Diaphorina citri psyllid: psy7211


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MPTDYEVLLSHSPPIFSQSYFGCRYQPQRSPSALRRQFTTPSSLSLLKLQAPNQPVRPCLVTRPEDGNVSSGDENDPPSPTRIKKKVIFADDKGLSLTQVRLVKERPTSPPRWNSQFLALVTQGLNTEIIEPNNDLWEIMFSQPASNYLEFRKRLDEGKVSLENVIVKESENLVTGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIAPPRNSPILDDTISSKRYPDINHAKIDSWTEFASWTHLANDGPYWYL
cccccEEEECcccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEEEcccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHcccccEEEEEEEEEccccEEEEEEEEEcccccEEEEEEEECccccccCEEEEEEEcccccccccccCEEEEEEEEccccccEEEEEEEEEccccEEEcccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccc
MPTDYEVLL*****IFSQSYFGCR**************************************************************VIFADDKGLSLTQVRLVKERPT***RWNSQFLALVTQGLNTEIIEPNNDLWEIMFSQPASNYLEFRKRLDEGKVSLENVIVKESENLVTGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIA****************YPDINHAKIDSWTEFASWTHLANDGPYWYL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTDYEVLLSHSPPIFSQSYFGCRYQPQRSPSALRRQFTTPSSLSLLKLQAPNQPVRPCLVTRPEDGNVSSGDENDPPSPTRIKKKVIFADDKGLSLTQVRLVKERPTSPPRWNSQFLALVTQGLNTEIIEPNNDLWEIMFSQPASNYLEFRKRLDEGKVSLENVIVKESENLVTGTVKVRNLSFKKEVIIRYSTNNWTTFTDVKCAYVPSATPSSITIVYDTFAFQISIPKSAHQIEFCIAYKTENEEFWDNNNSKNYIIKKGIAPPRNSPILDDTISSKRYPDINHAKIDSWTEFASWTHLANDGPYWYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase 1 regulatory subunit 3B Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.confidentQ8C767
Protein phosphatase 1 regulatory subunit 3C-B Acts as a glycogen-targeting subunit for PP1 and regulates its activity. Activates glycogen synthase, reduces glycogen phosphorylase activity and limits glycogen breakdown.confidentQ6P950
Protein phosphatase 1 regulatory subunit 3B Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.confidentQ86XI6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000164 [CC]protein phosphatase type 1 complexprobableGO:0005737, GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019888 [MF]protein phosphatase regulator activityprobableGO:0019208, GO:0003674, GO:0030234
GO:0004721 [MF]phosphoprotein phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0005981 [BP]regulation of glycogen catabolic processprobableGO:0043470, GO:0043471, GO:0043467, GO:0031329, GO:0060255, GO:0031323, GO:0009894, GO:0050794, GO:0010906, GO:0065007, GO:0010675, GO:0008150, GO:0019222, GO:0070873, GO:0006109, GO:0050789, GO:0032881, GO:0080090
GO:0005979 [BP]regulation of glycogen biosynthetic processprobableGO:0032881, GO:0043255, GO:0009889, GO:0080090, GO:0043467, GO:0060255, GO:0031326, GO:0031323, GO:2000112, GO:0050794, GO:0010906, GO:0050789, GO:0010556, GO:0065007, GO:0010675, GO:0008150, GO:0032885, GO:0070873, GO:0006109, GO:0019222, GO:0010962
GO:0042587 [CC]glycogen granuleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0005977 [BP]glycogen metabolic processprobableGO:0044042, GO:0044238, GO:0044264, GO:0044262, GO:0015980, GO:0044260, GO:0005976, GO:0009987, GO:0044710, GO:0044237, GO:0043170, GO:0008152, GO:0071704, GO:0006112, GO:0008150, GO:0006073, GO:0005975, GO:0006091, GO:0055114

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EEF, chain A
Confidence level:very confident
Coverage over the Query: 135-264
View the alignment between query and template
View the model in PyMOL