Diaphorina citri psyllid: psy7218


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MTACRNTAPLCFFPFQVLFQASDSGRPDRQLLGAGVVTTRAHVHYVVTEHGIAFLFGKTLRQRAHALINIAPPDHREALEKAAFERLKVMPCA
cccccccccCEEEEEEEECccccccccCEEccccccccccccccEEEEcccEEEcccccHHHHHHHHHHccccccHHHHHHHHHHHccccccc
*****NTAPLCFFPFQVLFQASDSGRPDRQLLGAGVVTTRAHVHYVVTEHGIAFLFGKTLRQRAHALINIAPPDHREALEKAAFERLKVMP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTACRNTAPLCFFPFQVLFQASDSGRPDRQLLGAGVVTTRAHVHYVVTEHGIAFLFGKTLRQRAHALINIAPPDHREALEKAAFERLKVMPCA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxybutyrate coenzyme A transferase confidentP38942

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006084 [BP]acetyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D3U, chain A
Confidence level:very confident
Coverage over the Query: 14-87
View the alignment between query and template
View the model in PyMOL