BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy7214
         (201 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y69|F Chain F, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
 pdb|2Y69|S Chain S, Bovine Heart Cytochrome C Oxidase Re-Refined With
           Molecular Oxygen
          Length = 129

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 1   DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHW 59
           DPY     K TSGT++DPNLV S    R+VGC+CEED   ++W W+     +RC +CG  
Sbjct: 60  DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTH 119

Query: 60  FKL 62
           +KL
Sbjct: 120 YKL 122


>pdb|1OCC|F Chain F, Structure Of Bovine Heart Cytochrome C Oxidase At The
          Fully Oxidized State
 pdb|1OCC|S Chain S, Structure Of Bovine Heart Cytochrome C Oxidase At The
          Fully Oxidized State
 pdb|2OCC|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|2OCC|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|1OCO|F Chain F, Bovine Heart Cytochrome C Oxidase In Carbon
          Monoxide-bound State
 pdb|1OCO|S Chain S, Bovine Heart Cytochrome C Oxidase In Carbon
          Monoxide-bound State
 pdb|1OCR|F Chain F, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
          State
 pdb|1OCR|S Chain S, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
          State
 pdb|1OCZ|F Chain F, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 pdb|1OCZ|S Chain S, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
 pdb|1V54|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|1V54|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|1V55|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
          State
 pdb|1V55|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
          State
 pdb|2DYR|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|2DYR|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State
 pdb|2DYS|F Chain F, Bovine Heart Cytochrome C Oxidase Modified By Dccd
 pdb|2DYS|S Chain S, Bovine Heart Cytochrome C Oxidase Modified By Dccd
 pdb|2EIJ|F Chain F, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
          State
 pdb|2EIJ|S Chain S, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
          State
 pdb|2EIK|F Chain F, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
          C Oxidase In The Fully Reduced State
 pdb|2EIK|S Chain S, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
          C Oxidase In The Fully Reduced State
 pdb|2EIL|F Chain F, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
          C Oxidase In The Fully Oxidized State
 pdb|2EIL|S Chain S, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
          C Oxidase In The Fully Oxidized State
 pdb|2EIM|F Chain F, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
          Oxidase In The Fully Reduced State
 pdb|2EIM|S Chain S, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
          Oxidase In The Fully Reduced State
 pdb|2EIN|F Chain F, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
          Oxidase In The Fully Oxidized State
 pdb|2EIN|S Chain S, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
          Oxidase In The Fully Oxidized State
 pdb|2ZXW|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (1-S X-Ray Exposure Dataset)
 pdb|2ZXW|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (1-S X-Ray Exposure Dataset)
 pdb|3ABL|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (15-S X-Ray Exposure Dataset)
 pdb|3ABL|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (15-S X-Ray Exposure Dataset)
 pdb|3ABM|F Chain F, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (200-S X-Ray Exposure Dataset)
 pdb|3ABM|S Chain S, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
          State (200-S X-Ray Exposure Dataset)
 pdb|3ABK|F Chain F, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
          Reduced State (50k)
 pdb|3ABK|S Chain S, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
          Reduced State (50k)
 pdb|3AG1|F Chain F, Bovine Heart Cytochrome C Oxidase In The Carbon
          Monoxide-Bou Reduced State At 280 K
 pdb|3AG1|S Chain S, Bovine Heart Cytochrome C Oxidase In The Carbon
          Monoxide-Bou Reduced State At 280 K
 pdb|3AG2|F Chain F, Bovine Heart Cytochrome C Oxidase In The Carbon
          Monoxide-Bou Reduced State At 100 K
 pdb|3AG2|S Chain S, Bovine Heart Cytochrome C Oxidase In The Carbon
          Monoxide-Bou Reduced State At 100 K
 pdb|3AG3|F Chain F, Bovine Heart Cytochrome C Oxidase In The Nitric
          Oxide-Bound Reduced State At 100 K
 pdb|3AG3|S Chain S, Bovine Heart Cytochrome C Oxidase In The Nitric
          Oxide-Bound Reduced State At 100 K
 pdb|3AG4|F Chain F, Bovine Heart Cytochrome C Oxidase In The Cyanide
          Ion-Bound F Reduced State At 100 K
 pdb|3AG4|S Chain S, Bovine Heart Cytochrome C Oxidase In The Cyanide
          Ion-Bound F Reduced State At 100 K
 pdb|3ASN|F Chain F, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
          State Measured At 1.7470 Angstrom Wavelength
 pdb|3ASN|S Chain S, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
          State Measured At 1.7470 Angstrom Wavelength
 pdb|3ASO|F Chain F, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
          State Measured At 0.9 Angstrom Wavelength
 pdb|3ASO|S Chain S, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
          State Measured At 0.9 Angstrom Wavelength
 pdb|2YBB|Q Chain Q, Fitted Model For Bovine  Mitochondrial Supercomplex
          I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
          Length = 98

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 1/63 (1%)

Query: 1  DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHW 59
          DPY     K TSGT++DPNLV S    R+VGC+CEED   ++W W+     +RC +CG  
Sbjct: 29 DPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTH 88

Query: 60 FKL 62
          +KL
Sbjct: 89 YKL 91


>pdb|2ODX|A Chain A, Solution Structure Of Zn(Ii)cox4
          Length = 80

 Score = 28.1 bits (61), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 13 GTRDDPNLVRSAFKSRLVGCVCEEDQYH-IVWMWVEADMPRRC-ACGHWFKLKLI 65
          GT  DP ++ S    R VGC       H I+W+    +   RC  CG  +KL  +
Sbjct: 17 GTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPV 71


>pdb|1LF6|A Chain A, Crystal Structure Of Bacterial Glucoamylase
 pdb|1LF6|B Chain B, Crystal Structure Of Bacterial Glucoamylase
 pdb|1LF9|A Chain A, Crystal Structure Of Bacterial Glucoamylase Complexed With
           Acarbose
 pdb|1LF9|B Chain B, Crystal Structure Of Bacterial Glucoamylase Complexed With
           Acarbose
          Length = 684

 Score = 26.9 bits (58), Expect = 7.4,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 67  RGGVHVAIGSNWSKWILSSVGYLGQSDNLTKKDSNEQSVK 106
           R  V+ A+ SN   W   S+GY   +D +T  D N+Q  K
Sbjct: 183 RDNVYTALSSNIG-WKGYSIGYYKVNDIMTDLDENKQMTK 221


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,375,775
Number of Sequences: 62578
Number of extensions: 240640
Number of successful extensions: 346
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 344
Number of HSP's gapped (non-prelim): 6
length of query: 201
length of database: 14,973,337
effective HSP length: 94
effective length of query: 107
effective length of database: 9,091,005
effective search space: 972737535
effective search space used: 972737535
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)