  ++.+|++|+|+||++||++|||+||++|++++.+++| +.||+
T Consensus        48 ~ETl~ERi~AL-------kDm~Pp~~R~~i~~~~s~t~s~~ks~~sfsGkalWivsTSaLLLgVPlala~~~Eqql~emE  120 (145)
T TIGR00986        48 EETFTDRIYAL-------KDIVPPTTRGWIYHKYSTTTNFVKSTLSFAGRAAWAVSTSALLLGVPFAISFAEEQQLAEME  120 (145)
T ss_pred             cCcHHHHHHHH-------HhhCCHHHHHHHHHHHHHHHHHHHHHHHhcCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            48999999999       88888888888887766  7999999999999999999999999999999999996 66666


Q ss_pred             H----hhhhhhhcCCCc
Q psy72            96 R----NQQKQWSTRPFS  108 (202)
Q Consensus        96 ~----qQQRQiLLGP~a  108 (202)
                      +    ||+-+=+|-|++
T Consensus       121 kE~~~q~~a~e~lapG~  137 (145)
T TIGR00986       121 KEARMQELANDVLAAGG  137 (145)
T ss_pred             HHHHHHHhhhhhcCCCC
Confidence            4    444455777776


No 4  
>PF04281 Tom22:  Mitochondrial import receptor subunit Tom22 ;  InterPro: IPR005683  The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins []. The N-terminal region of Tom22 has been shown to have chaperone-like activity, and the C-terminal region faces the intermembrane face []. ; GO: 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane
Probab=91.37  E-value=0.032  Score=45.55  Aligned_cols=69  Identities=19%  Similarity=0.095  Sum_probs=44.9

Q ss_pred             ccCCCcccccCchhhhccccceEE-eeeehhhhhcccceeehhhhhHHHhhhhhhhhhhhHhHHHHHHhhhhh
Q psy72            30 EQGRSSLDNSTPKESYSAAGEIFL-IKVPISFYSFARTSTWLIATSATVALLPIVFESQRFEVQEMQRNQQKQ  101 (202)
Q Consensus        30 EMfPesLtEMFPe~VRSAAgatfs-v~vvKkLYsFSrsAlWI~~TSfmILvlPVIFEtER~QMEE~Q~qQQRQ  101 (202)
                      ||||++.|+.+-..+.+++....+ .+...|+.|...+.+=|++   +-|.+-+--|.+..+||+.|++||++
T Consensus        62 di~P~~~R~~i~~~~~~~~~~~k~~~~~~g~a~Wi~tTSallLg---vPl~l~ie~EqQl~emEkeq~~qq~~  131 (137)
T PF04281_consen   62 DIFPPSVRNWISSTVSTTSSAVKSLFSFSGKALWIVTTSALLLG---VPLALEIEREQQLVEMEKEQQMQQQA  131 (137)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            068999999877766655554444 3444555555555444443   45566666899999999988877764


No 5  
>TIGR03729 acc_ester putative phosphoesterase. Members of this protein family belong to the larger family pfam00149 (calcineurin-like phosphoesterase), a family largely defined by small motifs of metal-chelating residues. The subfamily in this model shows a good but imperfect co-occurrence in species with domain TIGR03715 that defines a novel class of signal peptide typical of the accessory secretory system.
Probab=50.46  E-value=9.7  Score=31.20  Aligned_cols=15  Identities=27%  Similarity=0.446  Sum_probs=11.2

Q ss_pred             CccccccCCCCCCcce
Q psy72           147 PANVACGPHTHGSWKS  162 (202)
Q Consensus       147 ~~~~~~~~~~~~~~~~  162 (202)
                      |.-+.|| |+|.++..
T Consensus       210 v~~~i~G-H~H~~~~~  224 (239)
T TIGR03729       210 IKDVIFG-HLHRRFGP  224 (239)
T ss_pred             CCEEEEC-CccCCCCC
Confidence            5556777 99999853


No 6  
>PF03288 Pox_D5:  Poxvirus D5 protein-like;  InterPro: IPR004968 This domain is found at the C terminus of phage P4 alpha protein and related proteins. Phage P4 DNA replication depends on the product of the alpha gene, which has origin recognition ability, DNA helicase activity, and DNA primase activity. The structure of the protein can be summarised as follows: The N terminus provides the primase activity, the central region is the helicase/nucleoside triphosphatase domain and the ori DNA recognition resides in the C-terminal 1/3 of the protein []. The domain is also found at the C terminus of a number of proteins from orthopox viruses including vaccinia virus D5. D5 encodes a 90kDa protein that is transiently expressed at early times after infection. It has an nucleoside triphosphatase activity which is independent of common nucleic acid cofactors and it can hydrolyse all the common ribo- and deoxyribonucleoside triphosphates to diphosphates in the presence of a divalent cation [].; PDB: 1KA8_E.
Probab=49.69  E-value=6.5  Score=27.62  Aligned_cols=11  Identities=64%  Similarity=1.552  Sum_probs=8.0

Q ss_pred             ehhhhccCCCC
Q psy72           169 FSWCRENGYGP  179 (202)
Q Consensus       169 ~~~~~~~~~~~  179 (202)
                      -.||++||+.|
T Consensus        32 ~~wc~~ng~~~   42 (86)
T PF03288_consen   32 KEWCEENGYKP   42 (86)
T ss_dssp             HHHHHHTT-S-
T ss_pred             HHHHHHhCCCc
Confidence            47999999998


No 7  
>PF09752 DUF2048:  Uncharacterized conserved protein (DUF2048);  InterPro: IPR019149  This family of proteins has no known function. 
Probab=40.30  E-value=8  Score=36.03  Aligned_cols=26  Identities=46%  Similarity=0.819  Sum_probs=20.4

Q ss_pred             ehhhhccCCCCccceeeecCCCCCCCCcccC
Q psy72           169 FSWCRENGYGPLFPCILLGTGSSLGPGMAMM  199 (202)
Q Consensus       169 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  199 (202)
                      .+||+++||||+-     =||.|+|--||-|
T Consensus       166 l~Wl~~~G~~~~g-----~~G~SmGG~~A~l  191 (348)
T PF09752_consen  166 LHWLEREGYGPLG-----LTGISMGGHMAAL  191 (348)
T ss_pred             HHHHHhcCCCceE-----EEEechhHhhHHh
Confidence            5899999999862     3688888777754


No 8  
>PF05381 Peptidase_C21:  Tymovirus endopeptidase;  InterPro: IPR008043 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].   This entry is found in cysteine peptidases belong to the MEROPS peptidase family C21 (tymovirus endopeptidase family, clan CA). The type example is tymovirus endopeptidase (turnip yellow mosaic virus). The noncapsid protein expressed from ORF-206 of turnip yellow mosaic virus (TYMV) is autocatalytically processed by a papain-like protease, producing N-terminal 150kDa and C-terminal 70kDa proteins.; GO: 0003968 RNA-directed RNA polymerase activity, 0016032 viral reproduction
Probab=39.58  E-value=7.3  Score=31.13  Aligned_cols=20  Identities=30%  Similarity=0.292  Sum_probs=14.7

Q ss_pred             hhhccc--ccCCCcccccCchhhh
Q psy72            24 SALWNG--EQGRSSLDNSTPKESY   45 (202)
Q Consensus        24 ERLWgL--EMfPesLtEMFPe~VR   45 (202)
                      |+||.-  ||+|||+=.  ++.++
T Consensus        19 ~~LW~~L~~~lPDSlL~--n~ei~   40 (104)
T PF05381_consen   19 ETLWATLCEILPDSLLD--NPEIR   40 (104)
T ss_pred             HHHHHHHHHhCchhhcC--chhhh
Confidence            789998  999998763  34444


No 9  
>KOG1819|consensus
Probab=36.06  E-value=21  Score=36.43  Aligned_cols=16  Identities=25%  Similarity=0.225  Sum_probs=11.6

Q ss_pred             HhHHHHHHhhhhhhhc
Q psy72            89 FEVQEMQRNQQKQWST  104 (202)
Q Consensus        89 ~QMEE~Q~qQQRQiLL  104 (202)
                      .|+|++|+|||-||-|
T Consensus       817 rqleqqqqqqqlqiql  832 (990)
T KOG1819|consen  817 RQLEQQQQQQQLQIQL  832 (990)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            4678888777777765


No 10 
>PF13975 gag-asp_proteas:  gag-polyprotein putative aspartyl protease
Probab=34.96  E-value=17  Score=25.36  Aligned_cols=35  Identities=17%  Similarity=0.178  Sum_probs=25.4

Q ss_pred             CCChhHHHHHhhhhhhcccccCCCcccccCchhhhccccc
Q psy72            11 KGSTSSVMKNLKGSALWNGEQGRSSLDNSTPKESYSAAGE   50 (202)
Q Consensus        11 ~~~~~~~~~~t~gERLWgLEMfPesLtEMFPe~VRSAAga   50 (202)
                      -|++.+.|-+.+++|| |++..+...    |.+++.|-|.
T Consensus        26 tGat~~fis~~~a~rL-gl~~~~~~~----~~~v~~a~g~   60 (72)
T PF13975_consen   26 TGATHNFISESLAKRL-GLPLEKPPS----PIRVKLANGS   60 (72)
T ss_pred             CCCcceecCHHHHHHh-CCCcccCCC----CEEEEECCCC
Confidence            4899999999999999 886555543    4455655553


No 11 
>PF11119 DUF2633:  Protein of unknown function (DUF2633);  InterPro: IPR022576  This family is conserved largely in Proteobacteria. Several members are named as YfgG. The function is not known. 
Probab=33.96  E-value=43  Score=24.59  Aligned_cols=24  Identities=8%  Similarity=0.192  Sum_probs=19.4

Q ss_pred             cceeehhhhhHHHhhhhhhhhhhh
Q psy72            65 RTSTWLIATSATVALLPIVFESQR   88 (202)
Q Consensus        65 rsAlWI~~TSfmILvlPVIFEtER   88 (202)
                      +-+-||..-||+|||.=++|..=-
T Consensus         8 ~mtriVLLISfiIlfgRl~Y~~I~   31 (59)
T PF11119_consen    8 RMTRIVLLISFIILFGRLIYSAIG   31 (59)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHh
Confidence            445699999999999988887543


No 12 
>PF06752 E_Pc_C:  Enhancer of Polycomb C-terminus;  InterPro: IPR009607 This entry represents the C terminus of eukaryotic enhancer of polycomb proteins, which have roles in heterochromatin formation []. This family contains several conserved motifs.
Probab=32.57  E-value=27  Score=31.36  Aligned_cols=15  Identities=33%  Similarity=0.552  Sum_probs=6.7

Q ss_pred             hhHhHHHHHHhhhhh
Q psy72            87 QRFEVQEMQRNQQKQ  101 (202)
Q Consensus        87 ER~QMEE~Q~qQQRQ  101 (202)
                      .|-|++++|++||+|
T Consensus        18 QkQQLaqiqqqQ~~~   32 (230)
T PF06752_consen   18 QKQQLAQIQQQQQQQ   32 (230)
T ss_pred             HHHHHHHHHHHHhhc
Confidence            334444444444444


No 13 
>PRK13892 conjugal transfer protein TrbC; Provisional
Probab=29.99  E-value=29  Score=29.06  Aligned_cols=17  Identities=6%  Similarity=-0.019  Sum_probs=14.6

Q ss_pred             CCCCCCCccchhhhhcc
Q psy72           118 NFENVEHHHPLKKILDT  134 (202)
Q Consensus       118 ~~~~~~h~~Pl~~~~~~  134 (202)
                      +++++|---||.||+|.
T Consensus        40 ~G~glPWE~pL~~I~~S   56 (134)
T PRK13892         40 TGGSLPYESWLTNLRNS   56 (134)
T ss_pred             CCCCCCchhHHHHHHHH
Confidence            37789999999999983


No 14 
>PF13664 DUF4149:  Domain of unknown function (DUF4149)
Probab=28.10  E-value=50  Score=23.69  Aligned_cols=29  Identities=21%  Similarity=0.463  Sum_probs=20.5

Q ss_pred             eeehhhhhHH-Hhhhhhhhhh-hhHhHHHHH
Q psy72            67 STWLIATSAT-VALLPIVFES-QRFEVQEMQ   95 (202)
Q Consensus        67 AlWI~~TSfm-ILvlPVIFEt-ER~QMEE~Q   95 (202)
                      ++|++++.+. ..+.|++|.. +|+|-.+.|
T Consensus         4 ~~w~G~~~~~~fvvap~lF~~L~~~~ag~i~   34 (101)
T PF13664_consen    4 ALWLGSMVFFTFVVAPVLFKALPRQQAGKIQ   34 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhCCHHHHHHHH
Confidence            5788888886 7889999985 444444333


No 15 
>PTZ00481 Membrane attack complex/ Perforin (MACPF) Superfamily; Provisional
Probab=27.67  E-value=64  Score=32.07  Aligned_cols=40  Identities=23%  Similarity=0.117  Sum_probs=26.0

Q ss_pred             HhHHHHHHhhhhhh-hcCCCccchhhcccCCCCCCCCccchhh
Q psy72            89 FEVQEMQRNQQKQW-STRPFSWLIFAFQGVNFENVEHHHPLKK  130 (202)
Q Consensus        89 ~QMEE~Q~qQQRQi-LLGP~aa~~~A~sG~~~~~~~h~~Pl~~  130 (202)
                      .+-.++|.++||++ -+||.+|-  |+.|-+.....|..|+.-
T Consensus       354 ~~~~q~qv~eqRrie~~~P~ta~--Aiqgng~~~~~~~~p~~~  394 (524)
T PTZ00481        354 QISYQQQVREQRRIERNGPRTAW--AIQGNGNCNGQLPLPLNY  394 (524)
T ss_pred             HHHHHHHHHHHHHHHhcCCcceE--EEccCccccCcccCCcce
Confidence            34344455556665 58999965  777776667777777653


No 16 
>PF10925 DUF2680:  Protein of unknown function (DUF2680);  InterPro: IPR024485 Members in this family of proteins are annotated as YckD however currently no function is known.
Probab=27.19  E-value=27  Score=24.87  Aligned_cols=9  Identities=33%  Similarity=0.970  Sum_probs=4.5

Q ss_pred             hhhccCCCC
Q psy72           171 WCRENGYGP  179 (202)
Q Consensus       171 ~~~~~~~~~  179 (202)
                      -|.+|||+|
T Consensus        51 ~~~qnGf~p   59 (59)
T PF10925_consen   51 YMQQNGFVP   59 (59)
T ss_pred             HHHHcCCCC
Confidence            345555554


No 17 
>TIGR03141 cytochro_ccmD heme exporter protein CcmD. The model for this protein family describes a small, hydrophobic, and only moderately well-conserved protein, tricky to identify accurately for all of these reasons. However, members are found as part of large operons involved in heme export across the inner membrane for assembly of c-type cytochromes in a large number of bacteria. The gray zone between the trusted cutoff (13.0) and noise cutoff (4.75) includes both low-scoring examples and false-positive matches to hydrophobic domains of longer proteins.
Probab=26.07  E-value=98  Score=20.53  Aligned_cols=15  Identities=20%  Similarity=0.423  Sum_probs=10.3

Q ss_pred             hhHhHHHHHHhhhhh
Q psy72            87 QRFEVQEMQRNQQKQ  101 (202)
Q Consensus        87 ER~QMEE~Q~qQQRQ  101 (202)
                      .|.+..|++++|+|+
T Consensus        30 ~r~~~~~l~~~~~r~   44 (45)
T TIGR03141        30 RRRLLRELRRLEARE   44 (45)
T ss_pred             HHHHHHHHHHHHHcc
Confidence            344577787777776


No 18 
>PF04995 CcmD:  Heme exporter protein D (CcmD);  InterPro: IPR007078 The CcmD protein is part of a C-type cytochrome biogenesis operon []. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation []. This protein is found fused to CcmE in P52224 from SWISSPROT. These proteins contain a predicted transmembrane helix.; GO: 0006810 transport, 0016021 integral to membrane
Probab=24.91  E-value=1.2e+02  Score=20.13  Aligned_cols=11  Identities=18%  Similarity=0.456  Sum_probs=6.0

Q ss_pred             HHHHHHhhhhh
Q psy72            91 VQEMQRNQQKQ  101 (202)
Q Consensus        91 MEE~Q~qQQRQ  101 (202)
                      ..+++++++|+
T Consensus        33 ~~~l~~~~~r~   43 (46)
T PF04995_consen   33 RKELKRLEARE   43 (46)
T ss_pred             HHHHHHHHHhH
Confidence            55555555554


No 19 
>KOG3648|consensus
Probab=24.62  E-value=59  Score=34.23  Aligned_cols=27  Identities=33%  Similarity=0.479  Sum_probs=13.5

Q ss_pred             hhhhhhhhhhHhHHHHHHhhhhhhhcCCC
Q psy72            79 LLPIVFESQRFEVQEMQRNQQKQWSTRPF  107 (202)
Q Consensus        79 vlPVIFEtER~QMEE~Q~qQQRQiLLGP~  107 (202)
                      -+|-++...+  ++++|+|||+|+-+=|-
T Consensus        62 ~~~~~~~~~~--~~~~~~~~~~~~~~~P~   88 (1179)
T KOG3648|consen   62 QLPQLLQSSQ--LQQQQQQQQQQQQLQPP   88 (1179)
T ss_pred             hhHHHHHHHH--HHHHHHHHHHHHhhCCC
Confidence            4566665544  44444444444444443


No 20 
>PF03746 LamB_YcsF:  LamB/YcsF family;  InterPro: IPR005501 This entry represents the uncharacterised protein family UPF0271, including LamB. The lam locus of Emericella nidulans (Aspergillus nidulans) consists of two divergently transcribed genes, lamA and lamB, involved in the utilization of lactams such as 2-pyrrolidinone. Both genes are under the control of the positive regulatory gene amdR and are subject to carbon and nitrogen metabolite repression []. The exact molecular function of the proteins in this family is unknown.; PDB: 1V6T_A 1XW8_A 2XU2_A 2DFA_A.
Probab=22.11  E-value=34  Score=30.47  Aligned_cols=27  Identities=33%  Similarity=0.550  Sum_probs=15.2

Q ss_pred             CccccccCCCCCCcceeeeeeeehhhhccC
Q psy72           147 PANVACGPHTHGSWKSLYLCLTFSWCRENG  176 (202)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  176 (202)
                      -+|+|||-|.- .=.+  .--|...|+++|
T Consensus        29 saNIACG~HAG-Dp~~--M~~tv~lA~~~g   55 (242)
T PF03746_consen   29 SANIACGFHAG-DPET--MRRTVRLAKEHG   55 (242)
T ss_dssp             EEEEE-SSSS---HHH--HHHHHHHHHHTT
T ss_pred             hHHHhhccccc-CHHH--HHHHHHHHHHcC
Confidence            48999999963 2222  223556677765


No 21 
>PRK05406 LamB/YcsF family protein; Provisional
Probab=21.91  E-value=30  Score=30.91  Aligned_cols=27  Identities=37%  Similarity=0.525  Sum_probs=15.9

Q ss_pred             CccccccCCCCCCcceeeeeeeehhhhccC
Q psy72           147 PANVACGPHTHGSWKSLYLCLTFSWCRENG  176 (202)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  176 (202)
                      -||+|||-|.-. =.  -.--|..-|.++|
T Consensus        31 sANIACG~HAGD-p~--~M~~tv~lA~~~g   57 (246)
T PRK05406         31 SANIACGFHAGD-PA--VMRRTVRLAKENG   57 (246)
T ss_pred             hHHHhccccCCC-HH--HHHHHHHHHHHcC
Confidence            489999999632 11  1223455566664


No 22 
>PRK12569 hypothetical protein; Provisional
Probab=21.84  E-value=29  Score=31.01  Aligned_cols=28  Identities=25%  Similarity=0.313  Sum_probs=18.5

Q ss_pred             CccccccCCCCCCcceeeeeeeehhhhccCC
Q psy72           147 PANVACGPHTHGSWKSLYLCLTFSWCRENGY  177 (202)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (202)
                      -||+|||-|.-.-.   -.--|...|+++|-
T Consensus        34 saNIACG~HAGDp~---~M~~tv~lA~~~~V   61 (245)
T PRK12569         34 SANIATGFHAGDPN---IMRRTVELAKAHGV   61 (245)
T ss_pred             hHHHhccccCCCHH---HHHHHHHHHHHcCC
Confidence            48999999974322   23346677787764


No 23 
>KOG4670|consensus
Probab=20.38  E-value=46  Score=33.52  Aligned_cols=32  Identities=28%  Similarity=0.373  Sum_probs=23.2

Q ss_pred             eeehhhhhHHHhhhhhhhhhhhH--hHHHHHHhhhhhh
Q psy72            67 STWLIATSATVALLPIVFESQRF--EVQEMQRNQQKQW  102 (202)
Q Consensus        67 AlWI~~TSfmILvlPVIFEtER~--QMEE~Q~qQQRQi  102 (202)
                      .+||-.|    ...|++=|.|.+  ||.++|.++|.||
T Consensus       368 R~win~t----iL~plvqeI~~vn~qfr~q~a~p~lqi  401 (602)
T KOG4670|consen  368 RLWINLT----ILDPLVQEIRTVNQQFRQQQAQPQLQI  401 (602)
T ss_pred             HHHHHHH----HHHHHHHHHHHHHHHHHHHhcCcccee
Confidence            4698777    457888888887  4777777776664


Done!