Diaphorina citri psyllid: psy7210

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MTKCICHDDTNEDTNPSRSVLMFPGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIAPPRNSPILDDTISSKRYPDINHAKIDSWTEFASWTHLANDGPYW

cccEEEEEEEECcccccccccEEEEEEEEEcccccEEEEEEEEccccccccCEEEEEEcccccccccccEEEEEEEEEccccccEEEEEEEEEccccEEEEccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccc

**KCICHDDTNEDTNPSRSVLMFPGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIAP***************YPDINHAKIDSWTEFASWTHLA***PYW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTKCICHDDTNEDTNPSRSVLMFPGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIAPPRNSPILDDTISSKRYPDINHAKIDSWTEFASWTHLANDGPYW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004721 [MF]	phosphoprotein phosphatase activity	probable	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0005981 [BP]	regulation of glycogen catabolic process	probable	GO:0043470, GO:0043471, GO:0043467, GO:0031329, GO:0060255, GO:0031323, GO:0009894, GO:0050794, GO:0010906, GO:0065007, GO:0010675, GO:0008150, GO:0019222, GO:0070873, GO:0006109, GO:0050789, GO:0032881, GO:0080090
GO:0005979 [BP]	regulation of glycogen biosynthetic process	probable	GO:0032881, GO:0043255, GO:0009889, GO:0080090, GO:0043467, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0010906, GO:0050789, GO:0010556, GO:0065007, GO:0010675, GO:0008150, GO:0032885, GO:0070873, GO:0006109, GO:0019222, GO:0010962
GO:0042587 [CC]	glycogen granule	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EEF, chain A
Confidence level:very confident
Coverage over the Query: 3-114
View the alignment between query and template
View the model in PyMOL