Query         psy7214
Match_columns 201
No_of_seqs    117 out of 203
Neff          2.5 
Searched_HMMs 46136
Date          Fri Aug 16 21:03:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy7214.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/7214hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01215 COX5B:  Cytochrome c o 100.0 1.2E-33 2.6E-38  227.0   6.3   74    1-74     61-136 (136)
  2 PLN02294 cytochrome c oxidase  100.0 6.1E-33 1.3E-37  231.4   8.4   76    1-76     89-167 (174)
  3 cd00924 Cyt_c_Oxidase_Vb Cytoc 100.0 3.8E-32 8.2E-37  207.5   8.0   68    1-68     29-97  (97)
  4 KOG3352|consensus              100.0 5.3E-31 1.2E-35  216.2   7.3   69    1-69     83-152 (153)
  5 PTZ00043 cytochrome c oxidase   99.9 3.4E-26 7.4E-31  199.9   7.8   75    3-77    131-212 (268)
  6 PF10276 zf-CHCC:  Zinc-finger   96.0   0.011 2.4E-07   39.6   3.6   36   26-61      1-40  (40)
  7 KOG3456|consensus               94.5   0.031 6.7E-07   45.5   2.6   40   22-61     73-115 (120)
  8 COG4391 Uncharacterized protei  80.9     2.6 5.6E-05   31.2   3.7   44   18-63     15-61  (62)
  9 PF04216 FdhE:  Protein involve  54.1      11 0.00024   32.8   2.6   34   35-69    218-256 (290)
 10 COG5189 SFP1 Putative transcri  53.6     5.6 0.00012   38.0   0.7   16   46-61    393-409 (423)
 11 COG4647 AcxC Acetone carboxyla  51.5     6.3 0.00014   33.6   0.6   12   49-60     68-79  (165)
 12 PF09845 DUF2072:  Zn-ribbon co  45.2       8 0.00017   32.0   0.3   11   51-61      1-12  (131)
 13 PF09723 Zn-ribbon_8:  Zinc rib  44.8      30 0.00065   22.5   2.9   16   52-67      6-22  (42)
 14 KOG3507|consensus               43.9     9.7 0.00021   28.3   0.5   15   45-59     31-46  (62)
 15 smart00834 CxxC_CXXC_SSSS Puta  43.7      31 0.00067   21.2   2.7   11   53-63      7-18  (41)
 16 PF13912 zf-C2H2_6:  C2H2-type   42.7      15 0.00033   20.8   1.2   11   51-61      1-12  (27)
 17 COG3357 Predicted transcriptio  40.9      12 0.00025   29.9   0.6   19   50-68     57-76  (97)
 18 PF08882 Acetone_carb_G:  Aceto  38.6      28 0.00061   28.3   2.5   19   42-60     15-33  (112)
 19 COG3364 Zn-ribbon containing p  38.3      12 0.00027   30.4   0.4   11   51-61      2-13  (112)
 20 PF03604 DNA_RNApol_7kD:  DNA d  36.0      17 0.00036   23.3   0.7   16   46-61     12-28  (32)
 21 PF13719 zinc_ribbon_5:  zinc-r  34.4      28  0.0006   22.3   1.5   14   48-61     22-36  (37)
 22 TIGR02605 CxxC_CxxC_SSSS putat  32.9      37  0.0008   22.2   2.0   13   52-64      6-19  (52)
 23 PF13465 zf-H2C2_2:  Zinc-finge  32.3      29 0.00062   20.4   1.2   13   49-61     12-25  (26)
 24 smart00659 RPOLCX RNA polymera  31.6      29 0.00062   23.4   1.3   16   46-61     14-30  (44)
 25 PF09526 DUF2387:  Probable met  31.6      66  0.0014   23.7   3.3   37   29-65      6-45  (71)
 26 PF06397 Desulfoferrod_N:  Desu  30.8      41 0.00089   22.3   1.9   21   48-68      3-24  (36)
 27 PF12172 DUF35_N:  Rubredoxin-l  29.5      29 0.00062   21.7   1.0   10   51-60     11-21  (37)
 28 COG1326 Uncharacterized archae  28.0      33 0.00072   30.4   1.4   50   35-87     15-72  (201)
 29 PF10571 UPF0547:  Uncharacteri  27.5      20 0.00044   21.9  -0.0   11   51-61     14-25  (26)
 30 PRK03564 formate dehydrogenase  24.5      77  0.0017   29.2   3.1   31   37-67    234-269 (309)
 31 PHA00616 hypothetical protein   24.0      18 0.00038   24.9  -0.8   11   51-61      1-12  (44)
 32 COG1545 Predicted nucleic-acid  23.4      38 0.00083   27.2   0.9   16   46-61     22-40  (140)
 33 cd06404 PB1_aPKC PB1 domain is  21.6      77  0.0017   24.5   2.2   23   55-77     36-58  (83)
 34 PF04405 ScdA_N:  Domain of Unk  21.5      28  0.0006   24.4  -0.2   18  158-175    16-33  (56)
 35 COG2007 RPS8A Ribosomal protei  20.3 1.2E+02  0.0025   25.3   3.1   40  148-187    24-68  (127)
 36 PF00096 zf-C2H2:  Zinc finger,  20.1      59  0.0013   17.6   1.0    9   53-61      2-11  (23)

No 1  
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=100.00  E-value=1.2e-33  Score=227.05  Aligned_cols=74  Identities=41%  Similarity=0.862  Sum_probs=50.6

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeC-CCCCcceEEEEEecCCceee-cCCcEEEEEEecCCCCcccc
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVC-EEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRGGVHVAI   74 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtG-peDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~g~~~~~   74 (201)
                      |||||+|+++++||+||||||||++++|||||+| ++|+|+|+||||++|+|+|| +||+||||+++|+++++|.|
T Consensus        61 D~Fd~~~~~~~~GT~e~P~lVpS~~~~RiVGC~g~~~~sH~v~W~~l~~g~~~RCpeCG~~fkL~~vg~~~~~h~h  136 (136)
T PF01215_consen   61 DPFDMKPLKAPFGTKEDPILVPSYFDERIVGCTGEPDDSHDVIWFWLHKGKPQRCPECGQVFKLKYVGPEGDHHHH  136 (136)
T ss_dssp             -TT--S--B----SSSS-CEEEESSSCEEEEESSSTT-SSS-EEEEEETTSEEEETTTEEEEEEEE----------
T ss_pred             CcccccCccCCCCCccCCeEccCCCCceEEeeccCCCCcceeEEEEEeCCCccCCCCCCeEEEEEEcCCCCCCCCC
Confidence            8999999988899999999999999999999999 66888999999999999999 89999999999999988864


No 2  
>PLN02294 cytochrome c oxidase subunit Vb
Probab=99.98  E-value=6.1e-33  Score=231.35  Aligned_cols=76  Identities=29%  Similarity=0.630  Sum_probs=74.0

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeC--CCCCcceEEEEEecCCceee-cCCcEEEEEEecCCCCccccCC
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVC--EEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRGGVHVAIGS   76 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtG--peDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~g~~~~~gs   76 (201)
                      |||||+++++++||+||||||||++++|||||+|  ++|+|+|+||||++|+|+|| |||+||||+++|++++|+.||-
T Consensus        89 D~Fd~~~~~gp~GTke~P~lVpS~~d~RiVGCtg~~~eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~~vG~~~~~~~h~d  167 (174)
T PLN02294         89 KLLDIDFPEGPFGTKEAPAVVKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYFELEVVGPGGPPDGHGD  167 (174)
T ss_pred             CccccccccCCCCCccCCcEeccCCCceEEeeCCCCCCCCceeEEEEecCCCceeCCCCCCEEEEEEeCCCCCCCCCCC
Confidence            8999999999999999999999999999999999  89999999999999999999 8999999999999999999875


No 3  
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=99.97  E-value=3.8e-32  Score=207.46  Aligned_cols=68  Identities=49%  Similarity=1.023  Sum_probs=65.0

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeCCCCCcceEEEEEecCCceee-cCCcEEEEEEecCC
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRG   68 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtGpeDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~   68 (201)
                      |+|||+|+.+++||++|||||||++++|||||+|++|+|+|+||||++|+|+|| +||+||||++++++
T Consensus        29 d~f~~~~~~~~~GT~e~P~lVpS~~~~RiVGC~g~~~~h~v~W~~l~~g~~~rC~eCG~~fkL~~v~~~   97 (97)
T cd00924          29 DDFDMKPLKGPFGTKEDPNLVPSAFDKRIVGCICEPDSHDVIWMWLEKGKPKRCPECGHVFKLVDVGPP   97 (97)
T ss_pred             ccccccccccCCCCccCCeEecCCCCCeEEeeeCCCCCceEEEEEEeCCCceeCCCCCcEEEEEECCCC
Confidence            789999999888999999999999999999999988899999999999999999 69999999999864


No 4  
>KOG3352|consensus
Probab=99.97  E-value=5.3e-31  Score=216.25  Aligned_cols=69  Identities=46%  Similarity=0.939  Sum_probs=66.7

Q ss_pred             CCCCCCCCCCCCCCCCCCeeeecCCCceeEeeeCCCCCcceEEEEEecCCceee-cCCcEEEEEEecCCC
Q psy7214           1 DPYYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVCEEDQYHIVWMWVEADMPRRC-ACGHWFKLKLICRGG   69 (201)
Q Consensus         1 DPFDMkPLks~~GTKEDPiLVPS~~deRIVGCtGpeDSH~VvWf~L~KGkP~RC-ECGqwFKLv~vG~~g   69 (201)
                      |||||+.+++++||++|||||||++|+|||||.|++|+|+|+||||+||+++|| ||||||||+.+|+++
T Consensus        83 d~~d~k~~~~~~GTkedP~lV~S~~d~RiVGC~c~eD~~~V~Wmwl~Kge~~rc~eCG~~fkL~~v~~~~  152 (153)
T KOG3352|consen   83 DPFDMKVPRGPSGTKEDPNLVPSYYDKRIVGCGCEEDSHAVVWMWLEKGETQRCPECGHYFKLVPVGPVN  152 (153)
T ss_pred             CccccccccCCCCcccCCccccccCCceEEeecccCCCcceEEEEEEcCCcccCCcccceEEeeecCCCC
Confidence            799999669999999999999999999999999999999999999999999998 999999999999876


No 5  
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=99.93  E-value=3.4e-26  Score=199.91  Aligned_cols=75  Identities=25%  Similarity=0.422  Sum_probs=69.8

Q ss_pred             CCCCCCCCCCCCCCCCeeeecCCCceeEeeeC--CCCCcceEEEEEecCCceee-cCCcEEEEEE----ecCCCCccccC
Q psy7214           3 YYNGPFKRTSGTRDDPNLVRSAFKSRLVGCVC--EEDQYHIVWMWVEADMPRRC-ACGHWFKLKL----ICRGGVHVAIG   75 (201)
Q Consensus         3 FDMkPLks~~GTKEDPiLVPS~~deRIVGCtG--peDSH~VvWf~L~KGkP~RC-ECGqwFKLv~----vG~~g~~~~~g   75 (201)
                      +.++++.+++||+|||+||||++++|||||+|  ++|+|+|+|||+++|+++|| +||+||||++    ++++++|++.-
T Consensus       131 Lk~~~~~GPfGTkEdPiLVpSy~deRyVGCTGg~~EDeH~VvWFwLrEGkpqRCpECGqVFKLVr~~~s~~dg~dp~~~d  210 (268)
T PTZ00043        131 LKSSSFVGPFGTIENPVLVPSVGTERVVGCTGGTGEHEHVPLWFRCREGFLYRCGECDQIFMLVRVLYSLPDGEDPFPND  210 (268)
T ss_pred             cCcCCCCCCCCCccCCeEeccCCCceEEeccCCCccCCceeEEEEecCCCCccCCCCCcEEEEEEEEeecCCCCCCCCCC
Confidence            45678899999999999999999999999999  78899999999999999999 9999999999    99999999876


Q ss_pred             Cc
Q psy7214          76 SN   77 (201)
Q Consensus        76 s~   77 (201)
                      -.
T Consensus       211 pd  212 (268)
T PTZ00043        211 PD  212 (268)
T ss_pred             Cc
Confidence            43


No 6  
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=95.96  E-value=0.011  Score=39.63  Aligned_cols=36  Identities=22%  Similarity=0.386  Sum_probs=29.7

Q ss_pred             CceeEeeeC--CCCCcceEEEEEec-CCceee-cCCcEEE
Q psy7214          26 KSRLVGCVC--EEDQYHIVWMWVEA-DMPRRC-ACGHWFK   61 (201)
Q Consensus        26 deRIVGCtG--peDSH~VvWf~L~K-GkP~RC-ECGqwFK   61 (201)
                      +.|+|-|.|  .+-.|-.+|+.|.+ +++..| .||.-|+
T Consensus         1 ~~~~v~CdG~~~~lgHPrVyl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen    1 DGRRVSCDGGGGALGHPRVYLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             -SSEEEEEESSTTSCCCCEEEE-TTTTCEEEETTTTEEEE
T ss_pred             CCcEEEeCCCCCCCCCCeEEEecCCCCCeEECCCCCCEEC
Confidence            468999999  46889999999999 478999 7999885


No 7  
>KOG3456|consensus
Probab=94.45  E-value=0.031  Score=45.48  Aligned_cols=40  Identities=23%  Similarity=0.382  Sum_probs=35.8

Q ss_pred             ecCCCceeEeeeC--CCCCcceEEEEEecCCceee-cCCcEEE
Q psy7214          22 RSAFKSRLVGCVC--EEDQYHIVWMWVEADMPRRC-ACGHWFK   61 (201)
Q Consensus        22 PS~~deRIVGCtG--peDSH~VvWf~L~KGkP~RC-ECGqwFK   61 (201)
                      |+--+.|+|.|-|  ++=-|-.+|+.|.+..++-| .||--|.
T Consensus        73 p~e~d~RVV~CdGg~~aLGHPkvyInLDk~~~~~CgYCGlrf~  115 (120)
T KOG3456|consen   73 PIEVDGRVVACDGGTPALGHPKVYINLDKPGPHICGYCGLRFV  115 (120)
T ss_pred             hhhccceEEEecCCCCCCCCCeEEEEcCCCCCcccccchhhhh
Confidence            4556999999999  78899999999999999999 8998775


No 8  
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=80.89  E-value=2.6  Score=31.18  Aligned_cols=44  Identities=11%  Similarity=0.197  Sum_probs=32.9

Q ss_pred             CeeeecCCCceeEeeeC--CCCCcceEEEEEecCCceee-cCCcEEEEE
Q psy7214          18 PNLVRSAFKSRLVGCVC--EEDQYHIVWMWVEADMPRRC-ACGHWFKLK   63 (201)
Q Consensus        18 PiLVPS~~deRIVGCtG--peDSH~VvWf~L~KGkP~RC-ECGqwFKLv   63 (201)
                      ++.|.+..  --+-|.|  ++-+|-=+|+-+.+..-.-| .||..|+|.
T Consensus        15 ~~~I~~~~--~~l~C~g~~~p~~HPrV~L~mg~~gev~CPYC~t~y~l~   61 (62)
T COG4391          15 HETIEIGD--LPLMCPGPEPPNDHPRVFLDMGDEGEVVCPYCSTRYRLN   61 (62)
T ss_pred             ceEEEeCC--eeEEcCCCCCCCCCCEEEEEcCCCCcEecCccccEEEec
Confidence            44454432  2367999  57899999999966567899 699999985


No 9  
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=54.09  E-value=11  Score=32.77  Aligned_cols=34  Identities=12%  Similarity=0.206  Sum_probs=16.9

Q ss_pred             CCCCcceEEEEEecCC----ceee-cCCcEEEEEEecCCC
Q psy7214          35 EEDQYHIVWMWVEADM----PRRC-ACGHWFKLKLICRGG   69 (201)
Q Consensus        35 peDSH~VvWf~L~KGk----P~RC-ECGqwFKLv~vG~~g   69 (201)
                      +.+.+.-.|+.-.+++    ..-| .|++|+|..+ .+.+
T Consensus       218 g~~~~~~l~~~~~e~~~~~rve~C~~C~~YlK~vd-~~~~  256 (290)
T PF04216_consen  218 GNTDHEKLEYFTVEGEPAYRVEVCESCGSYLKTVD-REKD  256 (290)
T ss_dssp             ---SS-EEE--------SEEEEEETTTTEEEEEEE-TTT-
T ss_pred             CCCCCcceeeEecCCCCcEEEEECCcccchHHHHh-hhhC
Confidence            5566666666423333    3779 6999999999 4433


No 10 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=53.64  E-value=5.6  Score=38.00  Aligned_cols=16  Identities=38%  Similarity=0.891  Sum_probs=14.3

Q ss_pred             EecCCceeec-CCcEEE
Q psy7214          46 VEADMPRRCA-CGHWFK   61 (201)
Q Consensus        46 L~KGkP~RCE-CGqwFK   61 (201)
                      .-+++|.||| |+.-||
T Consensus       393 ~~~~KPYrCevC~KRYK  409 (423)
T COG5189         393 SAKDKPYRCEVCDKRYK  409 (423)
T ss_pred             cccCCceeccccchhhc
Confidence            6688999996 999998


No 11 
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=51.53  E-value=6.3  Score=33.57  Aligned_cols=12  Identities=50%  Similarity=1.071  Sum_probs=10.2

Q ss_pred             CCceeecCCcEE
Q psy7214          49 DMPRRCACGHWF   60 (201)
Q Consensus        49 GkP~RCECGqwF   60 (201)
                      ++..||+||+.|
T Consensus        68 ~rv~rcecghsf   79 (165)
T COG4647          68 KRVIRCECGHSF   79 (165)
T ss_pred             ccEEEEeccccc
Confidence            457999999987


No 12 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=45.23  E-value=8  Score=31.99  Aligned_cols=11  Identities=45%  Similarity=1.365  Sum_probs=9.5

Q ss_pred             ceee-cCCcEEE
Q psy7214          51 PRRC-ACGHWFK   61 (201)
Q Consensus        51 P~RC-ECGqwFK   61 (201)
                      |+|| .||..|.
T Consensus         1 PH~Ct~Cg~~f~   12 (131)
T PF09845_consen    1 PHQCTKCGRVFE   12 (131)
T ss_pred             CcccCcCCCCcC
Confidence            7899 8999985


No 13 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=44.84  E-value=30  Score=22.55  Aligned_cols=16  Identities=38%  Similarity=0.779  Sum_probs=10.6

Q ss_pred             eee-cCCcEEEEEEecC
Q psy7214          52 RRC-ACGHWFKLKLICR   67 (201)
Q Consensus        52 ~RC-ECGqwFKLv~vG~   67 (201)
                      .|| +||+.|....-..
T Consensus         6 y~C~~Cg~~fe~~~~~~   22 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSIS   22 (42)
T ss_pred             EEeCCCCCEEEEEEEcC
Confidence            578 6888887655433


No 14 
>KOG3507|consensus
Probab=43.91  E-value=9.7  Score=28.28  Aligned_cols=15  Identities=27%  Similarity=0.497  Sum_probs=12.8

Q ss_pred             EEecCCceee-cCCcE
Q psy7214          45 WVEADMPRRC-ACGHW   59 (201)
Q Consensus        45 ~L~KGkP~RC-ECGqw   59 (201)
                      .|..+.+-|| |||+-
T Consensus        31 ~lk~~D~irCReCG~R   46 (62)
T KOG3507|consen   31 TLKRGDVIRCRECGYR   46 (62)
T ss_pred             cccCCCcEehhhcchH
Confidence            3788999999 99973


No 15 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=43.65  E-value=31  Score=21.20  Aligned_cols=11  Identities=55%  Similarity=1.343  Sum_probs=5.9

Q ss_pred             ee-cCCcEEEEE
Q psy7214          53 RC-ACGHWFKLK   63 (201)
Q Consensus        53 RC-ECGqwFKLv   63 (201)
                      +| +||+.|.+.
T Consensus         7 ~C~~Cg~~fe~~   18 (41)
T smart00834        7 RCEDCGHTFEVL   18 (41)
T ss_pred             EcCCCCCEEEEE
Confidence            55 555555544


No 16 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=42.69  E-value=15  Score=20.83  Aligned_cols=11  Identities=45%  Similarity=1.168  Sum_probs=8.6

Q ss_pred             ceee-cCCcEEE
Q psy7214          51 PRRC-ACGHWFK   61 (201)
Q Consensus        51 P~RC-ECGqwFK   61 (201)
                      |.+| .|+..|.
T Consensus         1 ~~~C~~C~~~F~   12 (27)
T PF13912_consen    1 PFECDECGKTFS   12 (27)
T ss_dssp             SEEETTTTEEES
T ss_pred             CCCCCccCCccC
Confidence            5689 7999884


No 17 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=40.88  E-value=12  Score=29.93  Aligned_cols=19  Identities=37%  Similarity=0.723  Sum_probs=13.9

Q ss_pred             Cceee-cCCcEEEEEEecCC
Q psy7214          50 MPRRC-ACGHWFKLKLICRG   68 (201)
Q Consensus        50 kP~RC-ECGqwFKLv~vG~~   68 (201)
                      +|.|| .||..|.=..+-.+
T Consensus        57 ~Pa~CkkCGfef~~~~ik~p   76 (97)
T COG3357          57 RPARCKKCGFEFRDDKIKKP   76 (97)
T ss_pred             cChhhcccCccccccccCCc
Confidence            58999 79999976555433


No 18 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=38.59  E-value=28  Score=28.31  Aligned_cols=19  Identities=37%  Similarity=0.971  Sum_probs=14.4

Q ss_pred             EEEEEecCCceeecCCcEE
Q psy7214          42 VWMWVEADMPRRCACGHWF   60 (201)
Q Consensus        42 vWf~L~KGkP~RCECGqwF   60 (201)
                      .|..-.+++.-+|+|||.|
T Consensus        15 l~i~~~~~k~vkc~CGh~f   33 (112)
T PF08882_consen   15 LWIVQKKDKVVKCDCGHEF   33 (112)
T ss_pred             EEEEEecCceeeccCCCee
Confidence            4555555678999999987


No 19 
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=38.34  E-value=12  Score=30.43  Aligned_cols=11  Identities=45%  Similarity=1.331  Sum_probs=9.5

Q ss_pred             ceee-cCCcEEE
Q psy7214          51 PRRC-ACGHWFK   61 (201)
Q Consensus        51 P~RC-ECGqwFK   61 (201)
                      |+|| -||++|-
T Consensus         2 pH~CtrCG~vf~   13 (112)
T COG3364           2 PHQCTRCGEVFD   13 (112)
T ss_pred             Cceecccccccc
Confidence            7999 8999984


No 20 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=36.03  E-value=17  Score=23.31  Aligned_cols=16  Identities=38%  Similarity=0.900  Sum_probs=11.7

Q ss_pred             EecCCceee-cCCcEEE
Q psy7214          46 VEADMPRRC-ACGHWFK   61 (201)
Q Consensus        46 L~KGkP~RC-ECGqwFK   61 (201)
                      +..+.+-|| +||+.-.
T Consensus        12 ~~~~~~irC~~CG~RIl   28 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRIL   28 (32)
T ss_dssp             BSTSSTSSBSSSS-SEE
T ss_pred             cCCCCcEECCcCCCeEE
Confidence            667888999 8998543


No 21 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=34.40  E-value=28  Score=22.27  Aligned_cols=14  Identities=43%  Similarity=1.030  Sum_probs=11.4

Q ss_pred             cCCceee-cCCcEEE
Q psy7214          48 ADMPRRC-ACGHWFK   61 (201)
Q Consensus        48 KGkP~RC-ECGqwFK   61 (201)
                      .|...|| .|++.|.
T Consensus        22 ~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   22 GGRKVRCPKCGHVFR   36 (37)
T ss_pred             CCcEEECCCCCcEee
Confidence            4667999 7999985


No 22 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=32.86  E-value=37  Score=22.18  Aligned_cols=13  Identities=54%  Similarity=1.168  Sum_probs=10.8

Q ss_pred             eee-cCCcEEEEEE
Q psy7214          52 RRC-ACGHWFKLKL   64 (201)
Q Consensus        52 ~RC-ECGqwFKLv~   64 (201)
                      .+| +||+.|.+..
T Consensus         6 y~C~~Cg~~fe~~~   19 (52)
T TIGR02605         6 YRCTACGHRFEVLQ   19 (52)
T ss_pred             EEeCCCCCEeEEEE
Confidence            589 7999998764


No 23 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=32.33  E-value=29  Score=20.39  Aligned_cols=13  Identities=38%  Similarity=1.065  Sum_probs=10.5

Q ss_pred             CCceee-cCCcEEE
Q psy7214          49 DMPRRC-ACGHWFK   61 (201)
Q Consensus        49 GkP~RC-ECGqwFK   61 (201)
                      .+|..| .|+..|.
T Consensus        12 ~k~~~C~~C~k~F~   25 (26)
T PF13465_consen   12 EKPYKCPYCGKSFS   25 (26)
T ss_dssp             SSSEEESSSSEEES
T ss_pred             CCCCCCCCCcCeeC
Confidence            358999 7999884


No 24 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=31.59  E-value=29  Score=23.39  Aligned_cols=16  Identities=25%  Similarity=0.594  Sum_probs=11.9

Q ss_pred             EecCCceee-cCCcEEE
Q psy7214          46 VEADMPRRC-ACGHWFK   61 (201)
Q Consensus        46 L~KGkP~RC-ECGqwFK   61 (201)
                      +..+.+-|| +||+--.
T Consensus        14 ~~~~~~irC~~CG~rIl   30 (44)
T smart00659       14 IKSKDVVRCRECGYRIL   30 (44)
T ss_pred             cCCCCceECCCCCceEE
Confidence            446788999 8998443


No 25 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=31.57  E-value=66  Score=23.74  Aligned_cols=37  Identities=24%  Similarity=0.536  Sum_probs=24.0

Q ss_pred             eEeeeCCC-CCcceEEEEEecCC-ceee-cCCcEEEEEEe
Q psy7214          29 LVGCVCEE-DQYHIVWMWVEADM-PRRC-ACGHWFKLKLI   65 (201)
Q Consensus        29 IVGCtGpe-DSH~VvWf~L~KGk-P~RC-ECGqwFKLv~v   65 (201)
                      |.|=+||. .+-+.+=||-+.+. -..| +||+...+...
T Consensus         6 IAGa~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~~~~   45 (71)
T PF09526_consen    6 IAGAVCPKCQAMDTIMMWRENGVEYVECVECGYTERQPDQ   45 (71)
T ss_pred             ecCccCCCCcCccEEEEEEeCCceEEEecCCCCeeccCCc
Confidence            66778863 33344444555554 5899 99998776544


No 26 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=30.77  E-value=41  Score=22.27  Aligned_cols=21  Identities=19%  Similarity=0.355  Sum_probs=12.0

Q ss_pred             cCCceee-cCCcEEEEEEecCC
Q psy7214          48 ADMPRRC-ACGHWFKLKLICRG   68 (201)
Q Consensus        48 KGkP~RC-ECGqwFKLv~vG~~   68 (201)
                      +++..+| .||+...+...|.+
T Consensus         3 ~~~~YkC~~CGniVev~~~g~g   24 (36)
T PF06397_consen    3 KGEFYKCEHCGNIVEVVHDGGG   24 (36)
T ss_dssp             TTEEEE-TTT--EEEEEE--SS
T ss_pred             cccEEEccCCCCEEEEEECCCC
Confidence            4567899 69999988876643


No 27 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=29.53  E-value=29  Score=21.66  Aligned_cols=10  Identities=40%  Similarity=0.976  Sum_probs=5.4

Q ss_pred             ceee-cCCcEE
Q psy7214          51 PRRC-ACGHWF   60 (201)
Q Consensus        51 P~RC-ECGqwF   60 (201)
                      .+|| .||.++
T Consensus        11 ~~rC~~Cg~~~   21 (37)
T PF12172_consen   11 GQRCRDCGRVQ   21 (37)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEcCCCCCEe
Confidence            4899 899985


No 28 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=28.04  E-value=33  Score=30.36  Aligned_cols=50  Identities=20%  Similarity=0.200  Sum_probs=27.5

Q ss_pred             CCCCcceEEEEEecCC--ceee-cCCcEEE--EEEecCCCCc---cccCCchhhhHhhhcc
Q psy7214          35 EEDQYHIVWMWVEADM--PRRC-ACGHWFK--LKLICRGGVH---VAIGSNWSKWILSSVG   87 (201)
Q Consensus        35 peDSH~VvWf~L~KGk--P~RC-ECGqwFK--Lv~vG~~g~~---~~~gs~~~~~~~~~~~   87 (201)
                      ++-+|.++=.   +|.  .-|| +||+++.  ++...+-...   -.++-|+.+|+-.--|
T Consensus        15 eev~hEVik~---~g~~~lvrC~eCG~V~~~~i~~~k~~~v~viVS~~~~S~~~~vel~~g   72 (201)
T COG1326          15 EEVSHEVIKE---RGREPLVRCEECGTVHPAIIKTPKPVRVRVIVSRHEESFTKEVELDPG   72 (201)
T ss_pred             chhhHHHHHh---cCCceEEEccCCCcEeeceeeccccceEEEEEecCCcccceeEecCCC
Confidence            3444565322   344  5999 8999993  3332222211   1356788888754433


No 29 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=27.51  E-value=20  Score=21.91  Aligned_cols=11  Identities=36%  Similarity=0.890  Sum_probs=8.8

Q ss_pred             ceee-cCCcEEE
Q psy7214          51 PRRC-ACGHWFK   61 (201)
Q Consensus        51 P~RC-ECGqwFK   61 (201)
                      ..+| .||+.|.
T Consensus        14 ~~~Cp~CG~~F~   25 (26)
T PF10571_consen   14 AKFCPHCGYDFE   25 (26)
T ss_pred             cCcCCCCCCCCc
Confidence            4789 5999885


No 30 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=24.51  E-value=77  Score=29.18  Aligned_cols=31  Identities=13%  Similarity=0.462  Sum_probs=22.3

Q ss_pred             CCcceEEEEEecCC----ceee-cCCcEEEEEEecC
Q psy7214          37 DQYHIVWMWVEADM----PRRC-ACGHWFKLKLICR   67 (201)
Q Consensus        37 DSH~VvWf~L~KGk----P~RC-ECGqwFKLv~vG~   67 (201)
                      ++..+.++.+..+.    ..-| .|+.|.|..+...
T Consensus       234 ~~~~l~y~~~~~~~~~~r~e~C~~C~~YlK~~~~~~  269 (309)
T PRK03564        234 QSGKLHYWSLDSEQAAVKAESCGDCGTYLKILYQEK  269 (309)
T ss_pred             CCCceeeeeecCCCcceEeeecccccccceeccccc
Confidence            34567777776652    4779 6999999987654


No 31 
>PHA00616 hypothetical protein
Probab=24.01  E-value=18  Score=24.93  Aligned_cols=11  Identities=36%  Similarity=0.993  Sum_probs=7.6

Q ss_pred             ceee-cCCcEEE
Q psy7214          51 PRRC-ACGHWFK   61 (201)
Q Consensus        51 P~RC-ECGqwFK   61 (201)
                      |.+| +||..|.
T Consensus         1 pYqC~~CG~~F~   12 (44)
T PHA00616          1 MYQCLRCGGIFR   12 (44)
T ss_pred             CCccchhhHHHh
Confidence            4578 7887764


No 32 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=23.44  E-value=38  Score=27.19  Aligned_cols=16  Identities=19%  Similarity=0.644  Sum_probs=12.3

Q ss_pred             EecCCc--eee-cCCcEEE
Q psy7214          46 VEADMP--RRC-ACGHWFK   61 (201)
Q Consensus        46 L~KGkP--~RC-ECGqwFK   61 (201)
                      +.+|+.  .|| .||++|-
T Consensus        22 l~~~kl~g~kC~~CG~v~~   40 (140)
T COG1545          22 LKEGKLLGTKCKKCGRVYF   40 (140)
T ss_pred             hhhCcEEEEEcCCCCeEEc
Confidence            666774  999 7999873


No 33 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=21.62  E-value=77  Score=24.49  Aligned_cols=23  Identities=30%  Similarity=0.265  Sum_probs=20.2

Q ss_pred             cCCcEEEEEEecCCCCccccCCc
Q psy7214          55 ACGHWFKLKLICRGGVHVAIGSN   77 (201)
Q Consensus        55 ECGqwFKLv~vG~~g~~~~~gs~   77 (201)
                      .=++-|+|+++.++||+..+.|.
T Consensus        36 ~~~q~ft~kw~DEEGDp~tiSS~   58 (83)
T cd06404          36 HNDQPFTLKWIDEEGDPCTISSQ   58 (83)
T ss_pred             CCCCcEEEEEECCCCCceeecCH
Confidence            35789999999999999999874


No 34 
>PF04405 ScdA_N:  Domain of Unknown function (DUF542)  ;  InterPro: IPR007500 This is a domain of unknown function found at the N terminus of genes involved in cell wall development and nitrous oxide protection. ScdA is required for normal cell growth and development; mutants have an increased level of peptidoglycan cross-linking and aberrant cellular morphology suggesting a role for ScdA in cell wall metabolism []. NorA1, NorA2, and YtfE are involved in the nitrous oxide response. NorA1 and NorA2, which are similar to YtfE, are co-transcribed with the membrane-bound nitrous oxide (NO) reductases. The genes appear to be involved in NO protection but their function is unknown [, ]. 
Probab=21.46  E-value=28  Score=24.42  Aligned_cols=18  Identities=39%  Similarity=0.829  Sum_probs=15.8

Q ss_pred             ccccceeEEEecCCCCcc
Q psy7214         158 VHHFNRFRIRFGSGGNRT  175 (201)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~  175 (201)
                      ..=|++|+|-|--||||+
T Consensus        16 a~vf~~~gIDfCCgG~~~   33 (56)
T PF04405_consen   16 ARVFRKYGIDFCCGGNRS   33 (56)
T ss_pred             HHHHHHcCCcccCCCCch
Confidence            455999999999999997


No 35 
>COG2007 RPS8A Ribosomal protein S8E [Translation, ribosomal structure and biogenesis]
Probab=20.27  E-value=1.2e+02  Score=25.30  Aligned_cols=40  Identities=28%  Similarity=0.337  Sum_probs=27.9

Q ss_pred             hhhhhCCCCcccccce---eEEEecCCCCcccee--ccCCceeee
Q psy7214         148 SKLVLGRDPKVHHFNR---FRIRFGSGGNRTERL--QGKGNVFQA  187 (201)
Q Consensus       148 ~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~--~~~~~~~~~  187 (201)
                      .|..|||.|..+...-   +...-.-|||++-|+  +..+||+..
T Consensus        24 rK~elGreP~~t~ige~~~~~~vr~rGgn~K~r~~~~~~aNV~~p   68 (127)
T COG2007          24 RKFELGREPTETKIGEKRKRKKVRTRGGNFKVRALRAKTANVSDP   68 (127)
T ss_pred             hhhhcCCCCcccccCccceEEEEEeecCCeEEEEEEeccceeccc
Confidence            4678999999988754   222334689998886  456777664


No 36 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=20.06  E-value=59  Score=17.64  Aligned_cols=9  Identities=44%  Similarity=1.327  Sum_probs=6.7

Q ss_pred             ee-cCCcEEE
Q psy7214          53 RC-ACGHWFK   61 (201)
Q Consensus        53 RC-ECGqwFK   61 (201)
                      +| .||..|.
T Consensus         2 ~C~~C~~~f~   11 (23)
T PF00096_consen    2 KCPICGKSFS   11 (23)
T ss_dssp             EETTTTEEES
T ss_pred             CCCCCCCccC
Confidence            68 6888874


Done!